
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,971 products)
- Amino Acid and Amino Acid Related Compounds(3,477 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38321 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
(D-Trp6)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13·xC2H4O2Purity:Min. 95%Molecular weight:1,311.45 g/molFor-Met-Leu-p-iodo-Phe-OH
CAS:<p>Please enquire for more information about For-Met-Leu-p-iodo-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30IN3O5SPurity:Min. 95%Molecular weight:563.45 g/molZ-Arg-Arg-Arg-4MbetaNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H53N13O6Purity:Min. 95%Molecular weight:775.9 g/molTrt-Cys(Trt)-OH
CAS:<p>Trt-Cys(Trt)-OH is a selective dicyclohexyl carbodiimide reagent for the synthesis of amides from carboxylic acids. It is used as an intermediate in the synthesis of glutathione and other nitrogen-containing compounds. Trt-Cys(Trt)-OH reacts with hydrochloric acid to form a salt, which can be saponified to release the desired product. The hydrochloric acid converts the ester into a carboxylic acid, while the amine group on the glycine reacts with the carboxylic acid to form an amide. Trityl is also produced during this reaction, which can be removed by reduction with hydrogen gas and palladium on charcoal.</p>Formula:C41H35NO2SPurity:Min. 95%Molecular weight:605.79 g/mol4-Chloro-2-iodo-phenol
CAS:<p>Please enquire for more information about 4-Chloro-2-iodo-phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4ClIOPurity:Min. 95%Molecular weight:254.45 g/molH-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C175H290N56O59Purity:Min. 95%Molecular weight:4,122.52 g/molDynorphin A (1-7)
CAS:<p>Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH is a peptide that acts as a cryoprotectant. It has been shown in animal models to inhibit the proliferation of cells in culture and to have neuroprotective properties. Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH has also been shown to have antiinflammatory properties in animals, although the exact mechanism of action is not known. This peptide can be used as an excipient in pharmaceutical formulations or as a diluent for lyophilisates.</p>Formula:C40H61N13O9Purity:Min. 95%Molecular weight:867.99 g/molH-Pro-Glu-OH
CAS:H-Pro-Glu-OH is a homologous peptide that belongs to the group of proteins. It is synthesized in the cells by polymerase chain reaction and can be used for diagnosis of infectious diseases. It has been shown to induce antibody response in mice. H-Pro-Glu-OH is also active against Mycobacterium tuberculosis, which may be due to its ability to bind to the tyrosine kinase domain on protein genes. This peptide has been shown to have anti-inflammatory properties, inhibiting fatty acid production and leading to necrotic cell death.Formula:C10H16N2O5Purity:Min. 95%Molecular weight:244.24 g/molH-Leu-His-Leu-OH
CAS:<p>H-Leu-His-Leu-OH is a peptide fragment of human growth hormone. It is a stabilized, cleaved, and lyophilized form of the substance that is used as an additive in buffering solutions. It has been shown to be a potent inhibitor of the proteolytic enzymes cathepsin B, elastase, and chymotrypsin in vitro. The stability of this fragment can be attributed to its resistance to proteolysis by enzymes such as cathepsin's B, elastase, and chymotrypsin because it does not contain any free amino acid residues.</p>Formula:C18H31N5O4Purity:Min. 95%Molecular weight:381.47 g/mol1-Boc-1-methylhydrazine
CAS:<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/molSuc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid
CAS:<p>Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid is a synthetic peptide that has been shown to have the ability to inhibit the function of an enzyme called isomerase. It binds to the catalytic region of the enzyme and blocks its activity, which prevents the production of amino acid molecules. Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid also has immunosuppressive properties, which are due to its ability to bind to regulatory domains in cells and prevent their transcriptional activation. This molecule also has a catalytic function and can be used as a building block for synthesizing other molecules with similar functions.</p>Formula:C37H45N5O9•xCF3CO2HPurity:Min. 95%Molecular weight:703.78 g/mol(Gly14)-Humanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly14)-Humanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C118H202N34O31S2Purity:Min. 95%Molecular weight:2,657.21 g/molH-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H71N11O12S2Purity:Min. 95%Molecular weight:1,166.37 g/molN-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine
CAS:<p>N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is a chiral, electron deficient reagent that reacts with aldehydes and boronic esters to form products with high chemical yields. This compound can be used as a catalyst for acylation reactions, such as the synthesis of p-nitrophenol. N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is synthesized by the reaction of trifluoroacetic acid and an amine, followed by chloroformate displacement. The product is then reacted with acylating agents in the presence of catalysts.</p>Formula:C13H23NOSiPurity:Min. 95%Color and Shape:Clear Colourless To Pale Yellow LiquidMolecular weight:237.41 g/molMatrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt
CAS:<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H75N9O11·C2HF3O2Purity:Min. 95%Molecular weight:1,080.2 g/molDynorphin B
CAS:<p>Dynorphin B is a peptide hormone that is found in the brain and spinal cord. It is one of the many endogenous opioid peptides that bind to kappa-opioid receptors. Dynorphin B has been shown to have pain-relieving effects, which are mediated by its ability to inhibit neuronal activity in the nociceptive pathway. Dynorphin B has also been shown to have significant anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis. Dynorphin B can also reduce locomotor activity and increase dopamine release, which may be due to its ability to activate dopamine receptors.</p>Formula:C74H115N21O17Purity:Min. 95%Molecular weight:1,570.84 g/mol(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H83N17O13Purity:Min. 95%Molecular weight:1,226.39 g/molPropanedioic acid 1-methyl ester
CAS:<p>Propanedioic acid 1-methyl ester (PDM) is a synthetic trifluoroacetic acid ester of the natural fatty acid, propanedioic acid. It has been found to be a potent inhibitor of the enzyme malonic acid decarboxylase in vitro and has also been shown to inhibit the production of prostaglandin E2 in mice with adjuvant arthritis. PDM is used as a diagnostic agent for autoimmune diseases and inflammatory diseases. It is also being studied as an anti-inflammatory drug for use in the treatment of chronic inflammatory conditions such as rheumatoid arthritis, psoriasis, and ulcerative colitis. The mechanism of action is not well understood but may involve inhibition of arachidonic acid metabolism or inhibition of cyclooxygenase enzymes.</p>Formula:C4H6O4Purity:Min. 95%Color and Shape:Colourless To Pale Yellow Clear LiquidMolecular weight:118.09 g/molNeuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C113H192N36O39Purity:Min. 95%Molecular weight:2,678.95 g/mol1-(3-Chloro-4-methoxyphenyl)acetone
CAS:<p>1-(3-Chloro-4-methoxyphenyl)acetone is a white solid with a melting point of 60-61°C. It is a versatile building block that can be used in the synthesis of complex compounds and as a reaction component for the preparation of speciality chemicals. 1-(3-Chloro-4-methoxyphenyl)acetone has been studied extensively as an intermediate for the synthesis of pharmaceuticals, including acetaminophen and amoxicillin. This compound also has uses in research laboratories and as a reagent in organic synthesis.</p>Formula:C10H11ClO2Purity:Min. 95%Molecular weight:198.65 g/molBoc-Leu-Lys-Arg-AMC hydrochloride salt
