Organic Halides
Subcategories of "Organic Halides"
Found 20442 products of "Organic Halides"
4-Chloro-6-methoxyquinoline
CAS:4-Chloro-6-methoxyquinoline is an inhibitor of bacterial DNA gyrase. It has antibacterial activity against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus, Enterococcus faecalis, and Pseudomonas aeruginosa. 4-Chloro-6-methoxyquinoline is a synthetic compound that was reinvestigated for its antibacterial activity. It has been shown to be effective in the treatment of Staphylococcal infections. The mechanism of action may involve inhibition of topoisomerase II or interference with the synthesis of DNA by binding to the enzyme bacterial DNA gyrase. Quinidine and cinchonidine are quinine derivatives that have been found to inhibit bacterial DNA gyrase. These compounds are found in the bark of Cinchona species, which includes Cinchona ledgeriana, Cinchona officinalis, and Cinchona succirubFormula:C10H8ClNOPurity:Min. 95%Molecular weight:193.63 g/mol1-(4-Chlorothiophen-2-yl)ethanone
CAS:1-(4-Chlorothiophen-2-yl)ethanone is an oxychloride that belongs to the family of thiourea derivatives. It is synthesized by reacting phosphorus oxychloride with 2,3-dichloroacetophenone in a solvent such as dioxane or acetonitrile. The final product is purified by means of vacuum distillation and recrystallization from diethyl ether, hexane, and chlorinated hydrocarbons.Formula:C6H5ClOSPurity:Min. 95%Molecular weight:160.62 g/molPhylloseptin-L2 trifluoroacetate salt
CAS:Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C76H126N18O19Purity:Min. 95%Molecular weight:1,595.92 g/molSodium 2,3,5,6-Tetrafluoro-4-hydroxybenzenesulfonate
CAS:Sodium 2,3,5,6-Tetrafluoro-4-hydroxybenzenesulfonate is a synthetic compound that is used as a probe for catalytic reactions. It has been shown to be active in the oxidation of glycols and ethylene glycols. This compound is also useful for the tethering of metal atoms or ions. Sodium 2,3,5,6-Tetrafluoro-4-hydroxybenzenesulfonate can be used in catalysis due to its ability to act as an electron donor.Formula:C6HF4NaO4SPurity:Min. 95%Color and Shape:White PowderMolecular weight:268.12 g/mol3,5-Dimethylbenzyl bromide
CAS:3,5-Dimethylbenzyl bromide is a chemical reagent that is used in homogeneous catalysis. It is prepared by the cross-coupling of an aryl chloride with methyl 3,5-dimethylbenzoate. The compound has been shown to be effective in the treatment of inflammatory diseases such as rheumatoid arthritis and Crohn's disease, as well as other types of inflammatory disorders. This drug has been shown to have anti-inflammatory properties by inhibiting prostaglandin synthesis and may also inhibit the production of cytokines and nitric oxide. 3,5-Dimethylbenzyl bromide has been used clinically as an organic solvent for urine samples.Formula:C9H11BrPurity:Min. 95%Color and Shape:PowderMolecular weight:199.09 g/molH-Lys-Thr-OH hydrochloride salt
CAS:H-Lys-Thr-OH hydrochloride salt is a synthetic amino acid that has been used in the synthesis of a cyclic peptide. The synthesis was achieved by metathesis reactions, which involved the reaction of an acid chloride with a chiral amine to form an ester. H-Lys-Thr-OH hydrochloride salt has been shown to have high binding constants to its targets and can be used as a selective reagent for the synthesis of virus proteins. It is also able to bind to carboxylate groups, which are common in wild type viruses and gene products. This reagent also has cleavage products, which can be used for efficient method for synthesizing cyclic peptides.
Formula:C10H21N3O4Purity:Min. 95%Molecular weight:247.29 g/mol(D-Trp6)-LHR
Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/molBoc-Asp(OBzl)-chloromethylketone
CAS:Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.Formula:C17H22ClNO5Purity:Min. 95%Molecular weight:355.81 g/mol(Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt
CAS:Please enquire for more information about (Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C153H225N43O50SPurity:Min. 95%Molecular weight:3,498.75 g/molAmyloid beta-Protein (3-40) trifluoroacetate salt
CAS:Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C187H285N51O54SPurity:Min. 95%Molecular weight:4,143.64 g/molMelanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:Please enquire for more information about Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C46H72N10O15Purity:Min. 95%Molecular weight:1,005.12 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol(Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:Please enquire for more information about (Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C167H277N51O49S2Purity:Min. 95%Molecular weight:3,847.43 g/molGLP-2 (1-34) (human) trifluoroacetate salt
CAS:Structure/Function: human; Trifluoroacetate saltFormula:C171H266N48O56SPurity:Min. 95%Molecular weight:3,922.3 g/mol4-Fluorobenzoic acid
CAS:4-Fluorobenzoic acid is a chemical compound with the molecular formula C6H4FO2 and is a member of the group of chemicals known as carboxylic acids. It has been shown to have high levels of antibacterial activity against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). 4-Fluorobenzoic acid can be used for wastewater treatment and also has the potential to be used in other applications such as an antimicrobial agent or an additive in food packaging. The mechanism of its antibacterial activity is not well understood but may be related to its ability to inhibit the enzyme diphenolase, which catalyzes the conversion of phenols into quinones.Formula:C7H5FO2Purity:Min. 95%Color and Shape:White To Yellow SolidMolecular weight:140.11 g/mol2-Bromooxazole
CAS:2-Bromooxazole is a synthetic compound that inhibits the translation of mRNA in pancreatic cancer cells by binding to the interleukin-1 receptor. It also inhibits diacylglycerol synthesis, which causes a reduction in the production of amide and fatty acid. 2-Bromooxazole has been shown to have an immunosuppressive effect on lymphocytic leukemia cells and chronic lymphocytic leukemia cells. This drug is currently being studied for its potential use as an anticancer agent.Formula:C3H2BrNOPurity:Min. 95%Molecular weight:147.96 g/molTyr-alpha-CGRP (human) trifluoroacetate salt
CAS:Please enquire for more information about Tyr-alpha-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C172H276N52O51S2Purity:Min. 95%Molecular weight:3,952.48 g/molMet(O)14-Exenatide trifluoroacetate salt
CAS:Please enquire for more information about Met(O)14-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C184H282N50O61SPurity:Min. 95%Molecular weight:4,202.57 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molIndium (III) chloride
CAS:Indium (III) chloride is a reactive metal with a high oxidation state that has been shown to have significant cytotoxic effects in vitro. It is also genotoxic, which may be due to the generation of hydroxyl radicals and other reactive oxygen species. Indium (III) chloride has been used for the treatment of various infectious diseases, including HIV, Epstein-Barr virus, herpes simplex virus type 1, and influenza A virus. The toxicity of this metal is dependent on the concentration and duration of exposure. Indium (III) chloride is metabolized by plasma mass spectrometry as a substrate molecule for cytochrome P450 enzymes. This reaction results in the formation of an active metabolite that can bind to DNA and affect mitochondrial membrane potential. Indium (III) chloride has also been used as a contrast agent in fluorescein angiography or particle imaging techniques to visualize the presence of biological materials such as tissue necrosis or inflammation.Formula:Cl3InPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:221.18 g/molAcetylcholine perchlorate
