
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,472 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38263 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)
CAS:<p>Please enquire for more information about (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C148H221N41O47SPurity:Min. 95%Molecular weight:3,358.65 g/molH-D-Arg(Pbf)-allyl ester hydrochloride
CAS:<p>Please enquire for more information about H-D-Arg(Pbf)-allyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H34N4O5S•HClPurity:Min. 95%Molecular weight:503.06 g/mol(Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molSuc-Ala-His-Pro-Phe-pNA
CAS:<p>Suc-Ala-His-Pro-Phe-pNA is an amide that binds to the casein kinase II, phosphatase, and inhibits cellular growth. The biochemical and cell specific activity of this drug target has been shown using biochemical and cellular assays. Suc-Ala-His-Pro-Phe-pNA has potent inhibitory activity against the enzyme phosphatase, which is a drug target for many diseases such as cancer. This compound also inhibits fk506 binding to endoplasmic reticulum protein FKBP12, which is a drug target for immunosuppressive therapy in organ transplantation. Suc-Ala-His-Pro-Phe-pNA has been shown to have high protease activity towards peptidyl substrates.</p>Formula:C33H38N8O9Purity:Min. 95%Molecular weight:690.7 g/molSuc-Ala-Ala-Pro-Val-AMC
CAS:<p>Suc-Ala-Ala-Pro-Val-AMC is a protease inhibitor that inhibits serine proteases by binding to the reactive site. It has been shown to inhibit prorenin, a renin enzyme that is involved in the regulation of blood pressure and kidney function. Suc-Ala-Ala-Pro-Val-AMC has also been shown to inhibit thrombin, which is involved in blood coagulation, and neutrophil elastase, which is responsible for the degradation of elastin fibers. Suc-Ala-Ala-Pro-Val-AMC has been shown to be effective against babesiosis, an infection caused by the protozoan parasite Babesia microti. This drug is expected to have a neutral pH and high detection sensitivity when used in clinical settings.</p>Formula:C30H39N5O9Purity:Min. 95%Molecular weight:613.66 g/molN-Me-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-Me-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H29N3O2Purity:Min. 95%Molecular weight:319.44 g/molBrain Injury Derived Neurotrophic Peptide
CAS:<p>Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala-Arg-Gly-Ala-Ile-Phe-Gln-Ala-NH2 is a growth factor that has been shown to have antiinflammatory and immunosuppressive effects in autoimmune diseases. It also has the ability to bind to peptides, proteins, and particle surfaces. This peptide has been shown to be effective against cancer cells by inhibiting tumor growth and increasing the effectiveness of radiation therapy. Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala Arg Gly Ala Ile Phe Gln Ala NH2 is also an immunosuppressant that can reduce inflammation caused by infectious diseases such as HIV/AIDS.</p>Formula:C62H102N18O18Purity:Min. 95%Molecular weight:1,387.58 g/molFmoc-Phe-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Met-Ser-OH
CAS:<p>H-Met-Ser-OH is a dihedral molecule that has an amino acid composition of H, Met, Ser, and OH. It is acidic and has efficiencies in polarizability and acceptor. The dipole moment of the molecule is hydrogen bonding interactions with sequences. The vibrational frequencies are computationally predicted by computational methods. The sulfate fractionation was used to determine the percent of H-Met-Ser-OH in human liver tissue.</p>Formula:C8H16N2O4SPurity:Min. 95%Molecular weight:236.29 g/molVIP (10-28) (human, mouse, rat)
CAS:<p>Angiotensin II is a peptide hormone that is involved in the regulation of blood pressure, water and electrolyte balance, and vascular resistance. It also plays a role in the development of angiogenic diseases such as cancer. Angiotensin II is an antagonist at the AT1 receptor, which is found on many tissues, including those in the brain, kidney, and vasculature. In addition to its effects on blood pressure and fluid retention, angiotensin II has been shown to affect intestinal motility and ileal absorption in rats. The inhibition of angiotensin II could be used for the treatment of neovascular diseases such as cancer.</p>Formula:C105H180N32O26SPurity:Min. 95%Molecular weight:2,338.82 g/molZ-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H43FN4O11Purity:Min. 95%Molecular weight:654.68 g/molH-Lys(Abz)-Pro-Pro-pNA
CAS:<p>H-Lys(Abz)-Pro-Pro-pNA is a potent and selective DPP-IV inhibitor that has been shown to be active in humans. This drug binds to the DPP-IV enzyme and prevents it from breaking down the incretin hormone, GLP-1, which is released by the intestine in response to food intake. This leads to increased insulin production and an improved glycemic profile in people with type 2 diabetes. H-Lys(Abz)-Pro-Pro-pNA also inhibits endoproteolysis of dipeptidyl peptidase IV (DPPIV), which reduces its activity against other enzymes such as amyloid beta protein precursor protein (APP) and angiotensin II receptor type 1 (AT1R).</p>Formula:C29H37N7O6Purity:Min. 95%Molecular weight:579.65 g/molHIV-1 gag Protein p17 (76-84) acetate salt
CAS:<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>Formula:C44H72N10O15Purity:Min. 95%Molecular weight:981.1 g/molH-D-Arg-Gly-Asp-Trp-OH
CAS:<p>H-D-Arg-Gly-Asp-Trp-OH is a cyclic peptide that has been shown to bind to staphylococcal cells, inhibiting their growth. The peptide was found to have proton binding and membrane interactions. This drug has shown efficacy in biological samples such as collagen and fibrinogen. H-D-Arg-Gly-Asp-Trp-OH also can be activated by a disulfide bond. It has been found to bind with monoclonal antibodies and model systems.</p>Formula:C23H32N8O7Purity:Min. 95%Molecular weight:532.55 g/molFmoc-D-Asn(Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Asn(Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Phe-Phe-Phe-OH
CAS:<p>Z-Phe-Phe-Phe-OH is an organic solvent that is homogeneous, has low solubility and a high boiling point. The epimerization of this compound can be achieved through the use of experimental methods. Z-Phe-Phe-Phe-OH is used in medicinal solvents as well as fields such as pharmacology and chemistry. This compound also has efficient methods for producing it and yields are detectable. There are also no residues from this compound.</p>Formula:C35H35N3O6Purity:Min. 95%Molecular weight:593.67 g/molACTH (34-39)
CAS:<p>Please enquire for more information about ACTH (34-39) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H50N6O9Purity:Min. 95%Molecular weight:722.83 g/mol4-Fluoro-2-methoxyphenol
CAS:<p>4-Fluoro-2-methoxyphenol is a fluorinating agent that is used in the manufacture of pharmaceuticals, plastics and pesticides. It has been shown to induce apoptosis in cultured cells by upregulating reactive oxygen species (ROS) and increasing mitochondrial membrane permeability, as well as inhibiting cellular physiology. 4-Fluoro-2-methoxyphenol also inhibits the production of ATP and may be toxic to cells by interfering with dinucleotide phosphate.</p>Formula:C7H7FO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:142.13 g/molBradykinin (2-7) acetate salt
CAS:<p>Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40N6O8Purity:Min. 95%Molecular weight:600.66 g/molH-Gly-Arg-bNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Gly-Arg-bNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H24N6O2Purity:Min. 95%Molecular weight:356.42 g/molSuc-Leu-Tyr-AMC
CAS:<p>AMC conjugated molecule targeting chymotrypsin-like peptidase, calpain I and II and papain, and Ti protease from E. coli</p>Formula:C29H33N3O8Purity:Min. 95%Molecular weight:551.59 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/molFA-Gly-Leu-OH
CAS:<p>FA-Gly-Leu-OH is a peptidase that catalyzes the hydrolysis of an amide bond in a peptide or protein. It has been shown to be active with acid sequences, as well as transpeptidation, which involves the transfer of a terminal amino acid from one peptide chain to another. FA-Gly-Leu-OH is also involved in the synthesis of proteins and peptides. This enzyme has high hydrolase activity and can hydrolyze most substrates at neutral pH values.</p>Formula:C15H20N2O5Purity:Min. 95%Molecular weight:308.33 g/molFA-Arg-Leu-OH
CAS:<p>Please enquire for more information about FA-Arg-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H29N5O5Purity:Min. 95%Molecular weight:407.46 g/molN-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N3O5Purity:Min. 95%Molecular weight:409.52 g/mol4-Methylsalicylamide