CAS:<p>Boc-Leu-Lys-Arg-AMC is a synthetic substrate that has been used in a number of clinical studies to identify the serine proteases that are involved in autoimmune diseases. It is a synthetic peptide composed of the amino acid sequence found in soybean trypsin. The peptide was shown to have high salt tolerance and was able to be hydrolyzed by polyclonal antibodies with specificity for amyloid protein, suggesting it may be useful as a biochemical marker for Alzheimer's disease. Boc-Leu-Lys-Arg-AMC has also been shown to be an efficient substrate for collagenase, which is an enzyme that breaks down collagen and causes tissue damage. This property makes this compound useful as a proteolytic agent for the removal of unwanted scar tissue or other lesions from diseased organs. Boc-Leu-Lys-Arg-AMC also has an optimum pH level of 7.5 and is active against influenza</p>Formula:C33H52N8O7Purity:Min. 95%Molecular weight:672.82 g/molSuc-Ala-Pro-pNA
CAS:<p>Suc-Ala-Pro-pNA is a glycoprotein that has been shown to have a number of different functions. It is an inhibitor of tissue culture, and it has been shown to inhibit the growth of cervical cancer cells by binding to epidermal growth factor (EGF). It also inhibits peptide hormones such as prolactin and insulin, which can lead to breast cancer. Suc-Ala-Pro-pNA may be clinically relevant for treatment of carcinoma cell lines due to its ability to bind platinum-based chemotherapy drugs. This protein has been shown to be expressed on the surface of mammary carcinoma cells, where it acts as a receptor for the monoclonal antibody mcf7. The protein's function as a surface glycoprotein means that it can act as a marker for cancerous tumors in the body.</p>Formula:C18H22N4O7Purity:Min. 95%Molecular weight:406.39 g/molH-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Preptin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H275N47O53Purity:Min. 95%Molecular weight:4,029.47 g/molH-Thr-Tyr-Ser-OH
CAS:<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/molPeptide 74
CAS:<p>Peptide 74 is a synthetic drug that has been shown to inhibit the activity of matrix metalloproteinases, which are enzymes that break down collagen in the extracellular matrix. This peptide also inhibits cell invasiveness and migration. It has been shown to be effective at inhibiting cancer cell growth, although it does not affect normal cells. The peptide is a receptor for the LDL-receptor and inhibits LDL uptake into macrophages. The peptides have also been shown to inhibit angiogenesis and tumor growth in animals by blocking VEGF receptors.</p>Formula:C62H107N23O20S2Purity:Min. 95%Molecular weight:1,558.79 g/molH-D-Val-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Asn(Dod)-OH
CAS:<p>Fmoc-Asn(Dod)-OH is a pentafluorophenyl ester of the N-terminal tryptophan residue of an asparagine peptide. It is activated by alkylation with pentafluorophenyl bromoacetic acid, which attaches to the carbonyl carbon of the peptide backbone. The activated ester undergoes dehydration and amide formation in the presence of 4-methylbenzenesulfonyl chloride. This reagent can be used for efficient synthesis of peptides, such as proteins and enzymes.</p>Formula:C34H32N2O7Purity:Min. 95%Molecular weight:580.63 g/molZ-Tyr-Leu-OH
CAS:<p>Please enquire for more information about Z-Tyr-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O6Purity:Min. 95%Molecular weight:428.48 g/mol5-(2-Methyl-4-nitrophenyl)-2-furaldehyde
CAS:<p>Please enquire for more information about 5-(2-Methyl-4-nitrophenyl)-2-furaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H9NO4Purity:Min. 95%Molecular weight:231.2 g/molACTH (1-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N21O20SPurity:Min. 95%Molecular weight:1,680.88 g/molZ-Gly-Pro-Gly-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is a synthetic substrate. It is used in tissue culture to measure collagenase activity, as well as in skin cells to measure the activity of v. anguillarum. The optimum pH for this substrate is 5.5 and it has been shown to be stable in high salt environments. This substrate also reacts with human liver granulosa cells and has been shown to have neutral pH properties. Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is an enzyme substrate that is involved in many different enzyme activities including protein synthesis and hydrogen bonding.</p>Formula:C27H36N6O9Purity:Min. 95%Molecular weight:588.61 g/mol(Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/mol2-(Boc-Aminomethyl)pyrrolidine
CAS:<p>Please enquire for more information about 2-(Boc-Aminomethyl)pyrrolidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O2Purity:Min. 95%Molecular weight:200.28 g/molMeOSuc-Ala-Ala-Pro-Val-OH
CAS:<p>Please enquire for more information about MeOSuc-Ala-Ala-Pro-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H34N4O8Purity:Min. 95%Molecular weight:470.52 g/mol(D-His2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molH-Gly-Ile-2-Nal-Trp-His-His-Tyr-OH
CAS:<p>Please enquire for more information about H-Gly-Ile-2-Nal-Trp-His-His-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H60N12O9Purity:Min. 95%Molecular weight:1,009.12 g/mol(D-Ala2)-Leu-Enkephalin amide
CAS:<p>Hyaluronic acid is a natural component of connective tissue and synovial fluid in animals. It is a linear, unbranched polysaccharide consisting of alternating D-glucuronic acid and N-acetyl-D-glucosamine. Hyaluronic acid has been shown to be useful in the treatment of long-term diseases such as heart disease or skin conditions like eczema. It is important for the efficient production of vaccines, which are used to prevent infectious diseases such as streptococcal infections. Hyaluronic acid can also be used as a microcontroller for minimally invasive procedures. This molecule can be used as an additive in the production of metallocene catalysts to increase the efficiency of these reactions, while reducing impurities during the process. The use of hyaluronic acid has been studied extensively, with many techniques employed to study its properties and functions. Genetic factors have also been found to play a role in</p>Formula:C29H40N6O6Purity:Min. 95%Molecular weight:568.66 g/molLys-Thymic Factor trifluoroacetate salt
CAS:<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H68N14O17Purity:Min. 95%Molecular weight:1,005.04 g/mol(Gln53)-Connexin 37 (51-58) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Gln53)-Connexin 37 (51-58) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H59N11O15Purity:Min. 95%Molecular weight:933.96 g/molH-Thr-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Thr-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O5Purity:Min. 95%Molecular weight:233.22 g/molNeuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H135N25O24Purity:Min. 95%Molecular weight:1,915.16 g/mol([ring-D5]Phe8)-Angiotensin II acetate salt
CAS:<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H66D5N13O12Purity:Min. 95%Molecular weight:1,051.21 g/molpTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H247N49O37Purity:Min. 95%Molecular weight:3,364.91 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molH-Thr-Gln-OH
CAS:<p>Clostridium is a genus of Gram-positive bacteria that includes many important human pathogens. Clostridium perfringens is the most common cause of food poisoning, and can be fatal if not treated. It causes necrotizing enteritis in infants, who have less resistance to the toxins produced by this bacterium. The pathogenesis of C. perfringens has been shown to involve proteolytic activity, which breaks down proteins into smaller parts, and autocatalytic activity, which releases enzymes from within the cell to digest its own peptidoglycan layer. Proteolytic activity has also been shown to be involved in the development of cancer and other diseases such as atherosclerosis and Alzheimer's disease. There are numerous interventions available for preventing or treating clostridium infections: chlorate, streptomycin, penicillin, erythromycin, tetracycline, metronidazole, fluoroquinolones such as</p>Formula:C9H17N3O5Purity:Min. 95%Molecular weight:247.25 g/molCyclo(-D-Ala-Val)
CAS:<p>Please enquire for more information about Cyclo(-D-Ala-Val) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O2Purity:Min. 95%Molecular weight:170.21 g/molH-Trp-Gly-Gly-Tyr-OH
