Amino Acids (AA)

<p>N-Boc-cis-4-hydroxy-L-proline methyl ester is a synthetic molecule that can be used to synthesize amides. It is typically prepared through a multistep process that begins with the condensation of an acid chloride and an amine. The reaction product is then treated with methyl chloroformate to produce the desired compound, which can be purified by recrystallization. N-Boc-cis-4-hydroxy-L-proline methyl ester has been used in the synthesis of nucleophilic and reactive molecules, as well as industrial processes.</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Pro-met-oh is an endoplasmic protein that is activated by the acidic α subunit. It belongs to a class of molecules called incompletely activated proteins, which are synthesized in the endoplasmic reticulum. H-Pro-met-oh has been shown to be a potential cancer therapeutic agent. The biochemical and cellular effects of this drug have been studied in vitro on C2C12 cells, which are mouse muscle cells. H-Pro-met-oh has been shown to stimulate fetal bovine growth factor (FGF), which may have therapeutic applications for treating cancer or other diseases where FGF levels are reduced.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>4-Bromo-2-methylthiophene is a linker that is used in the synthesis of metal carbonyls. It has been shown to be an efficient cross-linking agent for the preparation of polymers. 4-Bromo-2-methylthiophene can be isomerized to 2,5-dimethylthiophene by heating it with hydroxylamine. 4-Bromo-2-methylthiophene can also catalyze the alkylation of nucleophiles such as ammonia and dimethyl sulfate, as well as nucleophilic attack on carboxylic acid derivatives. This compound is acidic, due to its chloride substituent, which can react with basic groups such as hydroxyl groups or amines.</p>

<p>Please enquire for more information about Z-Gly-Gly-Arg-4MbNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-Methylpyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mbs-D-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>

<p>H-Lys-Tyr-Ser-OH is a molecule that is the product of a racemase enzyme. This molecule is an acid with a pKa of 2.6, which means that it can exist as either a D or L form at pH values less than 2.6. The D form is more stable and has greater solubility in water than the L form. H-Lys-Tyr-Ser-OH stabilizes the conformation of erythromycin and other antibiotics by binding to Murein, which is the cell wall component responsible for conferring resistance to these drugs.</p>

<p>(1,10-Phenanthroline)tris[4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedionato]europium(III) is a luminescent europium complex that is used in the development of microcapsules for fluorescence microscopy. The (1,10-phenanthroline) ligand is a chelate molecule that can be exchanged with other ligands to change the optical properties of the complex. The fluorescence microscope detects the emitted light at 488 nm and 514 nm wavelengths. The luminescent europium complex emits light when it binds to an organic molecule such as vinyl alcohol or water vapor. Ternary complexes are formed between the europium ion and two different ligands. Optical properties depend on the type of ligands present in these ternary complexes. This product has been shown to have chemical structures that are similar to those</p>

<p>Please enquire for more information about Z-N-Me-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Tyr-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-His-Leu-OH is a monoclonal antibody that is used in the diagnosis and treatment of prostate cancer. This drug binds to the extracellular domain of the human prostate epithelial cell antigen (PSA), which is overexpressed in prostate cancers. Z-Phe-His-Leu-OH can be used in combination with other drugs for the treatment of prostate hyperplasia, such as angiotensin II receptor antagonists or 5α reductase inhibitors. The conformational epitope of this antibody has been demonstrated by immunohistochemical analysis on human tissues.</p>

<p>3-Methyldihydrofuran-2,5-dione is a diterpenoid alkaloid found in the plant Dictamnus albus. This compound has been shown to have metal chelating properties and can be used as an asymmetric synthesis intermediate. 3-Methyldihydrofuran-2,5-dione reacts with diazonium salt to form a high resistance molecule that is highly reactive. This chemical reacts with hydroxyl groups, amide groups, or methyl ethyl groups. The structure of this compound consists of nitrogen atoms and anhydride bonds. 3-Methyldihydrofuran-2,5-dione has been shown to exhibit electrochemical impedance spectroscopy (EIS) characteristics similar to those of other molecules that are known to be reactive.</p>