CAS:<p>4-Methylsalicylamide is a chemical compound that belongs to the class of isonicotinic amides. It is a potent anti-inflammatory agent with minimal inhibitory concentration (MIC) values of 4 µg/mL for gram-positive bacteria and 8 µg/mL for gram-negative bacteria. This compound has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. 4-Methylsalicylamide has been shown to have an inhibitory effect on ring-opening, which may be due to its ability to acetylate mitochondrial membranes, altering the membrane potential. The molecular modeling studies also showed that 4MSAM binds at the same site as antibiotics such as penicillin and erythromycin in bacterial ribos</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/molOvokinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H67N13O11Purity:Min. 95%Molecular weight:1,002.13 g/molH-Leu-Trp-Leu-OH
CAS:<p>H-Leu-Trp-Leu-OH is a tryptophan protease that has been shown to have aminopeptidase activity. It can be used in the treatment of intestinal inflammation, as well as other conditions where it is desirable to reduce the concentration of amino acid precursors. The oxidation products of H-Leu-Trp-Leu-OH are antigenic and can be used for the detection of this enzyme in biological fluids. Hplc analysis can identify tripeptides formed by H-Leu-Trp-Leu-OH, which are then cleaved by other enzymes. This process creates a radioactive product that can be detected using radiation or microscopy. Immunoaffinity chromatography is also able to isolate H-Leu-Trp-Leu-OH from biological fluids. Monoclonal antibodies against this enzyme have been shown to inhibit ectoenzymes such as lipases and phospholip</p>Formula:C23H34N4O4Purity:Min. 95%Molecular weight:430.54 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H51N11O7•C2HF3O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:839.86 g/molZ-Val-Phe-OMe
CAS:<p>Z-Val-Phe-OMe is an efficient method for the synthesis of a benzyl ester, which is a precursor to the anti-leishmanial drug Z-Val-Phe. The reaction is carried out in chloroform in the presence of ethyl or benzyl esters and ammonium chloride. This methodology was developed to provide a systematic approach to synthesize this compound. The reaction proceeds through a serine protease catalyzed hydrolysis of the amide bond on the surface of leishmania. Kinetic data shows that Z-Val-Phe-OMe has an IC50 value of 0.87 μM for leishmania and is more active than Z-Val-Phe against L. major, L. mexicana, and L. braziliensis strains.</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molCRF (6-33) (human, rat)
CAS:<p>CRF (6-33) is a neuropeptide that is found in the human cerebral cortex and rat liver. It has been shown to inhibit protein synthesis and sequenced by Edmond H. Fischer, who also discovered corticotropin-releasing factor (CRF). CRF (6-33) binds to its receptor CRFR1, which activates phospholipase C and generates inositol 1,4,5-triphosphate. This leads to the release of calcium from intracellular stores and the activation of protein kinase C. The release of calcium ions into the cytosol causes an increase in intracellular levels of cAMP, which activates a series of reactions responsible for the cellular effects of CRF. CRF (6-33) has been shown to be involved in depression by controlling neurotransmitter levels.br></p>Formula:C141H231N41O43SPurity:Min. 95%Molecular weight:3,220.66 g/mol(Tyr4,D-Phe12)-Bombesin
CAS:<p>Please enquire for more information about (Tyr4,D-Phe12)-Bombesin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H110N22O19SPurity:Min. 95%Molecular weight:1,679.9 g/molH-Lys-Asn-Asn-Gln-Lys-Ser-Glu-Pro-Leu-Ile-Gly-Arg-Lys-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Lys-Asn-Asn-Gln-Lys-Ser-Glu-Pro-Leu-Ile-Gly-Arg-Lys-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H133N25O23Purity:Min. 95%Molecular weight:1,741 g/molVIP sulfoxide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H238N44O43SPurity:Min. 95%Molecular weight:3,341.8 g/molH-Trp(Boc)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Acetyl-Cholecystokinin Octapeptide (2-8) (sulfated)
CAS:<p>Please enquire for more information about Acetyl-Cholecystokinin Octapeptide (2-8) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H59N9O14S3Purity:Min. 95%Molecular weight:1,070.22 g/mol(Deamino-Cys1,b-cyclohexyl-Ala4,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>Formula:C50H71N13O11S2Purity:Min. 95%Molecular weight:1,094.31 g/molEGF Receptor (988-993) (phosphorylated) (human)
CAS:<p>Please enquire for more information about EGF Receptor (988-993) (phosphorylated) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H46N7O16PPurity:Min. 95%Molecular weight:803.71 g/mol2-Bromo-3-methylbenzoic acid
CAS:<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>Formula:C8H7BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:215.04 g/molFmoc-Lys(Dabsyl)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Dabsyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H37N5O6SPurity:Min. 95%Molecular weight:655.76 g/molBradykinin (2-9) acetate salt
CAS:<p>Acetate salt</p>Formula:C44H61N11O10Purity:Min. 95%Molecular weight:904.02 g/molZ-Val-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H36N8O7Purity:Min. 95%Molecular weight:584.62 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molN-((RS)-2-Hydroxy-1-phenyl-ethyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-((RS)-2-Hydroxy-1-phenyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H35N3O3Purity:Min. 95%Molecular weight:425.56 g/molH-Arg-Trp-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O2·2HClPurity:Min. 95%Molecular weight:432.35 g/molFmoc-Tyr-Ala-OH
CAS:<p>Fmoc-Tyr-Ala-OH is a biochemical that is expressed in mammalian cells. It has been shown to activate enzymes and the production of proteins, which are essential for cell growth. Fmoc-Tyr-Ala-OH is also proteolytic and hydrolyzing, meaning it can be used to cleave proteins into smaller pieces. It has been shown to have acidic and neutral properties at different pH levels. This enzyme also has an inhibitory effect on the production of monoclonal antibodies in mcf-7 cells, which are derived from mouse mammary epithelial cells.</p>Formula:C27H26N2O6Purity:Min. 95%Molecular weight:474.51 g/molZ-Leu-Tyr-NH2
CAS:<p>Please enquire for more information about Z-Leu-Tyr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H29N3O5Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:427.49 g/molZ-Pro-D-Leu-D-Ala-NHOH
CAS:<p>Z-Pro-D-Leu-D-Ala-NHOH is a neutralizing peptide that inhibits the activity of elastase and collagenase. It also has potent inhibitory activities against experimental infection with various microorganisms, including Streptococcus pyogenes, Staphylococcus aureus, and Pseudomonas aeruginosa. This peptide is a molecule consisting of 11 amino acids, which is synthesized in vivo by the host as a response to bacterial infections. Z-Pro-D-Leu-D-Ala-NHOH can be used for pharmaceutical preparations or techniques that require an enzyme inhibitor. The biological function of this peptide is not fully understood but it has been shown to have antiestrogenic effects.</p>Formula:C22H32N4O6Purity:Min. 95%Molecular weight:448.51 g/mol(1S, 2R)-1-Phenyl-2-(1-pyrrolidinyl)-1-propanol
CAS:Controlled Product<p>Please enquire for more information about (1S, 2R)-1-Phenyl-2-(1-pyrrolidinyl)-1-propanol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19NOPurity:Min. 95%Color and Shape:PowderMolecular weight:205.3 g/mol(D-Trp6)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13·xC2H4O2Purity:Min. 95%Molecular weight:1,311.45 g/molH-D-His(1-Me)-OH hydrochloride salt
CAS:<p>Please enquire for more information about H-D-His(1-Me)-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H11N3O2Purity:Min. 95%Molecular weight:169.18 g/molBoc-Pro-Pro-Pro-Pro-OH
CAS:<p>Boc-Pro-Pro-Pro-Pro-OH is a synthetic peptide. It has been shown to have high specificity and is useful in the diagnosis of diseases that are caused by abnormal extracellular glutamic acid, hydroxyproline, or ion-exchange. Boc-Pro-Pro-Pro-Pro-OH has been used as a model for other peptides and has been shown to have acidic properties. The structure is dodecyl peptidic with a residue of -N(CH2)3-.</p>Formula:C25H38N4O7Purity:Min. 95%Molecular weight:506.59 g/molProadrenomedullin (1-20) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H177N37O28Purity:Min. 95%Molecular weight:2,477.83 g/mol(Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH (salmon)
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH (salmon) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H76N14O12Purity:Min. 95%Molecular weight:1,197.34 g/molH-Tyr-Tyr-OH