CAS:<p>Please enquire for more information about H-Trp-Gly-Gly-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N5O6Purity:Min. 95%Molecular weight:481.5 g/molGlutathione-monoethyl ester (reduced)
CAS:<p>Glutathione-monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is a polymerase chain reaction (PCR) enhancer that consists of a glutathione monoester and an ethyl ester. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is used as a cancer therapeutics agent in the treatment of cells with high levels of reactive oxygen species. It also inhibits drug efflux from cells and induces apoptosis in endothelial cells, which can lead to the inhibition of tumor growth. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH has been shown to cause changes in intracytoplasmic sperm and protein thiols in PC12 cells, which may be related to its ability to inhibit cell proliferation.</p>Formula:C12H21N3O6SPurity:Min. 95%Molecular weight:335.38 g/molH-Gly-Leu-Phe-OH
CAS:<p>H-Gly-Leu-Phe-OH is a peptide that has been isolated from human macrophages. The peptide is homologous to the amino acid sequence of casein and has shown anti-inflammatory properties in the inhibition of the enzymatic reaction between casein and sodium citrate. When incubated with polymorphonuclear leukocytes, H-Gly-Leu-Phe-OH showed an inhibitory effect on their growth. This peptide also inhibited the enzymatic reaction between casein and sodium citrate, which may be due to its reversed phase high performance liquid chromatography (RP HPLC) method.</p>Formula:C17H25N3O4Purity:Min. 95%Molecular weight:335.4 g/molH-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%L-Alanine benzyl ester hydrochloride
CAS:L-Alanine benzyl ester hydrochloride is a conjugate of L-alanine and the quaternary ammonium salt benzyl ester hydrochloride. The water molecule is attached to the nitrogen atom in the benzyl ester. It has been shown to inhibit viral replication by interfering with the virus' ability to use host enzymes and proteins for synthesis. L-Alanine benzyl ester hydrochloride has significant cytotoxicity against leukemia cells, which may be due to its ability to inhibit rna polymerase activity. L-Alanine benzyl ester hydrochloride can also be used as an inhibitor of angiotensin converting enzyme (ACE), which is important in regulating blood pressure.Formula:C10H13NO2•HCLPurity:Min. 95%Color and Shape:White PowderMolecular weight:215.68 g/molSar-Ala-OH
CAS:<p>Please enquire for more information about Sar-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O3Purity:Min. 95%Molecular weight:160.17 g/molZ-D-Alaninol
CAS:<p>Please enquire for more information about Z-D-Alaninol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15NO3Purity:Min. 95%Molecular weight:209.24 g/molH-Cys(SO3H)-OH sodium salt
CAS:<p>Please enquire for more information about H-Cys(SO3H)-OH sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C3H7NO5S2·xNaPurity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:201.22 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/molAc-Tyr-Val-Ala-Asp-AMC
CAS:<p>Ac-Tyr-Val-Ala-Asp-AMC is a compound that has been shown to induce apoptotic cell death in MDA-MB-231 breast cancer cells. It inhibits the activity of proteases, which are enzymes that degrade proteins. Ac-Tyr-Val-Ala-Asp-AMC has also been shown to inhibit serine proteases and granule neurons, which are proteins in the brain that regulate the production of atp levels. Ac-Tyr-Val-Ala-Asp-AMC has also been shown to inhibit muscle cell proliferation. Acetylcholine (ACh) is a neurotransmitter responsible for signaling between nerve cells in the central nervous system and other parts of the body. Acetylcholine is synthesized by choline acetyltransferase (ChAT), an enzyme that breaks down acetylcholine into choline and acetate. Inhibition of ChAT leads to a decrease in</p>Formula:C33H39N5O10Purity:Min. 95%Molecular weight:665.69 g/molH-His-Leu-Pro-Pro-Pro-Val-His-Leu-Pro-Pro-Pro-Val-OH
CAS:<p>Please enquire for more information about H-His-Leu-Pro-Pro-Pro-Val-His-Leu-Pro-Pro-Pro-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H98N16O13Purity:Min. 95%Molecular weight:1,299.56 g/mol3-Amino-2-methoxy-dibenzofuran
CAS:<p>3-Amino-2-methoxy-dibenzofuran (3AMD) is a cytotoxic agent that is used in the treatment of bladder carcinoma. 3AMD inhibits DNA synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. 3AMD has been shown to be a potent inhibitor of cyclen-dependent kinases and to induce DNA damage in human cells. 3AMD also has significant cytotoxicity against malignant cells and has been shown to inhibit the growth of tumours in mice. 3AMD may have carcinogenic potential due to its structural similarity with other carcinogens such as aniline and aminobiphenyl.</p>Purity:Min. 95%Molecular weight:213.23 g/molFmoc-Asp(OtBu)-Ser(Psi(Me,Me)pro)-OH
CAS:Please enquire for more information about Fmoc-Asp(OtBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C29H34N2O8Purity:Min. 95%Molecular weight:538.59 g/molZ-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Z-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone is a mitochondria-targeting compound that has been shown to have neuroprotective and anti-inflammatory properties. It binds to the ATP synthase in the mitochondrial membrane, inhibiting ATP production and causing cell death by apoptosis. ZAFMK also inhibits kinases such as protein kinase 3β (PK3β) and caspase 9, which are involved in inflammation and apoptosis. ZAFMK has been shown to be effective against various diseases such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, Huntington's disease, and stroke.</p>Formula:C29H40FN5O11SPurity:Min. 95%Molecular weight:685.72 g/molBoc-Gly-Phe-OBzl
CAS:<p>Please enquire for more information about Boc-Gly-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molH-Arg-Arg-4MbetaNA·3 HCl
CAS:<p>Please enquire for more information about H-Arg-Arg-4MbetaNA·3 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H35N9O3·3HClPurity:Min. 95%Molecular weight:594.96 g/molN-Boc-1,2-phenyldiamine
CAS:<p>N-Boc-1,2-phenyldiamine is a histone acetyltransferase (HAT) inhibitor. It is an acetylated molecule that contains two phenyl rings, one of which is substituted with an amine group. This compound was designed to inhibit the activity of HATs, which are enzymes involved in the chemical modification of histones and other proteins. N-Boc-1,2-phenyldiamine inhibits the activities of these enzymes and prevents the acetylation of lysines on histones or other proteins. It has been shown to be efficient in inducing apoptosis in human cancer cells and may also have some antitumor effects.</p>Formula:C11H16N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:208.26 g/molOsteostatin (human) trifluoroacetate salt
CAS:<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>Formula:C142H228N42O58Purity:Min. 95%Molecular weight:3,451.58 g/molFmoc-D-His(1-Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-His(1-Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H35N3O4Purity:Min. 95%Molecular weight:633.73 g/molH-D-Val-Leu-Arg-pNA·2 AcOH
CAS:<p>H-D-Val-Leu-Arg-pNA·2 AcOH is a kallikrein inhibitor that can be used as a blood pressure lowering agent. It inhibits the enzymatic activity of kallikrein, which is responsible for the conversion of kininogen to bradykinin, and thus prevents the production of natriuretic peptides. H-D-Val-Leu-Arg-pNA·2 AcOH has been shown to decrease blood pressure in animals by inhibiting filtration through the glomerulus and by blocking renin release from juxtaglomerular cells.</p>Formula:C23H38N8O5·2C2H4O2Purity:Min. 95%Molecular weight:626.7 g/molLeptin (138-167) (human)
CAS:<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H224N37O47S2Purity:Min. 95%Molecular weight:3,253.64 g/molH-Pro-Asn-OH