<p>Please enquire for more information about Ginseng Tetrapeptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclo(leu-leu) is a glycosidase inhibitor that has been shown to have an inhibitory effect on the biosynthesis of aminoacylated proteins. Cyclo (leu-leu) is derived from the wild-type strain of a fungus, which is a genus of endophytic fungi. This compound inhibits the synthesis of proteins by binding to glycosylated amino acid residues and preventing their hydrolysis. Cyclo (leu-leu) also has homologous regions with mellein, which is another type of glycosidase inhibitor that binds to the enzyme protein kinase C, inhibiting protein synthesis and leading to cell death.</p>

<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Ile-OH is a cyclic peptide that has shown cytotoxic activity against cultured human brain cells. It is also an inhibitor of dipeptidyl peptidase IV (DPP-IV) and inhibits the breakdown of proteins in the brain, such as insulin. Fmoc-Ile-OH binds to the active site of DPP-IV and prevents it from binding to its substrate, thereby inhibiting the enzyme's activity. The inhibition of DPP-IV leads to increased levels of protein in the brain, which may be beneficial for people with Alzheimer's disease. Fmoc-Ile-OH is synthesized on a solid phase by coupling an amino acid with a protected carboxylic acid to yield a protected amide. This product can be used as an encapsulating agent for atosiban, a drug that is used to treat preterm labor.END&gt;&gt;</p>

<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>

<p>Please enquire for more information about Ac-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ser-Val-OH is a peptide that acts as a serotonin reuptake inhibitor. It has been shown to have antiangiogenic properties, which may be due to its ability to bind with the 5HT2A receptor and inhibit angiogenesis. H-Ser-Val-OH has also been shown to inhibit the growth of tumor cells in culture by binding to the peptide binding site on the growth factor receptor. H-Ser-Val-OH can be used for cancer therapy by increasing radiation sensitivity and inhibiting tumor perfusion.</p>

<p>Please enquire for more information about Ac-muramyl-Ala-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-1 fragment (22-38) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-[(4-Nitrophenyl)-azo]-phenol is a molecular compound that has a nitro group, an azo group, and a phenolic hydroxyl group. It's also known as nitrophenyl diazonium salt. 4-[(4-Nitrophenyl)-azo]-phenol is used in the synthesis of other compounds such as dyes and pharmaceuticals. The magnetic resonance spectroscopy and optical microscope techniques were used to study the chemical structure of 4-[(4-Nitrophenyl)-azo]-phenol. The titration method was used to determine the purity of this compound. 4-[(4-Nitrophenyl)-azo]-phenol has been shown to have mesomorphic properties, which are exhibited by its ability to be either solid or liquid at room temperature (25°C). This property may be due to its functional groups that stabilize it in both states.</p>

<p>Please enquire for more information about Fmoc-Pro-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-(Dmmb(Trt))Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>S-(p-Nitrobenzyl)glutathione acts as a competitive inhibitor of glutathionase.</p>

<p>S-Fcme activates multidrug resistance transporter by boosting ATPase activity and competing for drug binding.</p>

<p>S-Benzylglutathione acts as a competitive inhibitor of glutathionase and undergoes conversion by rat kidney microsomes into its cysteine derivatives.</p>

<p>Please enquire for more information about 4-Methyl-5-(2-phosphorylethyl)thiazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 10-Methyl-9-(phenoxycarbonyl)acridinium fluorosulfonate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bosentan is a potent inhibitor of the uptake of organic anions. It is used in the treatment of pulmonary arterial hypertension and has been shown to be effective against pravastatin-resistant HIV protease inhibitors, such as saquinavir, quinidine, and rosuvastatin. Bosentan inhibits uptake by binding to the transporter protein at a site that does not overlap with the binding site for organic anion substrates. This leads to a change in kinetic parameters for substrates, such as pravastatin and saquinavir. The binding site on bosentan may also be elucidated through monolayer experiments with efflux transporters.</p>