CAS:Acetylcholine perchlorate is a pharmacological agent that is used to induce acetylcholine release by the brain. It can be used to study cholinergic mechanisms in the brain and bowel disease. Acetylcholine perchlorate has been shown to have physiological effects, such as increasing heart rate and blood pressure, which may be due to its ability to activate nicotinic acetylcholine receptors. Acetylcholine perchlorate has also been shown to cause chemiluminescence reactions that are similar to those seen in biological studies of acetylcholine receptors.Formula:C7H16ClNO6Purity:Min. 95%Color and Shape:PowderMolecular weight:245.66 g/molGermaniumtetrachloride
CAS:Germaniumtetrachloride (GeCl4) is a thermal expansion agent that is used in the production of boron nitride and zirconium oxide. It is also used as a catalyst for hydrochloric acid and hydroxyl group reactions. GeCl4 has carcinogenic potential, but this has not been confirmed in animal studies. GeCl4 is an effective solid catalyst for the reaction of hydrogen chloride with ethylene oxide to form polyethylene glycols. The mechanism of this reaction involves a substitution reaction between the chlorine ion and the hydroxyl group on the catalyst surface, forming chlorohydrocarbonate ions, which react with ethylene oxide to form polymer chains. This process can be carried out at room temperature or below, without using any solvents or catalysis promoters such as mercury or sulfur dioxide.Formula:Cl4GePurity:Min. 95%Molecular weight:214.44 g/mol(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride
CAS:(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride is a synthetic chiral compound that is used to study the role of glyoxylate in biochemical reactions. This drug is an enolate and alkylating agent that can react with nucleophiles such as amines and thiols. It has been shown to be effective against perchlorates by hydrolyzing them into chlorine and oxygen gas. This drug has also been shown to inhibit the growth of Rhodobacter sphaeroides by inhibiting glyoxylate metabolism.Formula:C12H15NO4·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:273.71 g/mol2-Chloro-3,5-bis(trifluoromethyl)pyridine
CAS:Please enquire for more information about 2-Chloro-3,5-bis(trifluoromethyl)pyridine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C7H2ClF6NPurity:Min. 95%Molecular weight:249.54 g/mol2,3-Dichloropropionitrile
CAS:2,3-Dichloropropionitrile is a synthetic chemical that is used for the chlorination of calcium carbonate. It is also used in the production of ester hydrochloride and acrylonitrile. The reaction vessel contains calcium carbonate and malonic acid, which are heated with hydrochloric acid. 2,3-Dichloropropionitrile is added to the reaction products to produce ester hydrochloride and acrylonitrile. The product can be isolated by adding hydrogen chloride to the reaction mixture.Formula:C3H3Cl2NPurity:Min. 95%Molecular weight:123.97 g/mol2-Bromopropionic acid benzyl ester
CAS:2-Bromopropionic acid benzyl ester is a synthetic compound with a molecular weight of 220.24 g/mol. It is soluble in organic solvents and has a hydroxyl group at its alpha position. 2-Bromopropionic acid benzyl ester is used in the synthesis of beta-cyclodextrin, which is an important biomaterial for drug delivery as well as other applications. 2-Bromopropionic acid benzyl ester also has antioxidant properties and can be used to treat leukemia cells by inhibiting the production of reactive oxygen species (ROS).
Formula:C10H11BrO2Purity:Min. 95%Molecular weight:243.1 g/molChloromethyl isopropyl carbonate
CAS:Chloromethyl isopropyl carbonate (CIC) is a prodrug that is converted to disoproxil in the body. It has significant cytotoxicity and antiviral activity against HIV and other viruses, but has not been used clinically due to its chemical instability. CIC can be administered orally as a prodrug, with the active form of CIC being tenofovir disoproxil. Tenofovir disoproxil is metabolized by proximal tubules and has shown efficacy for treating hepatitis B and C. Tenofovir has also been shown to decrease the incidence of renal disease in HIV patients.
Formula:C5H9ClO3Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:152.58 g/mol12-Fluorododecan-1-ol
CAS:12-Fluorododecan-1-ol is a volatile chemical compound that is found in the exoskeleton of termites. It has been shown to be a major component of the termiticide, FluoroCitrate. 12-fluorododecan-1-ol can be used to control the growth of insect populations by interfering with their ability to synthesize fatty acids and alcohols. It also has an effect on protein synthesis and inhibits the activity of citrate synthase, which is an enzyme involved in glycolate metabolism. This compound is also toxic to some species of insects such as Rhinotermitidae. 12-fluorododecan-1-ol can be used as a marker for Reticulitermes flavipes (a type of wood eating cockroach) and it can be used to distinguish between different species or strains of termites.Formula:C12H25FOPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:204.32 g/molMethyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate
CAS:Please enquire for more information about Methyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%alpha-Chloro-2-nitrobenzaldoxime
CAS:The heterocycle alpha-chloro-2-nitrobenzaldoxime is a functional group that can be oriented in two different ways. The diversity of the product arises from the fact that it is possible to create new functional groups by substitution on the benzene ring and on the nitrogen. Heterocyclization of alpha-chloro-2-nitrobenzaldoxime can be achieved by using other heterocycles such as isoxazoles, which are readily available in large quantities, as building blocks. This reaction can be catalyzed by reductive means with sodium borohydride and methanol.Formula:C7H5ClN2O3Purity:Min. 95%Molecular weight:200.58 g/mol4-tert-Butyl-2,6-dimethylphenylsulfur trifluoride
CAS:4-tert-Butyl-2,6-dimethylphenylsulfur Trifluoride is a chemical compound that is used as an intermediate in the synthesis of pharmaceuticals. It has been shown to be effective against 5-HT2C receptors and is used in the treatment of obesity. The mechanism of action for 4-tert-Butyl-2,6-dimethylphenylsulfur Trifluoride is not yet known but it may involve cleavage of amide bonds or stereoisomerism. 4-tert-Butyl-2,6-dimethylphenylsulfur Trifluoride has been synthesized by reacting hydrogen fluoride with sulfur trifluoride in the presence of a base.Formula:C12H17F3SPurity:90%MinColor and Shape:PowderMolecular weight:250.32 g/mol4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester
CAS:Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H12BrNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:302.12 g/molN-(3-Aminopropyl)-2,2,3,3,4,4,5,5,6,6,7,7,8,8,8-pentadecafluorooctanamide
CAS:Controlled ProductPlease enquire for more information about N-(3-Aminopropyl)-2,2,3,3,4,4,5,5,6,6,7,7,8,8,8-pentadecafluorooctanamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C11H9F15N2OPurity:Min. 95%Molecular weight:470.18 g/molH-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt
CAS:H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.Formula:C14H25ClN6O5Purity:Min. 95%Molecular weight:392.84 g/molLHRH (1-5) (free acid) trifluoroacetate salt
CAS:LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)Formula:C34H38N8O9Purity:Min. 95%Color and Shape:PowderMolecular weight:702.71 g/molAmylin (free acid) (human) trifluoroacetate salt
CAS:Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C165H260N50O56S2Purity:Min. 95%Molecular weight:3,904.27 g/mol(S)-(+)-Naproxen chloride
CAS:COX1/2 inhibitor; nonsteroidal anti-inflammatory drug
Formula:C14H14Cl2O3Purity:Min. 95%Molecular weight:301.16 g/molMethyl 2,5-dibromobenzoate
CAS:Methyl 2,5-dibromobenzoate is a cross-coupling reagent that is used to stabilize proteins. It is a hydrophobic compound that binds to the surface of proteins and prevents denaturation. Methyl 2,5-dibromobenzoate has been shown to be an effective binder for protein stabilization in a model system, where it was found to increase the reaction rate of Suzuki coupling reactions. This reagent can be used as a substitute for fluoroaromatic solvents in cross-coupling reactions.Formula:C8H6Br2O2Purity:Min. 95%Color and Shape:Off-White PowderMolecular weight:293.94 g/mol3-Chloroazetidine hydrochloride
CAS:Please enquire for more information about 3-Chloroazetidine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C3H6ClN•HClPurity:Min. 95%Molecular weight:128 g/mol2-(2-Bromoethoxy)tetrahydro-2H-pyran
CAS:2-(2-Bromoethoxy)tetrahydro-2H-pyran is a synthetic molecule that has been shown to act as an estrogen receptor modulator, which has the potential to be used for the treatment of hormone-sensitive diseases such as breast cancer. This compound is chemically very similar to other compounds that have been shown to be effective in treating breast cancer. 2-(2-Bromoethoxy)tetrahydro-2H-pyran has a cavity and 6 hydroxyl groups that can form hydrogen bonds with water molecules, leading to its gelling properties. In addition, this compound is thermoreversible and can reversibly gel when heated or cooled. The gelation property of 2-(2-Bromoethoxy)tetrahydro-2H-pyran makes it a promising candidate for use in vaginal tablets, which could potentially lead to treatments for vaginal dryness and atrophy.Formula:C7H13BrO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:209.08 g/mol8-Fluoro-6-methoxy moxifloxacin
CAS:Please enquire for more information about 8-Fluoro-6-methoxy moxifloxacin including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C21H24FN3O4Purity:Min. 95%Molecular weight:401.43 g/mol5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride
CAS:Please enquire for more information about 5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C9H12N2O4•HClPurity:Min. 95%Molecular weight:248.66 g/mol7-Fluoro-2-methylquinoline
CAS:7-Fluoro-2-methylquinoline is a multistep synthetic compound that belongs to the family of quinoxalines. It has been shown to have potent antibacterial activity against a wide range of bacteria, including methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 7-Fluoro-2-methylquinoline was developed as an analog of the natural product quinoxaline. The key step in its synthesis is the reaction between an aldehyde and hydroxyalkylating reagent in the presence of iron catalyst. This process results in the formation of functional groups such as hydroxyls, alkoxy, or halogens.Formula:C10H8FNPurity:Min. 95%Color and Shape:White PowderMolecular weight:161.18 g/molDesmethylene paroxetine hydrochloride salt
CAS:Please enquire for more information about Desmethylene paroxetine hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C18H21ClFNO3Purity:Min. 95%Molecular weight:353.82 g/mol3'-O-Benzyl-2'-Deoxy-5-Trifluoromethyluridine
CAS:3'-O-Benzyl-2'-Deoxy-5-Trifluoromethyluridine (BDBMU) is a pyrimidine derivative that can be used as an antiviral drug. It inhibits the synthesis of DNA and RNA by inhibiting viral polymerase. BDBMU is a prodrug of uracil, which is converted to the active compound in tissues. The benzoylation reaction produces a fluorine atom at C5, which increases its potency. This drug has been shown to have minimal toxicity in tumor cells and has been used for the treatment of leukemia and other cancers.Formula:C17H17F3N2O5Purity:Min. 95%Molecular weight:386.32 g/mol(3R,5S)-5-(Hydroxymethyl)pyrrolidin-3-ol hydrochloride
CAS:Please enquire for more information about (3R,5S)-5-(Hydroxymethyl)pyrrolidin-3-ol hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%2,6-Difluoro-4-methoxyphenol
CAS:Please enquire for more information about 2,6-Difluoro-4-methoxyphenol including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H6F2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:160.12 g/mol5-Fluorohistidine
CAS:5-Fluorohistidine is an organic compound with the formula CHFNO. It is a fluorinated derivative of histidine, and a precursor to histamine. 5-Fluorohistidine has been shown to be a potent thyrotropin-releasing hormone (TRH) analog, and is used in the synthesis of histamine. This compound has also been used as a tool for investigating the mechanism of TRH action by studying its stereoselective binding to protrusions from rat brain capillary endothelial cells. 5-Fluorohistidine has also been used as a microbial probe for detecting microbial protrusions from bacterial cells.Formula:C6H8FN3O2Purity:Min. 95%Molecular weight:173.15 g/mol6-(Bromomethyl)-1,1,4,4-tetramethyl-1,2,3,4-tetrahydronaphthalene
CAS:Please enquire for more information about 6-(Bromomethyl)-1,1,4,4-tetramethyl-1,2,3,4-tetrahydronaphthalene including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C15H21BrPurity:Min. 80 Area-%Color and Shape:Clear LiquidMolecular weight:281.23 g/mol10-Methyl-9-(phenoxycarbonyl)acridinium fluorosulfonate
CAS:Please enquire for more information about 10-Methyl-9-(phenoxycarbonyl)acridinium fluorosulfonate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C21H16FNO5SPurity:Min. 95%Molecular weight:413.42 g/mol3,6-Dichloro trimellitic anhydride
CAS:3,6-Dichloro trimellitic anhydride is a reactive compound that is used in the synthesis of fluorescent probes. It is also used as a reagent to introduce chlorine substituents onto organic molecules. Fluorescence measurements can be used to determine the purity of 3,6-dichloro trimellitic anhydride. This compound reacts with nucleic acids, causing them to fluoresce and making them detectable by spectroscopy. 3,6-Dichloro trimellitic anhydride has been used in research involving the study of nucleic acids and their role in DNA replication and repair.Formula:C9H2Cl2O5Purity:Min. 95%Molecular weight:261.01 g/molPhenyl-magnesium bromide solution - 1.0 M in THF
CAS:Phenyl-magnesium bromide solution is a chemical compound that can be used as a pesticide. It has been shown to have carcinoid syndrome-inducing properties in animal studies. Phenyl-magnesium bromide solution has also been found to have biological properties that are beneficial for bowel disease, organometallic reactivity, and congestive heart failure. This chemical compound reacts with ester hydrochloride in the presence of an organic base to form a reactive intermediate that undergoes transfer reactions with other organic compounds. Phenyl-magnesium bromide solution is reactive and can cause metabolic disorders such as palladium-catalyzed coupling.