CAS:<p>Hydroxyl-Tyr-Tyr-OH is a fatty acid that belongs to the group of dietary lipids. It has been shown to have antioxidative properties and can be used in the treatment of pancreatic cancer. Hydroxyl-Tyr-Tyr-OH has also been shown to be an important regulatory molecule that controls certain cellular processes, including cell growth and differentiation. It may be involved in some disease processes, such as cancer and vasoactive intestinal peptide secretion, as well as being a reaction product of other molecules. Hydroxyl-Tyr-Tyr-OH can be found in urine samples after oral ingestion.</p>Formula:C18H20N2O5Purity:Min. 95%Molecular weight:344.36 g/molAc-Ile-Tyr-Gly-Glu-Phe-NH2
CAS:<p>Please enquire for more information about Ac-Ile-Tyr-Gly-Glu-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H44N6O9Purity:Min. 95%Molecular weight:668.74 g/molH-D-Leu-Tyr-OH
CAS:<p>H-D-Leu-Tyr-OH is a biochemically reactive compound that can undergo a number of reactions with other substrates. It is an amide that is converted to the tripeptides, H-D-leu-tyr and H-D-Phe-Lys, by hydrolysis in the liver. It is also converted to the condensation products, H-D-leu and H2NCH2COOH, by hydrochloric acid or metal ions. The formation rate of this compound depends on its concentration. The rate of reaction increases with increased substrate concentrations. This compound has an acidic pH and binds to a bidentate ligand, histidine.</p>Formula:C15H22N2O4Purity:Min. 95%Molecular weight:294.35 g/molOrcokinin
CAS:<p>Orcokinin H-Asn-Phe-Asp-Glu-Ile-Asp-Arg-Ser-Gly-Phe-Gly-Phe is a peptide that was synthesized in the laboratory. It has been shown to have receptor activity and to stimulate locomotor activity in experimental models. Orcokinin H is a member of the family of peptide hormones that are present in mammals. The peptide sequence contains six amino acids, four of which are hydrophobic and two polar, with a single hydroxyl group. These features make this molecule an excellent candidate for use as a model system for studying amyloid protein aggregation and its physiological function.</p>Formula:C67H92N18O23Purity:Min. 95%Molecular weight:1,517.55 g/molZ-Gly-Phe-Ala-OH
CAS:<p>Please enquire for more information about Z-Gly-Phe-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H25N3O6Purity:Min. 95%Molecular weight:427.45 g/mol(Des-Pyr 1,D-Ser(tBu)6,Azagly10)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Pyr 1,D-Ser(tBu)6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H79N17O12Purity:Min. 95%Molecular weight:1,158.31 g/molGalanin (1-13)-Neuropeptide Y (25-36) amide
CAS:<p>Please enquire for more information about Galanin (1-13)-Neuropeptide Y (25-36) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H209N41O34Purity:Min. 95%Molecular weight:2,962.37 g/molH-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H61N11O9SPurity:Min. 95%Molecular weight:848.03 g/molPACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C142H224N40O39SPurity:Min. 95%Molecular weight:3,147.61 g/molSerpinin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Serpinin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H202N32O46Purity:Min. 95%Molecular weight:2,865.11 g/molpTH (1-31) amide (human)
CAS:<p>pTH (1-31) amide is a polymer conjugate that is used to treat osteoporosis. It has been shown to be effective in reducing the risk of fracture and increasing bone mineral density in animals. The compound binds to the extracellular domain of the estrogen receptor, altering its conformation and preventing it from interacting with other proteins in the nucleus. pTH (1-31) amide has also been shown to reduce blood pressure in animals by inhibiting angiotensin-converting enzyme. Clinical data on this drug are limited, but it has been well tolerated so far.</p>Formula:C162H270N50O46S2Purity:Min. 95%Molecular weight:3,718.32 g/molPresenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C92H130N28O37SPurity:Min. 95%Molecular weight:2,252.25 g/molH-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H149N31O26SPurity:Min. 95%Molecular weight:2,017.32 g/mol(S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline)
CAS:<p>(S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline) is an asymmetric ligand that is chiral and has been shown to be useful in the preparation of enantiopure alcohols. The compound has been used as a catalyst to prepare aldehydes and ketones. It also has been used in reactions involving dehydration or alkylation. (S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline) can be synthesized by reacting molybdenum with an alcohol and adding a base. This reaction produces the desired product with high selectivity, which is due to its chirality.</p>Formula:C21H22N2O2Purity:Min. 95%Color and Shape:Colourless Or White To Yellow Solid Or Liquid (May Vary)Molecular weight:334.41 g/mol(5-Bromo-2-methoxyphenyl)acetic acid
CAS:<p>5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.</p>Formula:C9H9BrO3Purity:Min. 95%Color and Shape:PowderMolecular weight:245.07 g/molC3a (72-77) (human)
CAS:<p>Please enquire for more information about C3a (72-77) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H51N11O7Purity:Min. 95%Molecular weight:665.79 g/molMeOSuc-Ala-Ala-Pro-Ala-chloromethylketone
CAS:<p>MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone is a peptidyl substrate for the enzyme carboxypeptidase A. This substrate has a high specificity for carboxypeptidase A and does not bind to other enzymes such as carboxypeptidase B, D, or L. The hydrophobic nature of this substrate has been shown in both hamsters and macaques. MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone also shows cardiovascular effects in both animal models. It is possible that this effect is due to the proteolytic activity of the enzyme. More research needs to be done to identify the sequence of this peptide and how it may affect humans.</p>Formula:C20H31ClN4O7Purity:Min. 95%Molecular weight:474.94 g/molH-Leu-Val-Tyr-AMC
CAS:<p>H-Leu-Val-Tyr-AMC is a model compound that belongs to the group of sulfonamides. It is synthesized and used as a chymotrypsin-like protease inhibitor. H-Leu-Val-Tyr-AMC has been shown to inhibit the activity of chymotrypsin, a serine protease, by binding to its active site. This inhibition leads to an increase in the time required for digestion of proteins and peptides, which may be due to the steric hindrance created by the bulky H-Leu-Val-Tyr. H-Leu-Val-Tyr amide also has antiinflammatory properties, which are thought to be caused by its ability to inhibit prostaglandin synthesis.</p>Formula:C30H38N4O6Purity:Min. 95%Molecular weight:550.65 g/molH-D-Ala-Gln-OH
CAS:<p>H-D-Ala-Gln-OH is a modified structural analog of l-fucose that has been shown to be a potent immunostimulant in vitro. The hydrocarbon chain on this molecule is substituted with an H-D-Ala moiety, which provides the molecule with a hydroxyl group. This modification increases the solubility of the molecule, thereby making it more suitable for in vivo administration. Additionally, modifications to the hydrocarbon chain may have functional consequences on the molecule's activity (e.g., substitutions may increase or decrease its ability to induce interleukin).</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molZ-Gly-Gly-Leu-OH
CAS:<p>Glycylglycine is a hydrophobic amino acid that is found in collagen and other proteins. It has been shown to inhibit the activity of proteinases such as chymotrypsin, trypsin, and elastase, which are enzymes that break down proteins. Glycylglycine is a fluorescent molecule that can be detected by fluorescence microscopy and has been used in the study of protein-protein interactions. Glycylglycine is an acidic amino acid with an amino acid composition that consists of about 20% glycine, 40% hydroxyphenylalanine, 30% serine and 10% threonine. The spatial specificity of this compound has been studied using sephacryl electrophoresis, which showed it was localized to the extracellular matrix and in cell culture supernatants. Aminocoumarins are glycylglycines with an attached aminocoumarin group. Hydrolysis of gly</p>Formula:C18H25N3O6Purity:Min. 95%Molecular weight:379.41 g/mol(Deamino-Cys1,D-Orn 8)-Vasopressin
CAS:<p>Please enquire for more information about (Deamino-Cys1,D-Orn 8)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H62N12O12S2Purity:Min. 95%Molecular weight:1,027.18 g/molAc-Met-Asp-Lys-Val-Leu-Asn-Arg-Glu-OH
CAS:<p>Please enquire for more information about Ac-Met-Asp-Lys-Val-Leu-Asn-Arg-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H75N13O15SPurity:Min. 95%Molecular weight:1,046.2 g/mol3-Methylpentyl chloroformate