CAS:<p>H-Pro-Asn-OH is a reactive functional group that is activated by the presence of acidic conditions. It can react with epoxides to form cyclic ethers. H-Pro-Asn-OH can be used in vitro studies to assess the activation of caspases, which are proteolytic enzymes that play a role in cell apoptosis. It has also been used for molecular imaging and as an antigen for immunotherapy in cancer treatment. This molecule has a reactive functional group on its side chain and reacts with epoxides to form cyclic ethers.</p>Formula:C9H15N3O4Purity:Min. 95%Molecular weight:229.23 g/molXenopsin-Related Peptide 1 (XP-1) trifluoroacetate salt
CAS:<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>Formula:C51H79N15O9Purity:Min. 95%Molecular weight:1,046.27 g/molZ-Homocit-OH
CAS:<p>Please enquire for more information about Z-Homocit-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N3O5Purity:Min. 95%Molecular weight:323.34 g/molOsteocalcin (37-49) (human)
CAS:<p>Please enquire for more information about Osteocalcin (37-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H104N20O19Purity:Min. 95%Molecular weight:1,589.75 g/molAc-Gly-Leu-OH
CAS:<p>L-phenylalanine is an amino acid that has a sweet taste. It is one of the 20 amino acids encoded by the universal genetic code, and is classified as a polar amino acid because it has a hydroxyl group on its side chain. L-Phenylalanine is used in the food industry as a sweetener and to enhance salty or acidic flavors. Phenylalanine has been shown to be an important precursor for several important neurotransmitters in the brain. This includes serotonin, dopamine, and norepinephrine. Phenylalanine also plays a role in protein metabolism and enzyme activity, including aminopeptidases and racemases, which are enzymes that catalyze reactions involving racemic mixtures.</p>Formula:C10H18N2O4Purity:Min. 95%Molecular weight:230.26 g/molMca-Arg-Pro-Lys-Pro-Gln-OH
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H56N10O11Purity:Min. 95%Molecular weight:840.92 g/molDynorphin B (1-9)
CAS:<p>Please enquire for more information about Dynorphin B (1-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H78N16O12Purity:Min. 95%Molecular weight:1,143.3 g/molZ-Lys(Aloc)-OH·DCHA
CAS:<p>Please enquire for more information about Z-Lys(Aloc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H24N2O6·C12H23NPurity:Min. 95%Molecular weight:545.71 g/molIQB-782
CAS:IQB-782 is a mucolytic agent with mucolytic expectorant activity for the study of obstructive lung disease.Formula:C4H9N3O2SPurity:>99.99%Color and Shape:SolidMolecular weight:163.2TRAP-14 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H119N21O22Purity:Min. 95%Molecular weight:1,738.94 g/molEthyl 2-oxo-4-phenylbutyrate
CAS:<p>Ethyl 2-oxo-4-phenylbutyrate is a compound that belongs to the class of ester compounds. This molecule is found in cells grown in recombinant cultures and has been identified by its FTIR spectroscopy. Ethyl 2-oxo-4-phenylbutyrate inhibits the growth of candida glabrata by inhibiting an enzyme, which is involved in the conversion of glucose to acetoin. The mechanism for this inhibition is believed to be due to cinchonidine, which reacts with chloride ions. The chemical stability of ethyl 2-oxo-4-phenylbutyrate has been shown by its ability to withstand acidic pH and high concentrations of chloride ions without decomposing. Ethyl 2-oxo-4-phenylbutyrate also inhibits the synthesis of proteins and enzymes, although it does not inhibit DNA replication or transcription.</p>Formula:C12H14O3Purity:Min. 95%Molecular weight:206.24 g/molH-Asp-Asp-Asp-Asp-OH
CAS:<p>Please enquire for more information about H-Asp-Asp-Asp-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N4O13Purity:Min. 95%Molecular weight:478.37 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/mol(Leu15)-Gastrin I (human)
CAS:Gastrin I (human) Pyr-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Leu-Asp, is a peptide that belongs to the family of cholecystokinin. It is synthesized by solid phase synthesis on a carboxyl group with an efficiency of more than 95%. Gastrin I (human) Pyr-Gly-Pro-Trp... has been shown to be selective towards amide bond cleavage and has high yield. It is also stable in acidic conditions and can be detritylated with phenoxy.Formula:C98H126N20O31Purity:Min. 95%Molecular weight:2,080.17 g/molZ-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>Formula:C30H43FN4O11Purity:Min. 95%Molecular weight:654.68 g/mol(D-Ala2)-Leu-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N9O8·xC2H4O2Purity:Min. 95%Molecular weight:725.84 g/molH-Ile-Gln-OH
CAS:<p>H-Ile-Gln-OH is an amide that is a major metabolite of the hormone prolactin. It is generated by deamination, which converts the amino acid histidine to H-Ile-Gln-OH. H-Ile-Gln-OH has been shown to have an antiinflammatory effect on colitis and cardiac reperfusion injury. Its mechanism of action may be due to its ability to inhibit proinflammatory cytokines such as IL1β and TNFα.</p>Formula:C11H21N3O4Purity:Min. 95%Molecular weight:259.3 g/molZ-Arg(Mtr)-OtBu
CAS:<p>Please enquire for more information about Z-Arg(Mtr)-OtBu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H40N4O7SPurity:Min. 95%Molecular weight:576.71 g/mol4-Chloro-6-methyl-2-trifluoromethylpyrimidine
CAS:<p>Please enquire for more information about 4-Chloro-6-methyl-2-trifluoromethylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4ClF3N2Purity:Min. 95%Molecular weight:196.56 g/molAngiotensin I/II (1-6)
CAS:Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.Formula:C36H55N11O10Purity:Min. 95%Molecular weight:801.89 g/mol(Nle 8·18,Tyr34)-pTH (1-34) (human)
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H295N55O52Purity:Min. 95%Molecular weight:4,097.64 g/mol1-O-Hexadecyl-sn-glycerol
CAS:<p>1-O-Hexadecyl-sn-glycerol is a glycol ether that is used as a surfactant and emulsifier in cosmetic products. It has been shown to have minimal toxicity, and to not be carcinogenic or teratogenic. 1-O-Hexadecyl-sn-glycerol has been shown to increase the stability of proteins in rat liver microsomes, and it also prevents the hydrolysis of carbohydrates. The surface glycoprotein adsorbed by 1-O-Hexadecyl-sn-glycerol may play an important role in the binding of monoclonal antibodies. This compound affects cellular calcium levels, with high concentrations resulting in increased cytosolic calcium concentrations. Zirconium oxide can replace calcium ions in 1-O-Hexadecyl-sn-glycerol for this purpose, although this substitution reduces enzyme activity.</p>Formula:C19H40O3Purity:Min. 95%Molecular weight:316.52 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys-Gly-Lys-OH acetate salt
CAS:<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>Formula:C14H29N5O4Purity:Min. 95%Molecular weight:331.41 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molDABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/molFmoc-His(1-Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-His(1-Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Hyp (Bzl)-OH·HCl
CAS:<p>Please enquire for more information about H-Hyp (Bzl)-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H15NO3·HClPurity:Min. 95%Molecular weight:257.71 g/molBoc-beta-iodo-Ala-OMe
CAS:<p>Boc-beta-iodo-Ala-OMe is a hydrophobic reagent that can be used in peptide synthesis. It can be used in organic solvents, such as methyl ester, to synthesize homologues of amino acids and amino acid derivatives. Boc-beta-iodo-Ala-OMe is an electrophile that reacts with a nucleophile to produce the corresponding enantiomeric product. The hydrophobic nature of this reagent makes it useful for reactions involving solvents with low polarity, such as halides and alcohols.</p>Formula:C9H16INO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:329.13 g/mol(Sar 1)-Angiotensin II
CAS:<p>Please enquire for more information about (Sar 1)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H71N13O10Purity:Min. 95%Molecular weight:1,002.17 g/molTAT 2-4 trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C132H240N66O29Purity:Min. 95%Molecular weight:3,215.75 g/molNeuromedin B trifluoroacetate salt
CAS:<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/molH-Glu-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/molGlycine - EP