Formula:C6H5BrMgPurity:Min. 95%Molecular weight:181.31 g/molDi-tert-butyldichlorosilane
CAS:Di-tert-butyldichlorosilane is a silicon compound that has been used to silylate amines and primary alcohols. It is a sterically hindered molecule with two chloro groups at the same position on one of the silicon atoms, which prevents or limits steric interactions with other molecules. Covid-19 Pandemic is the name given to a new strain of influenza virus that was discovered in 2009. The new strain contains some genetic material from bird flu, which makes it resistant to oseltamivir and zanamivir, drugs commonly used to fight against influenza infection.
Formula:C8H18Cl2SiPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:213.22 g/molDi(o-tolyl)chlorophosphine
CAS:Di(o-tolyl)chlorophosphine is a chiral, asymmetric catalyst that has been used to synthesize tetrahydrofurans. This compound is prepared by a multimerization reaction of lithium metal and an o-tolylphosphine ligand in the presence of an injecting cocatalyst. This reaction is conducted in tetrahydrofuran at room temperature and requires a flow rate of 1.0 mL per minute. The use of this catalyst can be seen as a transition from the older, less efficient method of using phosphines as ligands for the synthesis of tetrahydrofurans with lithium aluminum hydride.Formula:C14H14ClPPurity:Min. 95%Molecular weight:248.69 g/mol5-Chloro-4-nitrothiophene-2-sulfonylchloride
CAS:Please enquire for more information about 5-Chloro-4-nitrothiophene-2-sulfonylchloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C4HCl2NO4S2Purity:Min. 95%Molecular weight:262.09 g/moltert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride
CAS:Please enquire for more information about tert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C14H18N2O2Purity:Min. 95%Molecular weight:246.31 g/mol8-Fluoro-Quinazoline-2,4-Diamine
CAS:8-Fluoro-Quinazoline-2,4-Diamine is an organic compound with the formula CHClN. It is a yellow solid that is soluble in organic solvents such as chloroform and toluene. The compound is used to produce dyes and pharmaceuticals. 8-Fluoro-Quinazoline-2,4-Diamine can be obtained by nitrating 2,4-diaminoquinazoline with nitric acid and hydrochloric acid in the presence of carbonate or stannous chloride. This reaction produces two isomers: 8-fluoroquinazoline (8FQ) and 6-fluoroquinazoline (6FQ). The 8FQ isomer has been shown to have a nuclear magnetic resonance spectrum at 300 MHz that contains four signals at 1.3 ppm, 3.5 ppm, 5.6 ppm, and 7.0 ppm, which are assigned toFormula:C8H7FN4Purity:Min. 95%Molecular weight:178.17 g/molChlorophyllide A
CAS:Chlorophyllide A is a chlorophyll molecule that has been synthesized by the enzymatic conversion of an existing chlorophyll molecule. It can be used as a model system for studying the physiological function of chlorophyll and its role in photosynthesis. The synthesis of Chlorophyllide A has been shown to be biocompatible with cells and tissues, making it an excellent candidate for drug delivery systems. The synthesis of this molecule is achieved through a reaction mechanism involving glutamate dehydrogenase, which adds a hydroxyl group to the cysteine residue on the chlorophyll molecule. This reaction takes place in low light conditions, which prevents photodegradation of this molecule. Chlorophyllide A also has a pH optimum at around pH 7-8 and does not react with proteins or nucleic acids.Formula:C35H34MgN4O5Purity:90%MinColor and Shape:PowderMolecular weight:614.97 g/mol7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid
CAS:7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid (ABT) is a drug that binds to bacterial enzymes and inhibits their ability to synthesize proteins. ABT is a conjugate of fluoroquinolone and an amino acid. As the drug is degradable by hydrolysis, it has been shown to be less toxic in Sprague Dawley rats than other fluoroquinolones. This drug has been used in diagnostic tests as a ligand for affinity ligands, but has not been approved for human use. The drug also possesses functional groups that are important for binding to reconstituted enzymes.br>br>ABT's ester linkages are degradable by hydrolysis and can beFormula:C20H16F3N3O3Purity:Min. 95%Molecular weight:403.35 g/molN-Fmoc-4-bromo-L-tryptophan
CAS:Please enquire for more information about N-Fmoc-4-bromo-L-tryptophan including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C26H21BrN2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:505.36 g/mol2,6-Dimethyl-4-phenylpyronium tetrafluoroborate
CAS:2,6-Dimethyl-4-phenylpyronium tetrafluoroborate is a high quality reagent that is useful for the preparation of complex compounds. It is also a useful intermediate and building block. The CAS No. 97606-13-8, 2,6-Dimethyl-4-phenylpyronium tetrafluoroborate has been used in research chemicals and as a versatile building block for the synthesis of speciality chemicals. This reagent can be used in reactions to form many organic molecules that are not commercially available or difficult to synthesize.Formula:C13H13O·BF4Purity:Min. 95%Color and Shape:PowderMolecular weight:272.05 g/mol(R)(−)-DOI hydrochloride
CAS:Controlled Product(R)(−)-DOI hydrochloride is a synthetic compound classified as a selective serotonin receptor agonist. It is primarily sourced from chemical synthesis processes designed to explore potential interactions within serotonergic pathways. The compound’s mode of action involves the activation of 5-HT2A, 5-HT2B, and 5-HT2C serotonin receptors, which play crucial roles in modulating neurotransmission and signaling pathways within the central nervous system.In research and experimental contexts, (R)(−)-DOI hydrochloride is utilized to investigate the molecular mechanisms of serotonin receptors, contributing to a deeper understanding of their role in neurophysiology and potential implications in neuropsychiatric disorders. Studies often explore its effects on cognition, perception, and mood regulation. Despite its promising role in scientific exploration, (R)(−)-DOI hydrochloride is not intended for therapeutic use and remains predominantly a tool for advancing the field of neuropharmacology through controlled experimental settings.Formula:C11H17ClINO2Purity:Min. 95%Molecular weight:357.62 g/mol4-Bromo-2-nitrothiophene
CAS:Please enquire for more information about 4-Bromo-2-nitrothiophene including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C4H2BrNO2SPurity:Min. 95%Molecular weight:208.03 g/molDecanoyl-Arg-Arg-Leu-Leu-chloromethylketone trifluoroacetate salt
CAS:Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt is a prohormone that is biosynthesized from the amino acid decanoic acid. It has been shown to inhibit fatty acid synthesis and mineralization in tissue samples, as well as drug target enzymes such as human pathogens. Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt has also been shown to have insulin resistance properties and may be used for the treatment of metabolic disorders.Formula:C35H67ClN10O5Purity:Min. 95%Molecular weight:743.42 g/mol2-Methyl-L-cysteine hydrochloride
CAS:2-Methyl-L-cysteine hydrochloride is a synthetic molecule that is used as an organic solvent. It can be produced from the reaction of an inorganic base with an ester hydrochloride and has been shown to have stereoselective properties. The spontaneous formation of this molecule was enhanced by the addition of hydrochloric acid, which increased the reaction yield. 2-Methyl-L-cysteine hydrochloride has been shown to react spontaneously with inorganic materials, such as titanium dioxide, which causes a color change from white to yellow.