CAS:<p>Please enquire for more information about 3-Methylpentyl chloroformate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H13ClO2Purity:Min. 95%Molecular weight:164.63 g/mol3-Cyano-2-methylphenylboronic acid
CAS:<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>Formula:C8H8BNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:160.97 g/molBoc-4-Abz-OSu
CAS:<p>Please enquire for more information about Boc-4-Abz-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N2O6Purity:Min. 95%Molecular weight:334.32 g/mol(Pyr 1)-Opiorphin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H45N11O8Purity:Min. 95%Molecular weight:675.74 g/molNeural-Cadherin (76-85) amide (chicken)
CAS:<p>Please enquire for more information about Neural-Cadherin (76-85) amide (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H75N17O13Purity:Min. 95%Molecular weight:1,050.17 g/molpTH (1-31) (human)
CAS:<p>Please enquire for more information about pTH (1-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H269N49O47S2Purity:Min. 95%Molecular weight:3,719.3 g/molFITC-β-Ala-Amyloid β-Protein (1-40)
CAS:<p>Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C218H311N55O64S2Purity:Min. 95%Molecular weight:4,790.27 g/molH-β-Ala-Lys-OH·HCl
CAS:<p>Please enquire for more information about H-beta-Ala-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H19N3O3·HClPurity:Min. 95%Molecular weight:253.73 g/molH-Asp-Arg-OH
CAS:<p>H-Asp-Arg-OH is a histamine releasing factor. Histamine is a neurotransmitter that regulates the release of other neurotransmitters in the brain. It also has been shown to be an important mediator of inflammatory reactions and has been associated with asthma, allergic reactions, and inflammation. H-Asp-Arg-OH can be used as a histological stain for the detection of 8-hydroxyquinoline and its metabolites such as glucuronides in tissues. The distribution pattern of this compound can be visualized using infrared spectroscopy and β-glucuronidase activity can be detected by color change in histochemical reactions.</p>Formula:C10H19N5O5Purity:Min. 95%Molecular weight:289.29 g/molH-Glu-Val-Phe-OH
CAS:<p>H-Glu-Val-Phe-OH is a cytosolic protein that has been shown to react with a number of reactive oxygen species. It reacts with electrons by forming a disulfide bond, which can be reduced back to the original molecule by the addition of an electron donor. This chemical reaction may be important in radiation or chemical toxicity. H-Glu-Val-Phe-OH has been used as a monoclonal antibody in pharmacokinetic modeling and pharmacodynamic studies, and has been shown to have low clearance and high volume of distribution, suggesting that this protein is concentrated in the cytosol. H-Glu-Val-Phe-OH also has pharmacokinetic properties that are not well understood, but it is thought to be eliminated from the body at a rate similar to ornithine.</p>Formula:C19H27N3O6Purity:Min. 95%Molecular weight:393.43 g/molAMCA-Glu-Glu-Lys-Pro-Ile-Ser-Phe-Phe-Arg-Leu-Gly-Lys(biotinyl)-NH2
CAS:<p>Please enquire for more information about AMCA-Glu-Glu-Lys-Pro-Ile-Ser-Phe-Phe-Arg-Leu-Gly-Lys(biotinyl)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H131N21O22SPurity:Min. 95%Molecular weight:1,891.2 g/molHIV-1 gag Protein p24 (137-154)
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (137-154) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C92H158N26O26SPurity:Min. 95%Molecular weight:2,076.46 g/molH-Lys(acetimidoyl)-OH
CAS:<p>Lysine acetimidate is a reactive compound that can be activated by the addition of an acid. Lysine acetimidate is a potent activator of macrophages and other inflammatory cells. It has been used in experimental models to study bowel disease and repair mechanisms. In these models, lysine acetimidate has shown to have anti-inflammatory effects, which may be due to its ability to decrease the production of pro-inflammatory cytokines by immune cells. The metabolic disorder caused by lysine acetimidate is still being studied. Lysine acetimidate also has immunomodulatory effects, as it can inhibit the synthesis of epidermal growth factor (EGF) in lung cells and cause damage to alveolar type II cells in the lung.</p>Formula:C8H17N3O2Purity:Min. 95%Molecular weight:187.24 g/molMca-Pro-Leu-Gly-Pro-D-Lys(Dnp)-OH
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Pro-D-Lys(Dnp)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H52N8O14Purity:Min. 95%Molecular weight:892.91 g/mol(Des-Gly2)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly2)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H279N49O59SPurity:Min. 95%Molecular weight:4,129.52 g/mol(Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H68N10O12S2Purity:Min. 95%Molecular weight:1,089.29 g/molZ-Thr(tBu)-OSu
CAS:<p>Please enquire for more information about Z-Thr(tBu)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N2O7Purity:Min. 95%Molecular weight:406.43 g/molDnp-Pro-Gln-Gly-OH
CAS:<p>Please enquire for more information about Dnp-Pro-Gln-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H22N6O9Purity:Min. 95%Molecular weight:466.4 g/molACV trifluoroacetate salt
CAS:<p>ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt is a nonheme iron that has been shown to be an oxidizing agent. It is used in the synthesis of antibiotics and other organic compounds. ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt also has synthetase activity, which catalyzes the formation of a thiolate ligand from two molecules of acetyl coenzyme A (ACCOA) and one molecule of propionyl coenzyme A (PCCOA). This ligand binds to metal ions such as Fe2+, which are then reduced to Fe3+ by the metal cluster. The water ligands on the coordination sphere may be replaced by other ligands, such as lysine.</p>Formula:C14H25N3O6SPurity:Min. 95%Molecular weight:363.43 g/mol(Nle 10)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Nle 10)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H56N8O10Purity:Min. 95%Molecular weight:748.87 g/molHIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H79N11O14S2Purity:Min. 95%Molecular weight:1,050.3 g/molH-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Fluoro-6-methylbenzoic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H7FO2Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:154.14 g/molFmoc-D-thiazolidine-4-carboxylic acid
CAS:<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17NO4SPurity:Min. 95%Molecular weight:355.41 g/molpTH (53-84) (human)
CAS:<p>Please enquire for more information about pTH (53-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H253N43O54Purity:Min. 95%Molecular weight:3,510.86 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/molOrphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H195N37O37Purity:Min. 95%Molecular weight:2,832.13 g/molH-Phe-Val-OH
CAS:<p>H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.</p>Formula:C14H20N2O3Purity:Min. 98%Color and Shape:PowderMolecular weight:264.32 g/molZ-Ala-Pro-Tyr-OH
CAS:<p>Please enquire for more information about Z-Ala-Pro-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29N3O7Purity:Min. 95%Molecular weight:483.51 g/molGAP 26 trifluoroacetate salt
CAS:<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>Formula:C70H107N19O19SPurity:Min. 95%Molecular weight:1,550.78 g/molBoc-Ala-Pro-Nva-4-chloro-SBzl
CAS:<p>Please enquire for more information about Boc-Ala-Pro-Nva-4-chloro-SBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36ClN3O5SPurity:Min. 95%Molecular weight:526.09 g/molBAM-3200
CAS:<p>BAM-3200 is a small molecule with the chemical formula CHFOC(O)NHCHCOOH. It is a potent and selective agonist of the TrkB receptor, which binds to brain-derived neurotrophic factor (BDNF). BAM-3200 has been shown to have anti-cancer activity in mouse tumor models, as well as increased locomotor activity and improved memory retention in mice. The biological function of BAM-3200 is not yet known. Structural analysis shows that it binds to the hydroxyl group on mammalian tissue receptors, which may be due to its basic protein structure. BAM-3200 also has been shown to hydrolyze enzymes such as esterases, glucuronidases, or glutathione reductase. This agent has been shown to be selectively active against cancer cells by binding to their acidic surface structures and altering their acidity.</p>Formula:C147H207N41O34S2Purity:Min. 95%Molecular weight:3,156.6 g/mol(Ala92)-Peptide 6
CAS:<p>Please enquire for more information about (Ala92)-Peptide 6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C93H155N31O26Purity:Min. 95%Molecular weight:2,123.42 g/molAc-muramyl-Ala-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-Ala-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/molH-Val-Leu-OH·HCl