CAS:<p>Glycine is a buffering agent that can be used in electrophoresis for protein samples. It has an optimal pH range of 2.2-3.6 and a pKa of 2.35.</p>Formula:NH2CH2COOHPurity:Min. 95%Molecular weight:75.07 g/molH-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Nle-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Nle-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Bz-Asn-Gly-Thr-NH2
CAS:<p>Please enquire for more information about Bz-Asn-Gly-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O6Purity:Min. 95%Molecular weight:393.39 g/molCecropin A (1-8)-Melittin (1-18) amide
CAS:<p>Please enquire for more information about Cecropin A (1-8)-Melittin (1-18) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H233N33O29Purity:Min. 95%Molecular weight:2,794.51 g/molS-(1,2-Dicarboxyethyl)glutathione
CAS:<p>S-(1,2-Dicarboxyethyl)glutathione is a glutathione analogue that has been shown to prevent acetaminophen-induced hepatotoxicity in mice. It inhibits the reaction between acetaminophen and hepatic microsomal cytochrome P450 enzymes, which prevents the formation of toxic metabolites. S-(1,2-Dicarboxyethyl)glutathione also inhibits the production of serotonin by inhibiting the enzyme tryptophan hydroxylase. This drug has an anticoagulant effect by preventing the conversion of prothrombin to thrombin. S-(1,2-Dicarboxyethyl)glutathione also affects growth factors and collagen synthesis by affecting both epidermal growth factor (EGF) and fibroblast growth factor (FGF). The optimum pH for this drug is at 7.0.</p>Formula:C14H21N3O10SPurity:Min. 95%Molecular weight:423.4 g/molNeuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H288N56O57Purity:Min. 95%Molecular weight:4,064.48 g/molZ-Pro-Leu-Gly-OH
CAS:<p>Z-Pro-Leu-Gly-OH is a peptide that belongs to the class of amides, oxalate salts, and grignard reagents. It can be synthesized from the reaction between an oxalate salt and a grignard reagent. The synthesis of Z-Pro-Leu-Gly-OH is usually done by reacting an oxalate salt with a grignard reagent in presence of a ketone or ketomethylene.</p>Formula:C21H29N3O6Purity:Min. 95%Molecular weight:419.47 g/mol2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide
CAS:<p>2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide is a signal molecule that has antimicrobial activity. It inhibits the proliferation of cells and is used as an antifungal agent. 2,5,6-Trimethyloxathiinium ion has been shown to induce apoptosis in human leukemia cells and inhibit the growth of erythrocytes infected with Plasmodium falciparum. This compound also inhibits wild type strains of bacteria and fungi and can be used as a natural fungicide. 2,5,6-Trimethyloxathiinium ion has been found to be effective in treating autoimmune diseases such as diabetes mellitus type II, which may be due to its ability to regulate glucose metabolism and suppress inflammatory responses.</p>Formula:C12H13NO2SPurity:Min. 95%Molecular weight:235.3 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH
CAS:<p>Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH is a molecule that can be used to generate an antigen against tumor necrosis factor alpha (TNFα). It has been shown to be able to bind TNFα and prevent it from binding to its receptors. This leads to a decrease in the production of cytokines, as well as a decrease in the activation of cytosolic guanylate cyclase. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH has also been shown to inhibit the proliferation of cancer cells by inhibiting extracellular Ca2+ influx and cytosolic Ca2+ ion concentrations.</p>Formula:C59H111N3O9SPurity:Min. 95%Molecular weight:1,038.59 g/molEpsilon-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt
CAS:<p>Epsilon-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt (EMAP) is a crosslinker that belongs to the group of heterobifunctional reagents. It has been used to conjugate monoclonal antibodies with other molecules, such as toxins. EMAP is activated by the dianion generated by protonation of the nitro groups on the phenyl ring and reacts with free amines or thiols in proteins. EMAP can be used for labeling immunotoxins for diagnostic use, maximizing detection sensitivity, and crosslinking DNA molecules for use in molecular cloning experiments.</p>Formula:C16H15N2NaO9SPurity:Min. 95%Molecular weight:434.35 g/molLHRH hydrochloride salt
CAS:<p>LHRH is a hormone that has been used to treat endometriosis, prostate cancer, and ovarian cysts. It is an agonist of the gonadotropin-releasing hormone receptor (GnRH receptor). LHRH binds to the GnRH receptor in the pituitary gland and stimulates the release of follicle-stimulating hormone and luteinizing hormone. This leads to increased production of estrogen and testosterone. LHRH has been shown to be effective in treating infectious diseases such as tuberculosis and HIV/AIDS. LHRH can also be used as a diagnostic aid for determining whether or not a tumor is cancerous by measuring its protein content.</p>Formula:C55H75N17O13·xHClPurity:Min. 95%Molecular weight:1,182.29 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molH-Gly-Gly-Arg-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/mol4-Fluoromethyl-alpha-methylbenzyl alcohol
CAS:<p>4-Fluoromethyl-alpha-methylbenzyl alcohol is a nonclassical molecule that has been synthesized. This molecule has been modeled computationally and the results indicate that it exhibits a planar geometry with a diastereomeric ratio of 1:1. The theoretical calculations show that the reaction of 4-fluoromethyl-alpha-methylbenzyl alcohol with water is exothermic, which would result in the formation of an intermediate hydroxide ion. Kinetic studies have shown that this molecule can undergo transfer reactions and dehydrogenation reactions, both of which are possible mechanisms for its reactivity.</p>Formula:C8H9FOPurity:Min. 95%Molecular weight:140.15 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/molH-Pro-Leu-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H26N4O5Purity:Min. 95%Molecular weight:342.39 g/molLHRH (free acid) trifluoroacetate salt
CAS:<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>Formula:C55H74N16O14Purity:Min. 95%Molecular weight:1,183.28 g/mol1-Methylpiperidine-4-carboxylic acid hydrochloride
CAS:<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>Formula:C7H14NO2ClPurity:Min. 95%Molecular weight:179.64 g/molGM-CSF (17-31)
CAS:<p>Please enquire for more information about GM-CSF (17-31) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H129N27O24Purity:Min. 95%Molecular weight:1,768.97 g/molH-Arg-D-Asp-OH
CAS:<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N5O5Purity:Min. 95%Molecular weight:289.29 g/molBoc-D-His(Boc)-OH benzene solvate
CAS:<p>Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H25N3O6Purity:Min. 95%Color and Shape:SolidMolecular weight:355.39 g/molH-Glu(OtBu)-allyl ester·HCl
CAS:<p>Please enquire for more information about H-Glu(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO4·HClPurity:Min. 95%Molecular weight:279.76 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Glu-OH
CAS:<p>H-Arg-Glu-OH is a small molecule that is used as a pharmacological agent for the treatment of diabetes. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of inflammatory mediators such as prostaglandin E2 and nitric oxide. H-Arg-Glu-OH also induces apoptosis in human monocytes and macrophages by binding to toll-like receptor 4 (TLR4) on the cell surface. This binding activates NFκB and JNK pathways, leading to the induction of apoptosis. H-Arg-Glu-OH binds with high affinity to monoclonal antibodies against glutamic acid and glycine, which are not present in humans. The compound may be toxic at a neutral pH because it is highly reactive due to intramolecular hydrogen bonding between carbonyl oxygens and amide hydrogens.</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/moltrans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate
CAS:<p>Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2
CAS:<p>Please enquire for more information about H-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H107N23O16Purity:Min. 95%Molecular weight:1,418.65 g/molAmyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H141N21O30SPurity:Min. 95%Molecular weight:1,993.24 g/mol(Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H189N33O36Purity:Min. 95%Molecular weight:2,682 g/mol1-Boc-5-Cyano-3-hydroxymethylindole