Formula:C4H9NO2S·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:171.65 g/mol2-[(Ethylamino)methyl]-4-aminophenol dihydrochloride
CAS:Please enquire for more information about 2-[(Ethylamino)methyl]-4-aminophenol dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C9H14N2O•(HCl)2Purity:Min. 95%Color and Shape:PowderMolecular weight:239.14 g/molTrifluoro(1,1,2,2-Tetrafluoro-2-Iodoethoxy)Ethylene
CAS:Please enquire for more information about Trifluoro(1,1,2,2-Tetrafluoro-2-Iodoethoxy)Ethylene including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C4F7IOPurity:Min. 95%Molecular weight:323.94 g/molGly-arg-4-methoxy-beta-naphthylamide dihydrochloride
CAS:Please enquire for more information about Gly-arg-4-methoxy-beta-naphthylamide dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C19H26N6O3·2ClHPurity:Min. 95%Molecular weight:459.37 g/molBis(pentafluorophenyl)zinc
CAS:Bis(pentafluorophenyl)zinc (BPFPZn) is a ring-opening polymerization catalyst that is used to synthesize polymers with pendant covalent adducts. BPFPZn has shown synergistic effects when used in combination with lactide, which is a monomer that can be polymerized to form polylactic acid. The reaction system used for the synthesis of BPFPZn and lactide involves nucleophilic attack on the zinc cation by the carbonyl group of lactide, leading to reductive elimination and coordination chemistry. This reaction system has been shown to produce architectures such as block copolymers and star polymers.
Formula:C12F10ZnPurity:Min. 95%Color and Shape:PowderMolecular weight:399.49 g/mol3-(Aminomethyl)-N,N-dimethyl-1,2,4-oxadiazole-5-carboxamide
CAS:Please enquire for more information about 3-(Aminomethyl)-N,N-dimethyl-1,2,4-oxadiazole-5-carboxamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C6H10N4O2Purity:Min. 95%Molecular weight:170.17 g/mol3-[5-(4-Fluorophenyl)-5-hydroxy-1-oxopentyl]-4-phenyl-2-oxazolidinone
CAS:Please enquire for more information about 3-[5-(4-Fluorophenyl)-5-hydroxy-1-oxopentyl]-4-phenyl-2-oxazolidinone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H20FNO4Purity:Min. 95%Molecular weight:357.38 g/molalpha,3-Dichlorobenzaldoxime
CAS:Please enquire for more information about alpha,3-Dichlorobenzaldoxime including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C7H5Cl2NOPurity:Min. 95%Molecular weight:190.03 g/mol10-Fluorodecan-1-Ol
CAS:Please enquire for more information about 10-Fluorodecan-1-Ol including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H21FOPurity:Min. 95%Molecular weight:176.27 g/molDansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt
CAS:Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.Formula:C28H32N6O9S·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:742.68 g/molMorpheridine dihydrochloride
CAS:Controlled ProductPlease enquire for more information about Morpheridine dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C20H32Cl2N2O3Purity:Min. 95%Molecular weight:419.39 g/mol1-Acetyl-6-(perfluoropropan-2-yl)-3-((pyridin-3-ylmethyl)amino)-3,4-dihydroquinazolin-2(1H)-one
CAS:1-Acetyl-6-(perfluoropropan-2-yl)-3-((pyridin-3-ylmethyl)amino)-3,4-dihydroquinazolin-2(1H)-one (PAFQ) is a mitochondrial cytochrome P450 inhibitor that inhibits the function of the ryanodine receptor and interacts with the piperonyl butoxide synergistically. PAFQ has been shown to be effective against animal pests such as termites, ants, and cockroaches. It also inhibits population growth in these populations by interfering with their ability to synthesize proteins. The effective dose for PAFQ varies depending on whether it is applied topically or orally.Formula:C19H15F7N4O2Purity:Min. 95%Molecular weight:464.34 g/molPyr-Pro-Arg-pNA hydrochloride salt
CAS:Pyr-Pro-Arg-pNA hydrochloride salt is a chromogenic substrate that is used to detect microorganisms in the blood. This substrate is activated by the enzyme ochraceous, which catalyzes the hydrolysis of pyr-pro-arg-pNA. The reaction produces hydrogen peroxide and an orange color. Pyr-Pro-Arg-pNA hydrochloride salt can be used as an anticoagulant for blood plasma samples. It can also be used to identify Aspergillus ochraceus, a fungus that causes pulmonary infections in humans. Aspergillus ochraceus has been shown to produce this enzyme and to have a high affinity for this substrate.Formula:C22H30N8O6·HClPurity:Min. 95%Molecular weight:538.98 g/molEthyl2-(acetylamino)-3-[3,5-diiodo-4-(4-methoxyphenoxy)phenyl]propanoate
CAS:Please enquire for more information about Ethyl2-(acetylamino)-3-[3,5-diiodo-4-(4-methoxyphenoxy)phenyl]propanoate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H21I2NO5Purity:Min. 95%Molecular weight:609.19 g/mol4-Fluorophenyl isocyanate
CAS:4-Fluorophenyl isocyanate is a hydroxylated derivative of phenyl isocyanate. It has been shown to have anticancer activity, with an IC50 value of about 50 μM. 4-Fluorophenyl isocyanate can be synthesized by reacting 3-bromopropylamine hydrobromide with hydrogen fluoride in the presence of a carbodiimide. The reaction can be optimized by adding epoxides or carbodiimides, and the best conditions are found to be at pH 10 and room temperature. 4-Fluorophenyl isocyanate binds to the MT2 receptor which leads to activation of G proteins, resulting in increased intracellular cAMP levels.Formula:C7H4FNOPurity:Min. 95%Molecular weight:137.11 g/molBenzal Chloride