CAS:<p>H-Val-Leu-OH·HCl is a hydrolytic cleavage product of the covalent adduct of valproic acid and HCl. It is an acidic compound that can be produced by hydrolysis or by exposure to alcohols. This compound is also known as ethylene glycol monobutyl ether, which is formed when ethylene reacts with butanol. H-Val-Leu-OH·HCl has been shown to cause termination in animal experiments and has been detected in humans following alcohol exposure. It also has some toxic effects on animals such as liver damage, kidney damage, and death.</p>Formula:C11H22N2O3·HClPurity:Min. 95%Molecular weight:266.76 g/molCholecystokinin Octapeptide (1-6) (desulfated)
CAS:<p>Please enquire for more information about Cholecystokinin Octapeptide (1-6) (desulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H47N7O10S2Purity:Min. 95%Molecular weight:801.93 g/molN-α-Allyloxycarbonyl-N-ε-2-Fmoc-L-lysine
CAS:<p>The synthesis of semaglutide is accomplished by a solid-phase synthetic route. The peptide is synthesized on a polymeric support. The side chains are assembled in the liquid phase and then condensed with the peptide chain. The condensation reaction between the side chains and peptide chain is catalyzed by an acid such as trifluoroacetic acid or ethyl chloroformate. Semaglutide was synthesized using this method to produce high purity, concentration, and yield.</p>Formula:C25H28N2O6Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:452.5 g/molACTH (1-39) (guinea pig)
CAS:<p>Please enquire for more information about ACTH (1-39) (guinea pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C206H308N56O58SPurity:Min. 95%Molecular weight:4,529.06 g/mol2-Bromo-5-hydroxy-4-methoxybenzaldehyde
CAS:<p>2-Bromo-5-hydroxy-4-methoxybenzaldehyde is a death pathway inhibitor that has been shown to have radiosensitizing effects in vitro. It has also been found to inhibit the expression of matrix metalloproteinase (MMP) in human glioma cells and in a rat model of cerebral ischemia. This compound may be used as a potential chemotherapeutic agent for the treatment of cancer. 2-Bromo-5-hydroxy-4-methoxybenzaldehyde inhibits cell proliferation by inducing apoptosis, or programmed cell death, which may be due to its ability to suppress MMP activity.</p>Formula:C8H7BrO3Purity:Min. 95%Color and Shape:PowderMolecular weight:231.04 g/mol(D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H106N22O12Purity:Min. 95%Molecular weight:1,375.67 g/molH-D-Phe-D-Phe-OH
CAS:<p>H-D-Phe-D-Phe-OH is a polypeptide that contains 24 amino acids. It is synthesized by the filamentous fungus, Aspergillus niger, and has been found to be an optimal substrate for aminopeptidase. H-D-Phe-D-Phe-OH has also been shown to be a homolog of the halophilic enzyme from Halobacterium salinarum.</p>Formula:C18H20N2O3Purity:Min. 95%Molecular weight:312.36 g/molAcetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N32O21Purity:Min. 95%Molecular weight:2,240.7 g/molFmoc-Tyr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Cys(Acm)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(Acm)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Methoxy estrone
CAS:Controlled Product<p>2-Methoxy estrone is a metabolite of estrone and is produced by the enzyme 2-hydroxylase. This compound has minimal toxicity and can be used as a marker for biological processes, such as cellular transformation. 2-Methoxy estrone has been shown to inhibit the activity of acetylcholinesterase, an enzyme that breaks down acetylcholine, which is essential for neurotransmission. It has also been implicated in the regulation of angiogenic processes in vitro and in vivo. The role of 2-methoxy estrone in cancer cells is not fully understood but it may have potential as a biomarker for prostate cancer and breast cancer.</p>Formula:C19H24O3Purity:(%) Min. 95%Color and Shape:PowderMolecular weight:300.39 g/mol(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone
CAS:<p>(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone is an organic compound that belongs to the class of carbonyl reductase. It is used as a catalyst for the transformation of secondary alcohols to ketones or aldehydes, including isopropyl alcohol. The reaction proceeds via an intermediate carboxylic acid. The enzyme has been found in various microorganisms, and can be purified from Bacillus megaterium and Streptomyces lividans. The enzyme’s activity can be inhibited by steric effects, metal ions, or other compounds. (3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone crystallizes in two forms: one with the chiral center at the 3 position and one with it at the 4 position.</p>Purity:Min. 95%(Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H206N44O35SPurity:Min. 95%Molecular weight:2,857.26 g/molFmoc-Ala-Ala-Pro-OH
CAS:<p>Fmoc-Ala-Ala-Pro-OH is a building block that is used in organic synthesis as a reaction component or reagent. It can be used to synthesize a wide range of complex compounds with speciality chemical and fine chemical applications. Fmoc-Ala-Ala-Pro-OH is also a versatile building block that can be used to synthesize various useful scaffolds, such as the Fmoc amino acid sequence, which has been shown to bind heparin. This compound has high purity and can be used in research and development.</p>Formula:C26H29N3O6Purity:Min. 95%Color and Shape:PowderMolecular weight:479.53 g/mol(D-Ala2)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molAtrial Natriuretic Factor (1-24) (frog)
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (1-24) (frog) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H165N37O34S3Purity:Min. 95%Molecular weight:2,561.84 g/molZ-Lys-Leu-OH
CAS:<p>Please enquire for more information about Z-Lys-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H31N3O5Purity:Min. 95%Molecular weight:393.48 g/molFmoc-Pro-Phe-OH
CAS:<p>Please enquire for more information about Fmoc-Pro-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H28N2O5Purity:Min. 95%Molecular weight:484.54 g/mol(Tyr0)-Stresscopin-Related Peptide (human)
CAS:<p>Please enquire for more information about (Tyr0)-Stresscopin-Related Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C214H367N69O59Purity:Min. 95%Molecular weight:4,850.63 g/molAbz-Ala-Gly-Leu-Ala-p-nitrobenzylamide
CAS:<p>Benzamidine is a benzamidase inhibitor that competitively binds to bacterial enzymes such as metalloendopeptidases and matrix metalloproteinases. It inhibits the degradation of collagen, resulting in a higher concentration of soluble extract. This drug also has an effect on spermatozoa, which may be due to its ability to inhibit bacterial enzymes that are involved with uptake and preload. Benzamidine has been shown to have a pH optimum of 8-9 and is most active at this pH range.</p>Formula:C28H37N7O7Purity:Min. 95%Molecular weight:583.64 g/molOsteoblast-Adhesive Peptide
CAS:<p>Please enquire for more information about Osteoblast-Adhesive Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H43N11O6Purity:Min. 95%Molecular weight:545.64 g/molIsopropyl 4-methylbenzenesulfonate
CAS:<p>Isopropyl 4-methylbenzenesulfonate is a chemical that is used in the preparation of pharmaceuticals. It is used as an intermediate in the production of sorafenib, an anticancer drug, and has been shown to be genotoxic. Isopropyl 4-methylbenzenesulfonate reacts with nucleophiles by nucleophilic attack. The compound has been found to be a competitive inhibitor of growth factor receptors and can inhibit uv absorption in skin cells. Isopropyl 4-methylbenzenesulfonate is typically analyzed using ionization techniques such as gas chromatography or liquid chromatography with mass spectrometry. This chemical can react with fatty acids, leading to the formation of carbonyl groups. Chemical ionization may also be used for sample preparation.</p>Formula:C10H14O3SPurity:Min. 95%Molecular weight:214.28 g/molH-Gly-Gly-Sar-OH
CAS:<p>Gly-Gly-Sar is a synthetic peptide that acts as a substrate for the peptide transporter, which is part of the membrane of cells. It is an amide with a reactive group that can form a ternary complex with two hydroxyl ions and one proton. Gly-Gly-Sar has been shown to be taken up by caco-2 cells in an extravesicular manner and undergoes proteolysis by peptidases. This leads to bond cleavage and formation of free Gly-Gly and Sar. The free Gly and Gly are then transported across the cell membrane into the cell cytoplasm, where they are hydroxylated by enzymes such as glycyl-l-leucine hydroxylase to form glycolic acid and glyoxylic acid, respectively.</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/mol1,3,5-Tri(1-phenyl-1H-benzo[d]imidazol-2-yl)phenyl