CAS:<p>Please enquire for more information about 1-Boc-5-Cyano-3-hydroxymethylindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H16N2O3Purity:Min. 95%Molecular weight:272.3 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/mol4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride
CAS:<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27N3O4•2HClPurity:Min. 95%Color and Shape:PowderMolecular weight:482.4 g/mol(D-Pro4,D-Trp7·9·10)-Substance P (4-11)
CAS:<p>Substance P is a neuropeptide that is found in the central nervous system. It is also found in the gastrointestinal tract and plays a role in the regulation of smooth muscle contraction. Substance P has been shown to be involved in inflammatory responses, immune responses, and regulation of water and electrolyte balance. The maximal response of substance P occurs at concentrations between 0.1 to 1 nM and its inhibitory effect on the apical Ca2+ response occurs at concentrations between 10-100 nM. In addition, substance P has been shown to have an excitatory effect on 5-HT7 receptors with subunit composition GluN1/GluN2A/GluN2B/GluN3A/5-HT7(H).</p>Formula:C62H74N14O10SPurity:Min. 95%Molecular weight:1,207.41 g/molCalcium-Like Peptide 3 trifluoroacetate salt
CAS:<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N10O9Purity:Min. 95%Molecular weight:881.07 g/mol(Met(O)5)-Enkephalin
CAS:<p>Met-enkephalin is a molecule that is formed from two of the three parts of the endorphin molecule, which are Tyr-Gly-Gly-Phe and Met(O)OH. It is a neurotransmitter that has been shown to inhibit pain in humans and animals. In coelomocytes, met-enkephalin binds to receptors on the cell membrane and inhibits the release of dopamine by binding to dopamine receptors. The sulfoxide group of this molecule can be reduced to form enkephalinase, which is an enzyme that cleaves Met(O)OH from the peptide chain. This process is not known to occur in humans or other mammals. Met-enkephalin has been localized in ganglia cells in animals, but not humans. It has also been found in messenger RNA (mRNA) for translation into protein, but it does not appear to be translated into protein in humans or other mammals.</p>Formula:C27H35N5O8SPurity:Min. 95%Molecular weight:589.66 g/molAlternariol-9-methyl ether
CAS:<p>Alternariol-9-methyl ether is a natural compound that has been shown to have significant cytotoxic effects on murine hepatoma cells. This compound also synergizes with anti-retroviral drugs and has been found to be capable of inducing apoptosis in HIV-infected T cells at low concentrations. Alternariol-9-methyl ether is structurally related to the polycyclic aromatic hydrocarbons, such as alternariol, which are only weakly toxic to mice but are potent pro-apoptotic proteins when bound covalently to DNA. Structural analysis of this compound revealed that it inhibits the binding of a pro-apoptotic protein (Bid) to its target site on dsDNA, preventing Bid from initiating apoptosis. It is thought that this effect may be responsible for its synergistic interaction with active antiretroviral therapy.</p>Formula:C15H12O5Purity:Min. 95%Color and Shape:PowderMolecular weight:272.25 g/molEndotoxin Inhibitor
CAS:<p>Endotoxin inhibitor H-Lys-Thr-Lys-Cys-Lys-Phe-Leu-Lys-Lys-Cys-OH is a natural disulfide bond that inhibits cytosolic Ca2+ release and bacterial translocation. It has been shown to decrease the production of tumor necrosis factor alpha (TNFα) in vitro, which may be due to its effects on protein synthesis. It also has antimicrobial activity against bacteria such as Clostridium perfringens, Mycobacterium tuberculosis, and Mycobacterium avium complex. Endotoxin inhibitor H-Lys-Thr-Lys-Cys-Lys-Phe-Leu-Lys-- Lys -Cys -OH binds to the ribosomal RNA of bacteria, inhibiting protein synthesis by binding to the peptidyl transferase center</p>Formula:C55H97N15O12S2Purity:Min. 95%Molecular weight:1,224.58 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molTyr-Somatostatin-14
CAS:<p>Please enquire for more information about Tyr-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H113N19O21S2Purity:Min. 95%Molecular weight:1,801.05 g/molAcetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt
CAS:<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>Formula:C22H40N6O8Purity:Min. 95%Molecular weight:516.59 g/molAloc-beta-(3-pyridyl)-DL-Ala-OH
CAS:<p>Please enquire for more information about Aloc-beta-(3-pyridyl)-DL-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H14N2O4Purity:Min. 95%Molecular weight:250.25 g/molH-Gly-Gly-b-Ala-OH
CAS:<p>Please enquire for more information about H-Gly-Gly-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/molBoc-Thr-OBzl
CAS:<p>Please enquire for more information about Boc-Thr-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H23NO5Purity:Min. 95%Molecular weight:309.36 g/molPrepro-Neuromedin S (70-103) (human) trifluoroacetate salt
<p>Please enquire for more information about Prepro-Neuromedin S (70-103) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H271N49O44SPurity:Min. 95%Molecular weight:3,857.45 g/molN-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H35N3O3Purity:Min. 95%Molecular weight:425.56 g/molPyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H57N13O9Purity:Min. 95%Molecular weight:827.93 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21N5O7Purity:Min. 95%Molecular weight:395.37 g/molGalanin (1-19) (human)
CAS:<p>Please enquire for more information about Galanin (1-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H130N26O25Purity:Min. 95%Molecular weight:1,964.14 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/molH-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>Formula:C40H58N10O7SPurity:Min. 95%Molecular weight:823.02 g/molBiotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H176N32O32SPurity:Min. 95%Molecular weight:2,574.91 g/molBoc-Phe-OBzl
CAS:<p>Please enquire for more information about Boc-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H25NO4Purity:Min. 95%Molecular weight:355.43 g/molAc-Arg-Phe-Met-Trp-Met-Arg-NH2
CAS:<p>Ac-Arg-Phe-Met-Trp-Met-Arg-NH2 is a synthetic peptide that binds to the opioid receptors, which are found in many areas of the body, including the brain and peripheral nervous system. Ac-Arg-Phe-Met-Trp-Met-Arg-NH2 has been shown to bind to the mu receptor with an affinity of ˜1 nM. It has also been shown to have antiinflammatory and anticancer properties. Ac-Arg-Phe-Met-Trp-Met -Arg NH2 has also been found in some cases to be effective against neurodegenerative diseases such as Alzheimer's disease. Ac Arg Phe Met Trp Met Arg NH2 is often used as a diluent for peptides and proteins because it does not cause aggregation.</p>Formula:C44H66N14O7S2Purity:Min. 95%Molecular weight:967.22 g/molH-Thr(Ac)-OH·HCl
CAS:<p>Please enquire for more information about H-Thr(Ac)-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H11NO4·HClPurity:Min. 95%Molecular weight:197.62 g/mol2-Fluoro-6-methylbenzoic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H7FO2Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:154.14 g/molH-Leu-NHOH·TFA
CAS:<p>H-Leu-NHOH·TFA is a histidine analogue that is used as a catalyst. It has been shown to be an effective inhibitor of corynebacteria, and can be used in the synthesis of fatty acids, which are important for cell membrane production. H-Leu-NHOH·TFA also binds to the enzyme synthetase and inhibits its activity, which blocks the conversion of ammonia and amino acids into polypeptides. This inhibition prevents bacterial growth. H-Leu-NHOH·TFA is active at acidic pH levels, with a maximum activity at pH 4.0. The optimum temperature for this compound is 50°C, but it will still work at temperatures up to 60°C.</p>Formula:C6H14N2O2·C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:260.21 g/molSomatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/molZ-Phe-Leu-Ala-OH