CAS:Controlled ProductBenzal Chloride is a chlorinating agent that exhibits reactive properties. It is used in wastewater treatment to disinfect and oxidize organic matter, as well as to remove hydrogen sulfide and other volatile organics. Benzal Chloride is also used for the preparation of benzalkonium chloride, which has been shown to have antimicrobial properties. The pharmacokinetic properties of benzal chloride are similar to those of chloride, but it has not been studied extensively in humans.Formula:C7H6Cl2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:161.03 g/molUroporphyrin I dihydrochloride
CAS:Uroporphyrin I dihydrochloride is a facilitator of carbohydrate metabolism. It is a cofactor for the enzyme dehydrogenase and changes the optical properties of certain compounds. Uroporphyrin I dihydrochloride has been shown to modulate the redox potential in lung cells and inhibit human immunodeficiency virus (HIV) replication by inhibiting coproporphyrin production. This drug has also been shown to have an anticancer effect against both leukemia and colon cancer cell lines. Uroporphyrin I dihydrochloride reacts with oxygen, giving it a luminescent property that can be used to assay for its presence in biological systems.Formula:C40H38N4O16•(HCl)2Purity:Min. 95%Molecular weight:903.67 g/molNIR-664-iodoacetamide
CAS:NIR-664 is a potential use for the treatment of cancer. It is an iodinated acetamide with a ruthenium complex that has been shown to have magnetic and fluorescent properties. The diameter of NIR-664 is approximately 2 nm, and it has a hydrophobic character. This compound can be used in nanocrystals or as a mesoporous material. The fluorescence of NIR-664 can be observed in the near infrared region at 664 nm, which gives this compound its name. NIR-664 has also been shown to react with ruthenium, which makes it suitable for use in particle form.Formula:C37H42IN3O4SPurity:Min. 95%Molecular weight:751.72 g/mol1-Bromopyrene
CAS:1-Bromopyrene is a chemical that has been shown to be mutagenic and a carcinogen. It has been used extensively in research as a fluorescence probe for DNA, due to its ability to bind to dioxygen and other oxygen nucleophiles. 1-Bromopyrene reacts with the molecule pyrene, which emits light of different wavelengths depending on the type of reaction. The diazonium salt formed from this reaction is an effective electron donor in organic reactions and can be used as a chemical oxidant. 1-Bromopyrene also has significant photochemical properties.
1-Bromopyrene binds to DNA via hydrogen bonding between the bromine atom and the phosphate group of deoxyribose sugar in DNA, forming a covalent bond that alters the conformation of DNA by opening up the double helix structure. This causes oxidative damage to DNA by increasing reactive oxygen species (ROS) production and decreasing cellular antioxidant capacity.Formula:C16H9BrPurity:Min. 95%Color and Shape:White PowderMolecular weight:281.15 g/molPiminodine dihydrochloride
CAS:Controlled ProductPlease enquire for more information about Piminodine dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C23H32Cl2N2O2Purity:Min. 95%Molecular weight:439.42 g/mol2-Bromobutyryl Bromide
CAS:Formula:C4H6Br2OPurity:>97.0%(GC)Color and Shape:Colorless to Light orange to Yellow clear liquidMolecular weight:229.903-Chlorobenzoyl Chloride
CAS:Formula:C7H4Cl2OPurity:>98.0%(GC)(T)Color and Shape:Colorless to Light yellow clear liquidMolecular weight:175.01Isobutyryl Chloride
CAS:Formula:C4H7ClOPurity:>98.0%(GC)(T)Color and Shape:Colorless to Light yellow clear liquidMolecular weight:106.553,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,10-Heptadecafluoro-1-decanethiol
CAS:Formula:C10H5F17SPurity:97%Color and Shape:LiquidMolecular weight:480.18455439999971,2-DIIODOTETRAFLUOROETHANE
CAS:Formula:C2F4I2Purity:96%Color and Shape:LiquidMolecular weight:353.8240Methyl Phosphorodichloridate
CAS:Formula:CH3Cl2O2PPurity:95%Color and Shape:LiquidMolecular weight:148.9131Diisopropylamine hydrochloride
CAS:Formula:C6H16ClNPurity:97%Color and Shape:SolidMolecular weight:137.65091-(CHLOROMETHYL)-4-ETHOXYBENZENE
CAS:Formula:C9H11ClOPurity:95%Color and Shape:SolidMolecular weight:170.63602-Chloro-1,3,2-dioxaphospholane-2-oxide
CAS:Formula:C2H4ClO3PPurity:95%Color and Shape:LiquidMolecular weight:142.4781Tetrabutylammonium chloride
CAS:Formula:C16H36ClNPurity:95%Color and Shape:SolidMolecular weight:277.9167Triphenyldibromophosphorane
CAS:Formula:C18H15Br2PPurity:97%Color and Shape:SolidMolecular weight:422.09352,2,2-TRIFLUOROETHYL TRIFLUOROACETATE
CAS:Formula:C4H2F6O2Purity:97%Color and Shape:LiquidMolecular weight:196.0479Cyclohexane, 4-bromo-1,1-difluoro-
CAS:Formula:C6H9BrF2Purity:97%Color and Shape:LiquidMolecular weight:199.0365Germane, chlorotriphenyl-
CAS:Formula:C18H15ClGePurity:98%Color and Shape:SolidMolecular weight:339.4047Butane,1-bromo-1,1,2,2,3,3,4,4,4-nonafluoro-
CAS:Formula:C4BrF9Purity:98%Color and Shape:LiquidMolecular weight:298.9324TERT-BUTYLPHOSPHONIC DICHLORIDE
CAS:Formula:C4H9Cl2OPPurity:99%Color and Shape:SolidMolecular weight:174.9934NEODYMIUM(III) TRIFLUOROMETHANESULFONATE
CAS:Formula:C3F9NdO9S3Purity:98%Color and Shape:SolidMolecular weight:591.4473Boronic acid, B-(3-fluoro-2-hydroxyphenyl)-
CAS:Formula:C6H6BFO3Purity:97%Color and Shape:SolidMolecular weight:155.9194Ethanesulfonamide, 1,1,2,2,2-pentafluoro-
CAS:Formula:C2H2F5NO2SPurity:98%Color and Shape:SolidMolecular weight:199.09982,2,3,3,4,4-HEXAFLUORO-1,5-PENTANEDIOL