CAS:<p>1,3,5-Tri(1-phenyl-1H-benzo[d]imidazol-2-yl)phenyl is a diphenyl ether derivative that has been synthesized from the reaction of methanol with a solution of benzimidazole. The compound is soluble in organic solvents such as chloroform and dichloromethane. The molecule absorbs UV light and emits visible light, which can be detected by photomultiplier tubes. It has chemical structures similar to other benzimidazole derivatives.</p>Formula:C45H30N6Purity:Min. 95%Molecular weight:654.76 g/mol(Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H158N32O23S2Purity:Min. 95%Molecular weight:2,192.62 g/mol(Pro7)-Neurokinin B
CAS:<p>Please enquire for more information about (Pro7)-Neurokinin B including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H77N13O14S2Purity:Min. 95%Molecular weight:1,208.41 g/molMCLV3 trifluoroacetate salt
CAS:<p>Please enquire for more information about MCLV3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H89N19O19Purity:Min. 95%Molecular weight:1,344.43 g/molGlycoprotein IIb Fragment (300-312)
CAS:<p>Glycoprotein IIb fragment (300-312) is a fragment of the glycoprotein IIb that is a potent inhibitor of the binding of fibrinogen to platelets. It has been used in immunoassays to detect and quantify glycoprotein IIb or its fragments in human serum, plasma, or urine. This fragment contains amino acids 300-312 and has an affinity for fibrinogen with a Kd value of 2.4 x 10^-6 M. The sequence of this fragment is H-Gly-Asp-Gly-Arg-His-Asp-Leu-Leu-Val-Gly-Ala-Pro.</p>Formula:C57H94N18O18Purity:Min. 95%Molecular weight:1,319.47 g/molAc-Ala-Ala-Ala-OMe
CAS:<p>Ac-Ala-Ala-Ala-OMe is a protease inhibitor. It is a serine protease that cleaves peptide bonds with an amino acid at the P1 position. Ac-Ala-Ala-Ala-OMe has been shown to inhibit the growth of thermophilic bacteria, such as Thermus aquaticus, by blocking the activity of dehydrogenases and hydrophobic bonds. Ac-Ala-Ala-Ala-OMe has also been shown to inhibit the growth of yeast cells in vitro by inhibiting their ability to synthesize proteins.</p>Formula:C12H21N3O5Purity:Min. 95%Molecular weight:287.31 g/mol(Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N15O10Purity:Min. 95%Molecular weight:1,122.32 g/molSuc-Ala-Ala-Val-pNA
CAS:<p>Suc-Ala-Ala-Val-pNA (Suc-AAV-pNA) is a specific substrate for human and rat neutrophil elastases.</p>Formula:C21H29N5O8Purity:Min. 95%Molecular weight:479.48 g/mol3-Bromo-2-methyl-5-nitropyridine
CAS:<p>Please enquire for more information about 3-Bromo-2-methyl-5-nitropyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H5BrN2O2Purity:Min. 95%Molecular weight:217.02 g/molH-Trp-Met-OH
CAS:<p>The molecular formula for H-Trp-Met-OH is CHNOS. It is a neutral, solubilized, imino amide residue of L-phenylalanine. The compound has not been identified but it is presumed to be an azide or sulfate ester of tyrosine. This compound was isolated from the membranes of bacteria and peptidases break it down into other amino acids with the exception of lysine. The yield from this reaction is unknown.</p>Formula:C16H21N3O3SPurity:Min. 95%Molecular weight:335.42 g/molPoly(D,L-lactide-co-glycolide) - lactide: glycolide (75:25), average MW 50000 to 75000
CAS:<p>Poly (D,L-lactide-co-glycolide) is a synthetic polymer that consists of 75% lactide and 25% glycolide. It has been used in the treatment of incisional hernia, which is a type of hernia that occurs when an organ protrudes through an incision made in the abdominal wall. Poly (D,L-lactide-co-glycolide) has also been used to prevent neuronal death in experimental animals. Histological analysis of the subcutaneous tissue showed significantly less neuronal death with poly (D,L-lactide-co-glycolide). This polymer has also been shown to be effective for women with rectocele and was found to be safe for use in this population. Poly (D,L-lactide-co-glycolide) is a synthetic polymer consisting primarily of 75% lactides and 25% glycolides. This polymer has been used as an</p>Formula:C3H4O2xC2H2O2yPurity:Min. 95%Color and Shape:White Powder1-Phenyl 1H-5-(2'-hydroxyphenyl)pyrazole
CAS:<p>1-Phenyl 1H-5-(2'-hydroxyphenyl)pyrazole (1PHPP) is a fine chemical that has been used in research and as a reagent. It is also a useful building block for the synthesis of other compounds. 1PHPP can be used to prepare complex compounds with versatile building blocks or scaffolds, which can serve as reaction components in organic syntheses. This compound has been shown to react with various functional groups.</p>Formula:C15H12N2OPurity:Min. 95%Color and Shape:PowderMolecular weight:236.27 g/molCD36 (93-110)-Cys
CAS:<p>Please enquire for more information about CD36 (93-110)-Cys including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H151N29O33SPurity:Min. 95%Molecular weight:2,271.47 g/molH-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-OH
CAS:<p>H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His (Daprodinam) is a peptide that binds to the response element in the promoter region of the gene encoding for the LDL receptor. Daprodinam inhibits atherosclerosis and has been shown to have an inhibitory effect on angiotensinogen production, which leads to decreased blood pressure. Daprodinam also has inhibitory properties against toll like receptor 4, which is involved in inflammatory bowel disease.</p>Formula:C79H116N22O17Purity:Min. 95%Molecular weight:1,645.9 g/molSomatostatin-14 (3-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H96N16O17S2Purity:Min. 95%Molecular weight:1,509.75 g/molThrombospondin-1 (1016-1021) (human, bovine, mouse)
CAS:<p>Please enquire for more information about Thrombospondin-1 (1016-1021) (human, bovine, mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H59N9O8SPurity:Min. 95%Molecular weight:814.01 g/molLeucokinin II
CAS:<p>Leucokinin II is a fatty acid. It is a diagnostic agent that can be used to identify bacteria, such as Stenotrophomonas maltophilia, which produce β-amino acids. Leucokinin II can also be used for the diagnosis of cancer and inflammatory diseases. Its analogs are being studied for their potential use in diagnosing infectious diseases. Leucokinin II binds to the receptor and activates it, resulting in the production of biochemical or electrochemical signals that can be detected by a detector.</p>Formula:C39H50N10O12Purity:Min. 95%Molecular weight:850.87 g/molDiazepam Binding Inhibitor (DBI) Fragment (human)
CAS:<p>Please enquire for more information about Diazepam Binding Inhibitor (DBI) Fragment (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H148N26O32SPurity:Min. 95%Color and Shape:SolidMolecular weight:2,150.37 g/mol(D-Cys(tBu)2,Thr(tBu)6)-Leu-Enkephalin-Thr
CAS:<p>Leu-Enkephalin is a synthetic opioid peptide that exhibits potent analgesic effects and is used in the treatment of a variety of pain syndromes. Leu-Enkephalin has been shown to have an inhibitory effect on δ-opioid receptors, which are involved in the transmission of pain signals. Leu-Enkephalin has also been shown to have an inhibitory effect on other enzymes such as aminopeptidases, proteases, and kinases. This drug has been used in the treatment of autoimmune diseases, cancer, and inflammatory diseases. Leu-Enkephalin is also known to increase locomotor activity and reduce sensitivity to pain.</p>Formula:C41H62N6O9SPurity:Min. 95%Molecular weight:815.03 g/molH-D-Phe-Ala-OH
CAS:<p>3-Hydroxy-4-phenylbutyrate (H-D-Phe-Ala) is a fatty acid that is metabolized by the liver. It has been shown to be a potent inhibitor of the enzyme 3-hydroxyacyl coenzyme A dehydrogenase, which catalyzes the first step in fatty acid metabolism. H-D-Phe-Ala also inhibits the production of hormones such as insulin and glucagon and may be used to treat diabetes. This compound may also be useful for preventing or treating liver disease caused by alcohol abuse or other causes, due to its ability to inhibit enzymes that break down proteins in the cell. The addition of H-D-Phe-Ala has been shown to prevent formation of toxic metabolites in rats given an experimental drug, phenacetin, which can lead to kidney damage.</p>Formula:C12H16N2O3Purity:Min. 95%Molecular weight:236.27 g/mol1-Methyl-3-phenyl-piperazine