<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>

<p>Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.</p>

<p>4-Methylaminophenol sulfate is an enzyme substrate that is used in the analytical method for determining the concentration of potassium dichromate. It is prepared by reacting 4-methylaminophenol with sulfuric acid, and its optimum concentration is 0.2 mM. The linear calibration curve was obtained at a pH range of 2 to 5.4 and a temperature range of 25 to 37°C. The analytical method can be applied to human serum samples and has been shown to be applicable for studies on autoimmune diseases and anthelmintics.</p>

<p>Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Methyl-2-(1-methylbutyl)-5-propyl-1,3-dioxane is a bitter compound that is found in the fruit of the prickly pear cactus. It has been shown to be a protein-coupled receptor (PCR) ligand and a sweetener. 5-Methyl-2-(1-methylbutyl)-5-propyl-1,3-dioxane activates taste receptors on the tongue and in the gut. It also has been shown to function as an inhibitor of chemosensation in mammals.</p>

<p>4-Methyl-3-nitrophenyl isocyanate (4MPN) is a chiral diisocyanate that can be used as an activated diisocyanate. 4MPN is prepared by the carbonylation of 3-nitrobenzaldehyde and xylene with hydrogen chloride in the presence of a catalyst. Impurities, such as chlorides or sulfurs, can be detected using surface methodology techniques. The feedstock for this compound is usually xylene, which has a high boiling point. This product contains reactive functional groups that can be used to modify surfaces and create polyurethane products.</p>

<p>6-Amino-4-(4-phenoxyphenylethylamino)quinazoline is a potential anticancer drug that has been shown to inhibit the polymerase chain reaction in human osteosarcoma cells. It also inhibits the signaling pathway of nuclear factor-κB (NF-κB), which is involved in cell death and tumorigenesis. 6-Amino-4-(4-phenoxyphenylethylamino)quinazoline has shown significant cytotoxicity against murine hepatoma cells and bowel disease cells, but not against normal tissue. This drug is also an inhibitor of the drug transporter Pgp. 6-Amino-4-(4-phenoxyphenylethylamino)quinazoline has been shown to be effective in experimental models for cancer, AIDS, and other infectious diseases.</p>

<p>Please enquire for more information about N2-(S)-1-Carboxy-3-phenylpropyl-L-lysine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Isoleucine beta-naphthylamide is an amide derivative of L-isoleucine and 2-naphthylamine, which are carboxylic acid derivatives. The condensation of these two substances leads to the formation of a new compound with a carboxy group and an amino group.</p>

<p>3,3',5'-Triiodo-D-thyronine is a thyroid hormone that is used in the treatment of hypothyroidism. It is administered by injection or by mouth. 3,3',5'-Triiodo-D-thyronine is an insoluble drug, which means it cannot be dissolved in water. This drug can be injected into the body or taken as a pill. 3,3',5'-Triiodo-D-thyronine has been shown to increase metabolic rate and may also inhibit the growth of certain types of tumors. 3,3',5'-Triiodo-D-thyronine has been used in diagnostic procedures such as iontophoresis and implanting devices to treat prostate cancer. This medication can also be used for cosmetic purposes such as skin rejuvenation and hair loss prevention. 3,3',5'-Triiodo-D-thyronine has two structural isomers: levothyroxine and</p>

<p>Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N,N-bis(Carboxymethyl)-L-glutamic acid is a synthetic compound that functions as a disinfectant. It has been shown to be effective against bacteria and fungi in vitro, with an efficacy of over 90%. N,N-bis(Carboxymethyl)-L-glutamic acid is used as a treatment for tumors due to its ability to penetrate the tumor cells and inhibit fatty acid uptake. This compound also prevents the formation of new blood vessels by inhibiting the synthesis of DNA and RNA. N,N-bis(Carboxymethyl)-L-glutamic acid can be used in coatings for metals or metal surfaces that are exposed to water or air because it is biodegradable and noncorrosive.</p>

<p>Please enquire for more information about N-[5-[5-(2-Methyl-1-oxoisoindolin-5-yl)thien-2-yl]pyridin-3-yl]-2-nitrobenzenesulfonamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7-Fluoro-2-methylquinoline is a multistep synthetic compound that belongs to the family of quinoxalines. It has been shown to have potent antibacterial activity against a wide range of bacteria, including methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 7-Fluoro-2-methylquinoline was developed as an analog of the natural product quinoxaline. The key step in its synthesis is the reaction between an aldehyde and hydroxyalkylating reagent in the presence of iron catalyst. This process results in the formation of functional groups such as hydroxyls, alkoxy, or halogens.</p>