CAS:<p>Z-Phe-Leu-Ala-OH is a homologous protein that has been shown to have proteolytic activity. It has a neutral pH and is stable in the presence of metal ions. This enzyme is structurally similar to subtilisin, with a sequence of residues containing two histidine residues, which are important for stability. The kinetic parameters of this enzyme were determined by analyzing its activity under different conditions and at different temperatures. The mutant Z-Phe-Leu-Ala-OH was found to be more active than the wild type at high temperature, but less active at low temperature, suggesting that the protein could be used as an industrial catalyst in food processing or chemical production.</p>Formula:C26H33N3O6Purity:Min. 95%Molecular weight:483.56 g/molFmoc-Lys(Boc)-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H41N3O8Purity:Min. 95%Molecular weight:595.68 g/molZ-Lys-Arg-pNA·2 HCl
CAS:<p>This is a new inhibitor of phosphatase 2A (PP2A) that is in the form of a zwitterion. The compound has been shown to have significant inhibitory activity on PP2A in vitro and in vivo, with an IC50 of 0.12 μM and 0.28 μM respectively. The compound also showed significant inhibitory activity against PP2A-related enzymes, such as PP1, PP2B, and PP4. Z-Lys-Arg-pNA·2 HCl has been shown to be effective at inhibiting phosphatases in plants, including seed germination and seedling growth.</p>Formula:C26H36N8O6·2HClPurity:Min. 95%Molecular weight:629.54 g/molBiotinyl-Tyr-Val-Ala-Asp-chloromethylketone
CAS:Please enquire for more information about Biotinyl-Tyr-Val-Ala-Asp-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C32H45ClN6O9SPurity:Min. 95%Molecular weight:725.25 g/mol(Nle 35)-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H313N55O60Purity:Min. 95%Molecular weight:4,496 g/molSomatostatin-14 (reduced)
CAS:Somatostatin-14 (reduced) H-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys is a synthetic peptide that is an adjuvant for vaccines. It induces a biphasic response by increasing the humoral immune response and decreasing the cellular immune response. Somatostatin has been shown to decrease the severity of symptoms in patients with psychiatric disorders and can be used as a long term treatment for these conditions. Somatostatin also has effects on the pancreas, such as inhibiting insulin release, leading to decreased blood glucose levels. Its disulfide bond in its structure may be important for its activity and stability.Formula:C76H106N18O19S2Purity:Min. 95%Molecular weight:1,639.9 g/molBoc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt
CAS:<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>Formula:C34H52N8O10Purity:Min. 95%Molecular weight:732.82 g/molBuccalin trifluoroacetate salt
CAS:<p>Buccalin is a cholinergic pharmaceutical drug that has been shown to have metabolic, growth factor, and chemotactic activities. It has been used in the treatment of various autoimmune diseases and infectious diseases. The mechanism of action for buccalin is unknown. Buccalin has been shown to have receptor activity in a variety of diagnostic agents such as monoclonal antibodies and fatty acids. It binds to acetylcholine receptors at the neuromuscular junction, leading to activation of muscle fibers by acetylcholine release from nerve endings.</p>Formula:C45H72N12O15SPurity:Min. 95%Molecular weight:1,053.19 g/molBexagliflozin
CAS:<p>Bexagliflozin is a drug that is used to treat type II diabetes in adults. It helps to control blood sugar levels by inhibiting the enzyme DPP-IV and increasing insulin release from the pancreas. Bexagliflozin has been shown to be effective in lowering blood sugar levels in patients with chronic kidney disease and cancer, as well as those with a body mass index (BMI) of 30 or higher. This drug is an oral hypoglycaemic agent that can be used for diagnostic purposes. It has also been shown to be clinically effective for the treatment of diabetic nephropathy and diabetic retinopathy. The enantiomers of bexagliflozin can be differentiated according to their pharmacological properties, which may allow for more targeted therapy.</p>Formula:C24H29ClO7Purity:Min. 95%Molecular weight:464.94 g/molFmoc-L-aspartic acid beta-allyl ester
CAS:<p>Fmoc-L-aspartic acid beta-allyl ester is a specific interaction between an amide and an enzyme target. It has been shown to have anti-inflammatory properties by inhibiting the activity of COX-2, which inhibits the production of prostaglandins. Fmoc-L-aspartic acid beta-allyl ester is a cyclic peptide with a lactam ring system that has been synthesized in a stepwise manner on a solid phase. This molecule interacts with cell line A549 and blocks the proliferation of cancer cells. Fmoc-L-aspartic acid beta-allyl ester also contains a disulfide bond that stabilizes its structure.</p>Formula:C22H21NO6Purity:Min. 95%Molecular weight:395.41 g/molZ-Asp-Met-OH
CAS:<p>Please enquire for more information about Z-Asp-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H22N2O7SPurity:Min. 95%Molecular weight:398.43 g/molH-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C27H38N6O5Purity:Min. 95%Molecular weight:526.63 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formula:C65H118N18O15Purity:Min. 95%Molecular weight:1,391.74 g/molZ-Ala-Tyr-OH
CAS:<p>Please enquire for more information about Z-Ala-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H22N2O6Purity:Min. 95%Molecular weight:386.4 g/molH-Gly-Gly-Pro-Ala-OH
CAS:<p>Glycosaminoglycans are polysaccharides that are made of repeating disaccharide units composed of a sugar and a uronic acid. Glycosaminoglycans serve as structural components in the extracellular matrix, where they provide tensile strength and elasticity to tissues. They also function as enzymes, providing energy for cellular processes. This glycosaminoglycan is found in human tissue, specifically the cervix and blood group antigens. It has been shown to have an effect on creatine kinase activity, which can be used as a screening tool for women who have had hysterectomies or biopsies done.</p>Formula:C12H20N4O5Purity:Min. 95%Molecular weight:300.31 g/molH-Gly-Gly-AMC hydrochloride salt
CAS:<p>H-Gly-Gly-AMC is a fluorescent substrate for the detection of protease activity. It can be used in a homogeneous assay to measure the protease activity of cells. The assay provides an accurate measurement of protease activity and the ability to normalize data to account for differences in cell number and protein content. H-Gly-Gly-AMC hydrochloride salt (HGG) is also a fluorogenic substrate for the determination of cell death or damage, which can be measured using aminoluciferin. This assay is based on the release of aminoluciferin from lysed cells, which fluoresces in proportion to the amount released.</p>Formula:C14H15N3O4Purity:Min. 95%Molecular weight:289.29 g/molN-alpha-Trityl-Nepsilon-Fmoc-L-lysine
CAS:<p>N-alpha-Trityl-Nepsilon-Fmoc-L-lysine is a pentapeptide that is used in peptides. It has been shown to have cytotoxicity and permeability, as well as being biologically active. N-alpha-Trityl-Nepsilon-Fmoc-L-lysine has also been used in solid phase synthesis of peptides. This pentapeptide can be synthesized using the Miyaura cross coupling reaction with an ether or Suzuki cross coupling reaction. N-alpha-Trityl-Nepsilon-Fmoc-L-lysine is a bicyclic molecule that can be synthesized on a solid phase.</p>Formula:C40H38N2O4Purity:Min. 95%Molecular weight:610.74 g/molN-(3-(2-Furyl)Acryloyl-Ala-Lys TFA salt
CAS:<p>FA-Ala-Lys-OH is a lysine derivative with a molecular weight of 243.2 daltons and a pKa of 6.5. It has been shown to be biologically active in humans and animals, and can be used as an amino acid supplement for patients with liver disease or kidney failure who require dialysis. FA-Ala-Lys-OH binds to the creatine kinase receptor on the surface of cells and causes cell lysis, which may be due to its ability to bind to the enzyme's allosteric site. This compound also has anti-viral properties, inhibiting the growth of recombinant virus mcf-7 in vitro by binding to erythrocyte membranes and disrupting protein synthesis. The 6-Fluoro-3-indoxyl beta D galactopyranoside is an antituberculosis drugs that belongs to the class of rifamycins. Rifapentine inhibits bacterial</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molH-Ala-Lys-Leu-Arg-Glu-Arg-Leu-Lys-Gln-Arg-Gln-Gln-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Ile-Leu-Phe-Leu-Gln-Glu-Gly-Gly-Leu-OH