CAS:Formula:C5H6F6O2Purity:98%Color and Shape:SolidMolecular weight:212.0904(4'-Bromo-[1,1'-biphenyl]-4-yl)(phenyl)methanone
CAS:Formula:C19H13BrOPurity:>98.0%(HPLC)Color and Shape:SolidMolecular weight:337.20991,1'-Biphenyl, 2-bromo-4'-chloro-
CAS:Formula:C12H8BrClPurity:97%Color and Shape:SolidMolecular weight:267.54899-(4'-BroMo-4-biphenylyl)-9H-carbazole
CAS:Formula:C24H16BrNPurity:98%Color and Shape:SolidMolecular weight:398.29454,4'-Dibromo-2,2'-diiodobiphenyl
CAS:Formula:C12H6Br2I2Purity:95%Color and Shape:SolidMolecular weight:563.79298Ref: IN-DA00G37P
Discontinued product2-Chloro-1,3,2-dioxaphospholane
CAS:Formula:C2H4ClO2PPurity:97%Color and Shape:LiquidMolecular weight:126.4787DIETHYL CHLOROPHOSPHITE
CAS:Formula:C4H10ClO2PPurity:95%Color and Shape:LiquidMolecular weight:156.54781-(4-(Trifluoromethyl)phenyl)propan-1-one
CAS:Formula:C10H9F3OPurity:98%Color and Shape:SolidMolecular weight:202.1731Ref: IN-DA006BIV
Discontinued product2-Fluorophenyl cyclopentyl ketone
CAS:Formula:C12H13FOPurity:96%Color and Shape:LiquidMolecular weight:192.2294Ref: IN-DA00367V
Discontinued productRef: IN-DA001YD6
Discontinued productOxirane, 2-(2,2,3,3,4,4,5,5,5-nonafluoropentyl)-
CAS:Formula:C7H5F9OPurity:98%Color and Shape:LiquidMolecular weight:276.0996Ref: IN-DA007GP3
Discontinued productN,N-Bis(1-methylethyl)phosphoramidous dichloride
CAS:Formula:C6H14Cl2NPPurity:95%Color and Shape:SolidMolecular weight:202.06182-(Difluoromethoxy)acetic acid
CAS:Formula:C3H4F2O3Purity:95%Color and Shape:SolidMolecular weight:126.0589Carbonochloridic acid, 2,2,2-trichloroethyl ester
CAS:Formula:C3H2Cl4O2Purity:97%Color and Shape:LiquidMolecular weight:211.85883,6-Dichloro-1,2,4,5-tetrazine
CAS:Formula:C2Cl2N4Purity:97%Color and Shape:SolidMolecular weight:150.95424-BROMO-4'-NITROBIPHENYL
CAS:Formula:C12H8BrNO2Purity:95%Color and Shape:SolidMolecular weight:278.1014Germane, dichlorodiphenyl-
CAS:Formula:C12H10Cl2GePurity:95%Color and Shape:LiquidMolecular weight:297.7538Tungsten chloride (WCl6), (OC-6-11)-
CAS:Formula:Cl6WPurity:99%Color and Shape:SolidMolecular weight:396.558Ref: IN-DA00118U
Discontinued product2-[Methyl[(tridecafluorohexyl)sulphonyl]amino]ethyl acrylate
CAS:Please enquire for more information about 2-[Methyl[(tridecafluorohexyl)sulphonyl]amino]ethyl acrylate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H10F13NO4SPurity:80%MinColor and Shape:PowderMolecular weight:511.26 g/molRef: 3D-FM96258
Discontinued product4-[[4-(4-Chlorophenyl)-2-thiazolyl]amino]phenol
CAS:4-[[4-(4-Chlorophenyl)-2-thiazolyl]amino]phenol is a chemical that has been used in analytical and in vitro methods to study the cellular physiology of cells. It was found to inhibit sphingosine kinase, which is an enzyme that is involved in the synthesis of sphingosine. The inhibition of this enzyme leads to decreased levels of sphingosine and the effect on the cell. 4-[[4-(4-Chlorophenyl)-2-thiazolyl]amino]phenol can also affect mitochondrial membrane potential and cyclase activity, which may be useful for treating hyperproliferative diseases such as breast cancer.Formula:C15H11ClN2OSPurity:Min. 95%Molecular weight:302.78 g/molRef: 3D-FC137468
Discontinued productAcetylthiocholine bromide
CAS:Acetylthiocholine bromide is a lipase inhibitor that has been shown to be nontoxic in doses as high as 250 mg/kg. Acetylthiocholine bromide has an acetylcholinesterase-inhibiting effect, which makes it a potential drug for the treatment of Alzheimer's disease and other neurological disorders. Acetylthiocholine bromide is also used in the detection of acetylcholine in biological samples, such as serum and urine. The surface-enhanced Raman (SERS) technique is used to detect the presence of acetylthiocholine bromide. This technique uses gold nanoparticles deposited on a substrate to increase the intensity of Raman scattering from molecules adsorbed on the surface. Inhibition of acetylcholinesterase by acetylthiocholine bromide leads to increased levels of acetylcholine and prevents its breakdown by cholinesterases. This leads
Formula:C7H16BrNOSPurity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:242.18 g/mol1-(2-Chloro-1-methylethyl)pyrrolidine hydrochloride
CAS:1-(2-Chloro-1-methylethyl)pyrrolidine hydrochloride is a versatile building block that can be used in the synthesis of fine chemicals, complex compounds, research chemicals, reagents and specialty chemicals. This compound is also useful as a building block for the synthesis of pharmaceuticals and chemical products. 1-(2-Chloro-1-methylethyl)pyrrolidine hydrochloride is a high quality chemical that can be used as a reaction component or scaffold for the synthesis of new chemical entities.Formula:C7H15Cl2NPurity:Min. 95%Color and Shape:PowderMolecular weight:184.1 g/molRef: 3D-FC116878
Discontinued productTrazodone hydrochloride
CAS:Controlled ProductTrazodone is an antidepressant that acts as a serotonin reuptake inhibitor. It has been shown to be effective in the treatment of depression and anxiety, and is also used to treat other conditions such as insomnia, chronic pain, and cancer-related symptoms. Trazodone is thought to have anti-inflammatory effects in some cases due to its ability to inhibit prostaglandin synthesis. Trazodone has a number of drug interactions, including with sedatives and other antidepressants. It can also cause drowsiness and dizziness, which may increase the risk for accidents or falls. Trazodone hydrochloride can be taken with food if stomach upset occurs.