<p>Please enquire for more information about N6-Glycyl-L-lysine trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Palmitoyl-rac-glycero-3-phosphocholine is a biological lipid that has been shown to be a potent growth factor for cells in culture. It binds to DNA and modulates transcriptional regulation. 1-Palmitoyl-rac-glycero-3-phosphocholine also inhibits the production of lysophosphatidylcholine, which is an inflammatory mediator that promotes the release of histamine from mast cells. This compound may be useful as an antimicrobial agent, as it has been shown to inhibit the growth of bacteria and fungi.</p>

<p>Please enquire for more information about Fmoc-a-Me-Lys-OH hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Glutinen-3-ol is an antiinflammatory compound that belongs to the group of bioactive phenolic compounds. It has significant cytotoxicity and can be used in cancer therapy. 5-Glutinen-3-ol has been shown to inhibit the proliferation of cervical cancer cells by inducing apoptosis through a mechanism involving the activation of gamma-aminobutyric acid (GABA) receptors. This compound also inhibits oxidative stress induced by reactive oxygen species and protects cells from DNA damage, which may protect against cancer. 5-Glutinen-3-ol also has antioxidant properties, which can help prevent or alleviate metabolic disorders such as diabetes mellitus and atherosclerosis.</p>

<p>Boc-4-aminopiperidine is a molecule that is used as a substrate in chemical reactions. It reacts with sodium hydroxide solution to form an imine, which is hydrogenated by reducing agents such as NaBH4. This reaction yields the products 4-aminopiperidine and acetaldehyde. Boc-4-aminopiperidine is also utilized as a cholinesterase inhibitor, which inhibits the breakdown of acetylcholine at nerve endings. The inhibitory activity of Boc-4-aminopiperidine can be determined using diagnostic techniques and it can be used to inhibit viruses such as HIV and influenza A virus.</p>

<p>Please enquire for more information about 2,6-Difluoro-4-methoxyphenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.</p>

<p>8-Phenyltheophylline (8PT) is an adenosine receptor agonist that is used as a bronchodilator for the treatment of asthma. It has been shown to increase the intracellular calcium concentration in hl-60 cells and in rat papillary muscles. 8PT also has locomotor activating effects, which are thought to be due to its ability to block potassium channels in the hippocampal formation. These effects may be related to ATP-sensitive potassium channels, which have been shown to be sensitive to ATP in untreated mice. 8PT also has anti-arrhythmic properties, which may be due to its ability to inhibit sodium channels and its effect on heart rate and contractility.</p>

<p>Sildenafil is a drug that is used to treat erectile dysfunction. It inhibits the action of phosphodiesterase type 5 (PDE-5), an enzyme that breaks down the messenger cyclic guanosine monophosphate (cGMP) within the corpus cavernosum. This leads to increased levels of cGMP, which relaxes smooth muscle cells in the corpus cavernosum and allows for more blood flow into the penis. Sildenafil is synthesized from chrysanthemum morifolium, a plant also known as "shamrock." Sildenafil has been shown to have no effects on insulin resistance or lipid metabolism, but it does cause side effects such as headache, visual disturbances, and hearing loss.</p>

<p>N3-PEG(45)-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, N3-PEG(45)-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>Please enquire for more information about H-Glu(Gly-OH)-OH trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 8-Fluoro-6-methoxy moxifloxacin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asp-Phe-NH2 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-[5-(4-Fluorophenyl)-5-hydroxy-1-oxopentyl]-4-phenyl-2-oxazolidinone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-a-Me-Asn-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methyl-L-cysteine hydrochloride is a synthetic molecule that is used as an organic solvent. It can be produced from the reaction of an inorganic base with an ester hydrochloride and has been shown to have stereoselective properties. The spontaneous formation of this molecule was enhanced by the addition of hydrochloric acid, which increased the reaction yield. 2-Methyl-L-cysteine hydrochloride has been shown to react spontaneously with inorganic materials, such as titanium dioxide, which causes a color change from white to yellow.</p>