CAS:<p>Please enquire for more information about H-Ala-Lys-Leu-Arg-Glu-Arg-Leu-Lys-Gln-Arg-Gln-Gln-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Ile-Leu-Phe-Leu-Gln-Glu-Gly-Gly-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H262N52O42Purity:Min. 95%Molecular weight:3,478.02 g/molIGF-II (33-40)
CAS:<p>This is a synthetic IGF-II peptide fragment (33-40) that has been immunized with an antiserum against the human growth hormone. It is used to measure the level of IGF-II in blood or serum. The immunizing antiserum cross-reacts with IgF-I and can also be used as a control for deficiency.</p>Formula:C38H74N20O12Purity:Min. 95%Molecular weight:1,003.12 g/mol(2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester
CAS:<p>Please enquire for more information about (2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H23N5O7Purity:Min. 95%Molecular weight:493.47 g/molSuc-Val-Pro-Phe-4MbNA
CAS:Please enquire for more information about Suc-Val-Pro-Phe-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C34H40N4O7Purity:Min. 95%Molecular weight:616.7 g/molSuc-Phe-Ala-Ala-Phe-pNA
CAS:<p>Suc-Phe-Ala-Ala-Phe-pNA is a serine protease with natriuretic properties. It has been shown to have high salt and pH optima and to be reactive at physiological pH. Suc-Phe-Ala-Ala-Phe-pNA has been sequenced and found to have a carboxy terminal reactive site. There are eight cysteine residues in the amino acid sequence of this protease, four of which are in the reactive site. This protease also has vasoactive intestinal peptide (VIP) activity, which is involved in inflammatory diseases.</p>Formula:C34H38N6O9Purity:Min. 95%Molecular weight:674.7 g/molH-Gly-Leu-Tyr-OH
CAS:<p>H-Gly-Leu-Tyr-OH is a tripeptide that is found in some human and animal proteins. The peptide contains glycine, leucine, tyrosine, and hydroxyproline. It binds to copper ions with an inhibition constant of 1.5 x 10^5 M and has a pH optimum of 7.0. In the active form, it inhibits α subunit of bacterial aminopeptidase which is required for protein synthesis in bacteria. The peptide also has been shown to be a model system for the study of enzyme mechanisms and as a chromatographic method for analyzing proteins in food chemistry.</p>Formula:C17H25N3O5Purity:Min. 95%Molecular weight:351.4 g/molFmoc-His-OMe
CAS:<p>Please enquire for more information about Fmoc-His-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H21N3O4Purity:Min. 95%Molecular weight:391.42 g/molTau-fluvalinate
CAS:<p>Tau-fluvalinate is a pesticide that is used to control ectoparasites. It has been shown to be effective against fleas, ticks, and mites. Tau-fluvalinate binds to the active site of the enzyme protein kinase C (PKC). This binding prevents the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3), which is required for cell signaling pathways and protein synthesis. Tau-fluvalinate also inhibits detoxification enzymes such as glutathione S-transferase (GST) and cytochrome P450 reductase. Tau-fluvalinate has been shown to have no sublethal effects on insects in vitro or in vivo at doses below its LD50. Tau-fluvalinate can also be used as an analytical standard for detecting polycyclic aromatic hydrocarbons in water samples with chemical ionization gas chromatography.</p>Formula:C26H22ClF3N2O3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:502.91 g/mol1-Methyl-1H-indazole-7-carbaldehyde
CAS:<p>1-Methyl-1H-indazole-7-carbaldehyde is a 1,3,5-substituted indazole derivative that can be used as a building block for the synthesis of complex compounds. It is an intermediate in the synthesis of various pharmaceuticals and it has been shown to have potential applications in research chemicals. 1-Methyl-1H-indazole-7-carbaldehyde can be used as a versatile building block after conversion to other derivatives. This chemical is also being investigated as a possible treatment for Parkinson's disease and Alzheimer's disease.</p>Formula:C9H8N2OPurity:Min. 95%Color and Shape:Yellow PowderMolecular weight:160.17 g/molH-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35ClN4O3Purity:Min. 95%Molecular weight:390.95 g/mol(D-Trp6)-LHRH (1-6) amide
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (1-6) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H49N11O9Purity:Min. 95%Molecular weight:887.94 g/molBoc-Asp(OtBu)-ONp
CAS:<p>Please enquire for more information about Boc-Asp(OtBu)-ONp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N2O8Purity:Min. 95%Molecular weight:410.42 g/molH-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Thr(Ile-Fmoc)-OH
CAS:Please enquire for more information about Boc-Thr(Ile-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C30H38N2O8Purity:Min. 95%Molecular weight:554.63 g/molBoc-Ala-Ala-Gly-pNA
CAS:<p>Boc-Ala-Ala-Gly-pNA is a peptide that has been synthesized using the Fmoc/tBu strategy. It has an acidic pH, and its proteolytic activity can be enhanced by the addition of chromogenic or fluorogenic substrates. Boc-Ala-Ala-Gly-pNA is used as a substrate in fingerprint analysis and can be used to identify bacteria such as Proteus mirabilis, Pseudomonas aeruginosa, and Bacillus cereus. This peptide can also be used to identify strains of Escherichia coli, Enterococci, Staphylococci, Streptococci, and Haemophilus influenzae.</p>Formula:C19H27N5O7Purity:Min. 95%Color and Shape:PowderMolecular weight:437.45 g/molBQ-123 Cyclo(-D-Trp-D-Asp-Pro-D-Val-Leu)
CAS:<p>BQ-123 is a cyclic peptide that has been shown to have a binding affinity for the serotonin receptor. The binding of BQ-123 to the receptor leads to a reduction in intracellular calcium concentration, which may be due to the inhibition of serine protease activity. This agent also inhibits the production of tumour necrosis factor-α (TNF-α) and has an inhibitory effect on cardiac contractility.</p>Formula:C31H42N6O7Purity:Min. 95%Molecular weight:610.7 g/molZ-Ala-Ala-OMe
CAS:<p>Z-Ala-Ala-OMe is a serine protease inhibitor that binds to serine proteases, including chymotrypsin, trypsin, and elastase. The inhibition of these enzymes prevents the hydrolysis of proteins by these enzymes, which can lead to cell death. Z-Ala-Ala-OMe has been shown to inhibit the growth of bacteria in vitro and in animal models. This compound also showed an ability to inhibit the production of phosphite by immobilized subtilisin from Bacillus licheniformis (Bacillus subtilis) with a Km value of 0.5 mM</p>Formula:C15H20N2O5Purity:Min. 95%Molecular weight:308.33 g/molFmoc-4,5-dehydro-L-leucine
CAS:Please enquire for more information about Fmoc-4,5-dehydro-L-leucine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C21H21NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:351.4 g/mol(Lys9,Trp11,Glu12)-Neurotensin (8-13) (Cyclic Analog)
CAS:<p>Please enquire for more information about (Lys9,Trp11,Glu12)-Neurotensin (8-13) (Cyclic Analog) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H59N11O8Purity:Min. 95%Molecular weight:809.96 g/molFmoc-Lys(Mtt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Lys(Mtt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Tyr-CRF (human, rat)
CAS:<p>Please enquire for more information about Tyr-CRF (human, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C217H353N61O65S2Purity:Min. 95%Molecular weight:4,920.63 g/molFmoc-His(Boc)-OPfp
CAS:<p>The Fmoc-His(Boc)-OPfp is a synthetic peptide that has been shown to bind to angiotensin. It is chemically reactive and can be used in diagnostic assays for the detection of angiotensin. The Fmoc-His(Boc)-OPfp can also be used as a feedback control for sequence analysis, where it monitors the reaction sequence by binding to the last amino acid in the peptide. This binding prevents the formation of an enzyme with the enzyme reaction necessary for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>Formula:C32H26F5N3O6Purity:Min. 95%Molecular weight:643.56 g/mol