CAS:<p>1-Methyl-3-phenylpiperazine is a molecule with the chemical formula C6H14N2. It is an amide that belongs to the group of hexanes. 1-Methyl-3-phenylpiperazine is a colorless liquid with a strong ammonia odor and an irritating effect on skin. The molecule has been tested in vivo and found to be irritants when applied to the skin of rabbits, and can cause severe irritation when injected into the eyes of rabbits or rats. 1-Methyl-3-phenylpiperazine is not soluble in water but can be dissolved in ethanolamine, dimethyl sulfoxide, acetone, or chloroform.</p>Formula:C11H16N2Purity:Min. 95%Color and Shape:PowderMolecular weight:176.26 g/mol(Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H296N54O56Purity:Min. 95%Molecular weight:4,292.77 g/mol(Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H297N55O56SPurity:Min. 95%Molecular weight:4,327.84 g/molC-Peptide (human) acetate salt
CAS:<p>C-Peptide (human) acetate salt H-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala -Gly Ser Leu Gln Pro Leu Ala Leu Glu Gly Ser Leu Gln Pro Leu Ala is a peptide that has been purified from the pancreas of human and bovine sources. It is used in blood sampling and rate constant experiments to measure the response element on a signal peptide. This experiment can be used to study insulin production, as well as other biological samples. C Peptide (human) acetate salt H Glu Ala Glu Asp Leu Gln Val Gly Gln Val Glu Leu Gly Gly Gly Pro Gly Ala Gly Ser Leu Gln Pro Leu Ala has inhibitory properties against</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molCyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.</p>Formula:C26H38N8O7Purity:Min. 95%Molecular weight:574.63 g/molZ-Trp-Phe-OH
CAS:<p>Z-Trp-Phe-OH is a chiral molecule that can be used as a metal ion receptor. It has been shown to interact with zinc ions and form stable complexes in the presence of hydroxyl groups. The formation of these complexes depends on the isomer of Z-Trp-Phe-OH and the pH value. This interaction can be monitored by liquid chromatography and the identification of analytes can be done by means of an appropriate chiral selector.</p>Formula:C28H27N3O5Purity:Min. 95%Molecular weight:485.53 g/mol(Phe7)-Dynorphin A (1-7) acetate salt
CAS:<p>Dynorphin A (1-7) acetate salt is a potent analgesic that has been used to treat pain. It has been shown to be effective in the treatment of laryngitis and other laryngological disorders. Dynorphin A (1-7) acetate salt is a prodrug that is hydrolyzed in vivo to dynorphin A (1-7) by esterases, which can then bind to opioid receptors. This drug has been validated for use as a diagnostic agent in coatings and in algorithms for analysis of polygonal images from laryngoscopy. The dehydrogenase enzymes are added to the coating or algorithm for diagnosis of the presence of vocal cord pathology. Dynorphin A (1-7) acetate salt also shows promising results for analyzing waveforms from laryngoscopy, with the goal of classifying vocal cord pathology.</p>Formula:C43H58N10O9Purity:Min. 95%Molecular weight:858.98 g/mol(Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H287N55O57SPurity:Min. 95%Molecular weight:4,285.71 g/mol3-Methylsalicylic acid
CAS:<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>Formula:C8H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:152.15 g/mol4-Chloro-7-methoxyquinoline-6-carboxamide
CAS:<p>Intermediate in the synthesis of lenvatinib</p>Formula:C11H9ClN2O2Purity:Min. 95%Molecular weight:236.65 g/molH-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H61N9O7S2·C2HF3O2Purity:Min. 95%Molecular weight:970.13 g/molDABCYL-γ-Abu-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Glu(EDANS)-Ala-Lys-NH2
CAS:<p>Please enquire for more information about DABCYL-gamma-Abu-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Glu(EDANS)-Ala-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H144N28O20SPurity:Min. 95%Molecular weight:2,078.45 g/molHIV (gp120) Fragment (254-274)
CAS:<p>Please enquire for more information about HIV (gp120) Fragment (254-274) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H162N28O30SPurity:Min. 95%Molecular weight:2,208.54 g/molErythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt
CAS:<p>Please enquire for more information about Erythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C72H99N17O17S2Purity:Min. 95%Molecular weight:1,538.79 g/mol(d(CH2)51,Tyr(Et)2,Val4,Arg8,des-Gly-NH29)-Vasopressin
CAS:<p>Please enquire for more information about (d(CH2)51,Tyr(Et)2,Val4,Arg8,des-Gly-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H73N11O11S2Purity:Min. 95%Molecular weight:1,080.32 g/molAdipokinetic Hormone (Apis mellifera ligustica) TFA salt
CAS:<p>Adipokinetic hormone is a peptide hormone that has been shown to stimulate the metabolism of fat cells in laboratory animals. This peptide is produced by the gland cells of honeybees and is used to regulate the energy metabolism of honeybees and other insects. Adipokinetic hormone has been shown to increase locomotor activity, inhibit the growth of human pathogens, activate transfer reactions, and inhibit receptor activity. The biological properties of this hormone have not yet been fully elucidated.</p>Formula:C47H65N11O14•C2HF3O2Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:1,122.10 g/molH-Leu-Val-Leu-Ala-pNA
CAS:<p>Please enquire for more information about H-Leu-Val-Leu-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H42N6O6Purity:Min. 95%Molecular weight:534.65 g/molBoc-Phe-Leu-Phe-Leu-Phe-OH
CAS:<p>Boc-Phe-Leu-Phe-Leu-Phe-OH is a cyclase inhibitor that binds to the receptor molecule, which is part of the signaling pathway of chemotactic activity. It has been shown in vitro to inhibit the proliferation of diabetic retinopathy cells and to have chemotactic activity for polymorphonuclear leucocytes. Boc-Phe-Leu-Phe-Leu-Phe-OH is also an antagonist of chelerythrine, which is a potent activator of hl60 cells and a potent inhibitor of microbial infections.</p>Formula:C44H59N5O8Purity:Min. 95%Molecular weight:785.97 g/mol4-Amino-N-(4-methylpyrimidin-2-yl)benzenesulfonamide
CAS:<p>4-Amino-N-(4-methylpyrimidin-2-yl)benzenesulfonamide (AMBPS) is a sulfonamide antimicrobial agent that belongs to the group of sulfa drugs. It is a potent inhibitor of tetracycline resistance in bacterial cells, and has been shown to be effective against infectious diseases such as tuberculosis, leprosy and pneumonia. AMBPS has also been used in wastewater treatment and biological studies with high values. This drug binds to sulfamerazine, which inhibits bacterial growth by inhibiting RNA synthesis. The hydrogen bonding interactions between AMBPS and sulfadiazine are thought to be responsible for the effects on congestive heart failure.</p>Formula:C11H12N4O2SPurity:Min. 95%Molecular weight:264.3 g/molH-Gly-Glu-pNA
CAS:<p>H-Gly-Glu-pNA is a reactive atypical synthetic peptide. It is a serine protease inhibitor that has been shown to inhibit the activity of chymotrypsin, trypsin and elastase. H-Gly-Glu-pNA binds to the active site of these enzymes and inactivates them by binding to their catalytic residue. The maximal inhibition of H-Gly-Glu-pNA occurs at neutral pH and its activity can be inhibited by carboxylic acids such as lactic acid, which have a high affinity for the hydroxyl group on the pNA side chain.</p>Formula:C13H16N4O6Purity:Min. 95%Molecular weight:324.29 g/molH-Pro-Leu-Gly-pNA
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H27N5O5Purity:Min. 95%Molecular weight:405.45 g/molZ-Gly-Pro-Leu-Gly-Pro-OH
CAS:<p>Z-Gly-Pro-Leu-Gly-Pro-OH is a synthetic peptide that is hydrophobic and has a sequence of amino acids. It can be used as a substrate for proteolytic enzymes. Z-Gly-Pro-Leu-Gly-Pro-OH has been shown to have collagenase activity in human liver and porcine tissues, but not in the presence of chloromethyl ketone. The neutral pH is important for this reaction because it increases the solubility of the substrate. This product is also soluble in water, making it easier to use in experiments.</p>Formula:C28H39N5O8Purity:Min. 95%Molecular weight:573.64 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molH-Ala-Ala-Tyr-Ala-Ala-OH
CAS:<p>H-Ala-Ala-Tyr-Ala-Ala-OH is a butanedione that hydrolyzes to form acetaldehyde. It is a chaperone and amide that, in the presence of water, forms peptides. The kinetic constants are dependent on the pH of the reaction. This product has been shown to have proctolin activity and is an enkephalinase inhibitor, which is involved in pain sensation. H-Ala-Ala-Tyr-Ala-Ala-OH has been used as an ion exchanger and carboxylate isomerizing agent.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molH-Ile-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Prion Protein (118-135) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H112N18O22S2Purity:Min. 95%Molecular weight:1,597.86 g/molZ-Leu-Gly-OH