<p>L-Alanyl-L-proline tert-butyl ester (LAP) is a potent inhibitor of proteases, including angiotensin converting enzyme (ACE), and can be used as an antihypertensive drug. LAP binds to the active site of the ACE and blocks the conversion of angiotensin I to angiotensin II. This inhibition leads to a reduction in blood pressure. LAP has been shown to inhibit the activity of other proteases such as cathepsins, chymotrypsin, trypsin, elastase, and papain. LAP also has potential for use as an anticancer agent due to its ability to inhibit cancer cell growth by blocking protein synthesis at the ribosome level.</p>

<p>7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid (ABT) is a drug that binds to bacterial enzymes and inhibits their ability to synthesize proteins. ABT is a conjugate of fluoroquinolone and an amino acid. As the drug is degradable by hydrolysis, it has been shown to be less toxic in Sprague Dawley rats than other fluoroquinolones. This drug has been used in diagnostic tests as a ligand for affinity ligands, but has not been approved for human use. The drug also possesses functional groups that are important for binding to reconstituted enzymes.br&gt;br&gt;ABT's ester linkages are degradable by hydrolysis and can be</p>

<p>5-Hydroxy-5-methylhydantoin (5HMH) is a glycosylase that is used to repair damaged DNA. It reacts with the hydroxyl group of 5-methylcytosine and removes it, yielding thymine. The reaction proceeds through a nucleophilic attack on the carbon atom adjacent to the C5 methyl group. This reaction is dependent on neutral pH, uv absorption, and has been shown in vitro to be inhibited by the presence of oxidizing agents. 5HMH has been shown to remove UVB-induced damage from DNA in mammalian cells, which may lead to cancer.</p>

<p>Pyr-Pro-Arg-pNA hydrochloride salt is a chromogenic substrate that is used to detect microorganisms in the blood. This substrate is activated by the enzyme ochraceous, which catalyzes the hydrolysis of pyr-pro-arg-pNA. The reaction produces hydrogen peroxide and an orange color. Pyr-Pro-Arg-pNA hydrochloride salt can be used as an anticoagulant for blood plasma samples. It can also be used to identify Aspergillus ochraceus, a fungus that causes pulmonary infections in humans. Aspergillus ochraceus has been shown to produce this enzyme and to have a high affinity for this substrate.</p>

<p>Phenylalanine betaine is a naturally occurring amino acid that is found in food. Phenylalanine betaines are used as a model system for studying the effects of hydroxyl groups on protein structures and functions. It can be found in urine samples, which indicates its presence in the body. The molecular modeling of phenylalanine betaine has shown that it can function both as an amino acid and a beta-hydroxy acid. Its inhibition constant is 3.5 µM, which indicates that it may have an antibacterial activity.</p>

<p>[[4-[[2-(4-Cyclohexylphenoxy)ethyl]ethylamino]-2-methylphenyl]methylene]malononitrile (CAS #: 68436-91-7) is a reactive chemical species that has been used as a crosslinking agent and an uv absorption dye. CEM is a styryl dye that absorbs radiation in the uv range, with a maximum absorption at about 275 nm. It is a substrate film for light emission and can be used to measure viscosity. CEM is also chemically related to aromatic hydrocarbons and fatty acids, and can be synthesized from hydroxyl groups.</p>

<p>Please enquire for more information about Gly-arg-4-methoxy-beta-naphthylamide dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DL-alpha-Methyl-m-tyrosine (AMT) is a drug that is used to treat Parkinson's disease. It is an inhibitor of the uptake of dopamine and norepinephrine, which are neurotransmitters in the central nervous system. AMT blocks the action of a specific enzyme called aromatic L-amino acid decarboxylase, preventing the conversion of these neurotransmitters into their inactive metabolites. AMT also has been shown to be an antidepressant drug with stimulant properties. This may be due to its ability to inhibit uptake and release of monoamines in brain tissue.</p>

<p>Please enquire for more information about 5-Amino-4-methyl-4H-1,2,4-triazole-3-thiol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-[(1-Methylindole-3-yl)carbonyl]-4,5,6,7-tetrahydro-1H-bezimidazole is a reactive heterocyclic compound. It is a carboxylic acid and an amide with a peptic and cephalalgic effect. The symptoms of 5-[(1-methylindole-3-yl)carbonyl]-4,5,6,7-tetrahydro-1H-bezimidazole are hemicrania and amnesia. It has been expressed in the calf thymus DNA.</p>

<p>2-Methylthio-trans-zeatin is a naturally occurring sulfur containing compound found in plants. It has been shown to modulate the plant’s defense system, inducing the formation of nodules on the roots and increasing resistance against diseases. 2-Methylthio-trans-zeatin can also be used for bioanalytical purposes, as it can be used to detect other isomers of 2-methylthio-trans-zeatin. The compound can be detected by a number of methods such as mass spectrometry or chromatography. 2-Methylthio-trans-zeatin has been shown to inhibit bacterial growth by binding to the enzyme adenylyltransferase, which is essential for DNA replication. This mechanism of action is similar to that of quinolones, which are commonly used antibiotics.</p>

<p>L-Tryptophan methyl ester hydrochloride is an allylation product of L-tryptophan, which is a precursor to serotonin and melatonin. It is used in the synthesis of benzodiazepine receptor ligands and has serotonergic activity. L-Tryptophan methyl ester hydrochloride can be synthesized from L-tryptophan by amination reaction with methylamine and formaldehyde in the presence of a base. This chemical compound was also shown to have antitumour activity against MDA-MB231 breast cancer cells, which may be due to its ability to inhibit cell proliferation.</p>

<p>Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt is a prohormone that is biosynthesized from the amino acid decanoic acid. It has been shown to inhibit fatty acid synthesis and mineralization in tissue samples, as well as drug target enzymes such as human pathogens. Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt has also been shown to have insulin resistance properties and may be used for the treatment of metabolic disorders.</p>

<p>Please enquire for more information about (4S)-3,4-Dihydro-2-(3-methoxypropyl)-2H-thieno[3,2-e]-1,2-thiazin-4-ol 1,1-dioxide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-glu(OFm)-OH is a synthetic, cyclic, amide-type molecule that has been shown to reversibly inhibit the activity of purine nucleoside phosphorylase. Boc-glu(OFm)-OH is an affinity ligand for caco-2 cells and has been used in the development of vaccines for porcine rotavirus. This compound has also been shown to have neutralizing effects on both enteroviruses and adenoviruses. The structure of Boc-glu(OFm)-OH is highly structured and it can be prodruged into a variety of analogues with different pharmacological profiles.</p>

<p>Please enquire for more information about 1-Phenyl-4-[4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-benzyl]piperazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,6-Dimethyl-4-phenylpyronium tetrafluoroborate is a high quality reagent that is useful for the preparation of complex compounds. It is also a useful intermediate and building block. The CAS No. 97606-13-8, 2,6-Dimethyl-4-phenylpyronium tetrafluoroborate has been used in research chemicals and as a versatile building block for the synthesis of speciality chemicals. This reagent can be used in reactions to form many organic molecules that are not commercially available or difficult to synthesize.</p>

<p>Please enquire for more information about N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-2-(methoxymethoxy)-L-phenylalanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-2,6-dichloro-L-phenylalanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-type Natriuretic peptide is a peptide hormone that causes vasodilation, diuresis, and natriuresis. It is secreted by the heart and kidneys in response to volume overload. C-type Natriuretic peptide has been shown to cause fibrosis of the kidney as well as other tissues in mice. The binding of C-type Natriuretic peptide to its receptor activates cyclase, which converts ATP into cAMP. This leads to increased levels of cGMP, which causes smooth muscle relaxation and vasodilation.</p>

<p>Please enquire for more information about Ethyl2-(acetylamino)-3-[3,5-diiodo-4-(4-methoxyphenoxy)phenyl]propanoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>