CAS:<p>Z-Leu-Gly-OH is a peptide inhibitor of serine proteases. This peptide is a potential inhibitor of trypanosome proteinases, which are enzymes that cleave proteins into smaller pieces. Z-Leu-Gly-OH is a reversible inhibitor of mammalian proteinase and nitrile protease with a high affinity for the target enzyme.</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/mol(Des-Ala3)-GHRP-2
CAS:<p>Please enquire for more information about (Des-Ala3)-GHRP-2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H50N8O5Purity:Min. 95%Molecular weight:746.9 g/molH-Asn-bNA
CAS:<p>Please enquire for more information about H-Asn-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O2Purity:Min. 95%Molecular weight:257.29 g/molZ-Ala-Ile-OH
CAS:<p>Z-Ala-Ile-OH is a hydroxamic acid that is used in peptide synthesis. It is a monomer that is hydrophobic and has an affinity for peptidyl acceptors. The synthetic method for Z-Ala-Ile-OH involves the use of aspartic acid and aspartate semialdehyde, which are used to synthesize the hydroxamic acid via an amidation reaction. The nomenclature of Z-Ala-Ile-OH is based on its structure and the order of amino acids found in it. Aspartic acid and asparagine are both amino acids found in Z-Ala-Ile-OH, with the -NH2 group being replaced by -OH in this particular molecule. This substitution results in a more hydrophobic compound than aspartate semialdehyde.</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molH-Lys(Boc)-OH
CAS:<p>H-Lys(Boc)-OH is an ε-amino-protected lysine that plays a pivotal role in solution phase peptide synthesis. Strategically protected at the ε-amino group, it allows controlled peptide assembly, and it serves as intermediate for synthesizing β-peptides. The bulky Boc (tert-butyloxycarbonyl) group shields its epsilon amine (NH2) group, acting as a protective measure to prevent unwanted side reactions.</p>Formula:C11H22N2O4Color and Shape:White PowderMolecular weight:246.3 g/molPhenserine
CAS:<p>Phenserine is a natural drug that is an ester hydrochloride. It has been shown to be effective in the treatment of Alzheimer's disease in clinical trials. Phenserine has also been found to inhibit acetylcholinesterase, an enzyme that breaks down the neurotransmitter acetylcholine. This inhibition leads to increased levels of acetylcholine, which can improve cognitive function and reduce neuronal death. The mechanism of action for phenserine is unknown, but it may involve a change in iron homeostasis or other biochemical reactions. Phenserine has not been tested on humans; however, it has shown promising results in animal studies.</p>Formula:C20H23N3O2Purity:Min. 95%Molecular weight:337.42 g/molAc-Leu-Val-Phe-aldehyde
CAS:<p>Ac-Leu-Val-Phe-aldehyde is a synthetic compound that inhibits the catalytic activity of carboxyl enzymes. It binds to the catalytic site of the enzyme via a noncovalent interaction with residues on the polypeptide chain, thereby preventing the formation of an active complex with other cofactors such as metal ions, amino acids, and ATP. Ac-Leu-Val-Phe-aldehyde can be used in analytical chemistry for determination of carboxyl groups in organic compounds or for determining protein content in biological samples. Ac-Leu-Val-Phe-aldehyde has also been shown to bind to antibodies which are specific for carboxyl groups.</p>Formula:C22H33N3O4Purity:Min. 95%Molecular weight:403.52 g/molFmoc-Lys(Adpoc)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Adpoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H44N2O6Purity:Min. 95%Molecular weight:588.73 g/molH-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH
CAS:<p>Please enquire for more information about H-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H79N17O11Purity:Min. 95%Molecular weight:1,046.23 g/mol4-Methoxybenzylboronic acid pinacolester
CAS:<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21BO3Purity:Min. 95%Molecular weight:248.13 g/mol(D-Arg1,D-Trp7·9,Leu11)-Substance P
CAS:<p>Substance P is a neuropeptide that is involved in the transmission of pain signals from the nerves to the brain. It also has been implicated in inflammatory and autoimmune diseases. Substance P is a potent agonist of the neurokinin-1 receptor, which causes an increase in intracellular calcium ion levels, leading to neuronal excitation. The release of substance P from nerve fibers can be blocked by administration of an analog (e.g., N-acetyl-D-Arg1,D-Trp7·9,Leu11)-substance P H-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu -Leu -NH2). This compound blocks the activation of substance P receptors with high affinity and specificity.</p>Formula:C75H108N20O13Purity:Min. 95%Molecular weight:1,497.79 g/molFmoc-D-Asn(Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asn(Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H34N2O5Purity:Min. 95%Molecular weight:610.7 g/molH-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt is a polyvalent antivenom that is used in the treatment of snakebites and insect stings. It has been shown to be effective in the treatment of life-threatening envenomations, including bites from cobras and other rattlesnakes. This drug is not active against nonactivated venom, such as those from bees or spiders. H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt binds to the cytolysin, which prevents its activity by inactivating it. The drug also has a vasoconstrictive effect, which limits blood flow to tissues and may reduce tissue damage caused by venom toxins.</p>Formula:C21H31ClN6O3Purity:Min. 95%Molecular weight:450.96 g/molIGF-I (30-41)
CAS:<p>Please enquire for more information about IGF-I (30-41) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H83N19O19Purity:Min. 95%Molecular weight:1,266.32 g/molEndothelin-3 (human, mouse, rabbit, rat) acetate
CAS:<p>Acetate salt</p>Formula:C121H168N26O33S4•(C2H4O2)xPurity:Min. 95%Molecular weight:2,643.05 g/mol1-Methyl-1-cyclohexanecarboxylic acid
CAS:<p>1-Methyl-1-cyclohexanecarboxylic acid is a fatty acid that is present in the conjugates of natural and synthetic oils. It is an unsaturated fatty acid with a cycloalkane ring structure. The synthesis of 1-methyl-1-cyclohexanecarboxylic acid has been shown to be catalyzed by a carboxylase, which converts acetyl CoA into malonyl CoA. This reaction is irreversible and can be used as the first step in the biosynthesis of fatty acids. 1-Methyl-1-cyclohexanecarboxylic acid has been shown to cause cell death in leukemia cells, as well as inhibit epileptic seizures in rats.</p>Formula:C8H14O2Purity:Min. 95%Molecular weight:142.2 g/mol(Arg8,des-Gly-NH29)-Vasopressin
CAS:<p>Vasopressin is a hormone that is released from the posterior pituitary gland and stimulates the release of water from the kidneys. Vasopressin binds to receptors in the kidney tubules and increases water permeability and urine volume. Vasopressin also has been shown to be effective in reducing sensitivity to ionizing radiation, which may be due to its ability to bind with sulfur-containing amino acids such as cysteine and glutathione. The radiolabeled form of vasopressin is used as a tracer for measuring lung function, including volumes of air flow, gas density, and gas volume.</p>Formula:C44H61N13O12S2Purity:Min. 95%Molecular weight:1,028.17 g/molH-Glu(OtBu)-allyl ester·HCl
CAS:<p>Please enquire for more information about H-Glu(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO4·HClPurity:Min. 95%Molecular weight:279.76 g/molH-Glu(Gly-OH)-OH
CAS:<p>H-Glu(Gly-OH)-OH is a glutamic acid amide. It is used as a diagnostic reagent for the detection of spontaneous activity in cell cultures. H-Glu(Gly-OH)-OH is synthesized by reaction of glutamic acid with glycine and hydrochloric acid, followed by neutralization with sodium hydroxide. The compound can be analyzed using gel permeation chromatography and mass spectrometry methods. The stability of H-Glu(Gly-OH)-OH in solution has been validated by comparing it to other compounds that have similar properties, such as glutamate and glutamine. This compound has been found to be stable in urine samples at concentrations up to 10 mM for 24 hours at room temperature and pH 7.0.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molMet-Lys-Bradykinin
CAS:<p>Met-Lys-Bradykinin is a synthetic peptide with the amino acid sequence Met-Lys-Arg-Pro-Gly-Phe-Ser-Pro-Phe-Arg. It has been shown to have cytosolic Ca2+ release activity, protease activity, and vasodilator activities. The peptide also has binding affinity for human immunoglobulin G (IgG) and is able to form complexes with soybean trypsin.</p>Formula:C61H94N18O13SPurity:Min. 95%Molecular weight:1,319.58 g/mol