Formula:C19H23Cl2N5OPurity:Min. 97 Area-%Color and Shape:White PowderMolecular weight:408.32 g/molNorbornylmethylpentafluorocinnamate
Norbornylmethylpentafluorocinnamate is a versatile building block in organic synthesis. It is used as a reagent for the production of amines and other organic compounds, as well as for the synthesis of novel heterocycles. Norbornylmethylpentafluorocinnamate is also used as an intermediate in chemical reactions. This compound has been shown to react with ethylene glycol to form ethylene carbonate and pentafluoroethane, which may be useful for the production of polyurethane foam. Norbornylmethylpentafluorocinnamate can be used as a scaffold for synthesizing new drug candidates or to produce novel pharmaceuticals.
Formula:C17H15F5O2Purity:Min. 95%Molecular weight:346.29 g/mol2-Bromo-4-methylbenzylamine hydrochloride
CAS:2-Bromo-4-methylbenzylamine hydrochloride is a fine chemical that is used as a building block for other chemicals or as a reagent in research. It has CAS No. 1293323-97-3 and can be used in reactions where an amine is needed. This product is high quality, versatile, and useful for many different types of reactions.
Formula:C8H10BrN·HClPurity:Min. 95%Color and Shape:PowderMolecular weight:236.54 g/molRef: 3D-FB67361
Discontinued product4-Iodo-2-methylanisole
CAS:4-Iodo-2-methylanisole (4IM) is a naphthalene that is regiospecifically eliminated after activation by nitrate in an acidic medium. The hydrochloride salt of 4IM, koenigicine, has been shown to produce estrogen levels in the female rat similar to those produced by 17β-estradiol. The synthesis of 4IM involves the nitration of 2-methylanisole followed by iodine oxidation. This reaction produces a mixture of mono-, di-, and tri-iodonapthalenes. The product obtained from this reaction is purified with column chromatography or recrystallization.
Theory predicts that 4IM will be oxidized to 4-iodo-2,6-dimethylanisole by terpene oxidants such as acetonitrile or ozone.Formula:C8H9IOPurity:Min. 95%Color and Shape:PowderMolecular weight:248.06 g/molRef: 3D-FI64636
Discontinued product20-Fluoromibolerone
CAS:Controlled Product20-Fluoromibolerone is a fluorinated analogue of the natural hormone mibolerone. It has been shown to have affinity for prostate tissue and to be selective for cancer cells in vivo, when injected into rats. The uptake of 20-fluoromibolerone into tissues is very high, with preferential accumulation in the liver, kidney and prostate. This drug is metabolized by sulfation and excreted in the urine as sulfate and positron. 20-Fluoromibolerone also has been shown to have a strong affinity for bone, which may be due to its ability to accumulate in bone tissue.
Formula:C20H29FO2Purity:Min. 95%Molecular weight:320.44 g/mol3-Hydroxypiperidine hydrochloride
CAS:3-Hydroxypiperidine hydrochloride is a synthetic compound that inhibits the enzyme acetylcholinesterase, which breaks down the neurotransmitter acetylcholine. The specificity of this inhibitor has been shown to be high in human urine samples. 3-Hydroxypiperidine hydrochloride can be used as a tethering agent in exploratory assays. This drug also has an effect on chemokine production and citric acid levels in the urine.
Formula:C5H11NO•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:137.61 g/molRef: 3D-FH29361
Discontinued productN-Acetyl-DL-p-fluorophenylalanine
CAS:N-Acetyl-DL-p-fluorophenylalanine is a chemical compound that can be used as a research chemical, or in the synthesis of other compounds. It is a reactive ingredient and can be used as a reagent. N-Acetyl-DL-p-fluorophenylalanine belongs to the class of speciality chemicals and can be used as an intermediate in the synthesis of other compounds. This compound has been found to be useful for the production of fine chemicals and complex compounds.
Formula:C11H12FNO3Purity:Min. 95%Color and Shape:PowderMolecular weight:225.22 g/mol4-Nitro-L-phenylalanine methyl ester hydrochloride
CAS:4-Nitro-L-phenylalanine methyl ester hydrochloride is a 4-nitrophenyl derivative of L-phenylalanine. It is a useful building block, reagent, or scaffold in organic synthesis. This compound finds use as a precursor to other derivatives and it has been used in the preparation of complex compounds. 4-Nitro-L-phenylalanine methyl ester hydrochloride is also used as a reaction component for the synthesis of different organic compounds and as a useful intermediate.
Formula:C10H13N2O4ClPurity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:260.67 g/molRef: 3D-FN45027
Discontinued product3-Chloro-4-toluic acid
CAS:3-Chloro-4-toluic acid is a quinone, which is derived from 3,4-dichlorotoluene. It has been shown to bind to nuclear receptors and act as a retinoic acid linker. This compound is also used in the synthesis of organic compounds by desorption in an acidic environment, followed by methyl esterification with an alcohol. 3-Chloro-4-toluic acid can be converted into zirconium chloride or hydrotalcite through chlorination or hydrochlorination. The resulting product can be used for dispersive solid-phase extraction methods.
Formula:C8H7ClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:170.59 g/mol3-Bromo-4-methoxybenzaldehyde
CAS:3-Bromo-4-methoxybenzaldehyde is a heterocycle that contains a covalent inhibitor. It has been shown to have inhibitory activity against imines, hydroxyl groups, and human serum. 3-Bromo-4-methoxybenzaldehyde has been shown to be an efficient method for the synthesis of nitrogen containing heterocycles with potential use as pharmaceuticals. This compound has also been used in the asymmetric synthesis of diphenyl ethers, which are useful in pharmacological studies. The reaction mechanism of this compound is not well understood and needs more research before it can be applied to other areas.
Formula:C8H7BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:215.04 g/molRef: 3D-FB55011
Discontinued product(S)-2-Amino-3-(methylamino)propanoic acid hydrochloride
CAS:(S)-2-Amino-3-(methylamino)propanoic acid hydrochloride is a synthetic compound often used in scientific research. It is derived from non-proteinogenic amino acids and has important implications for the study of neurotoxicology. This compound mimics the structural properties of certain naturally occurring amino acids, which allows it to act as a significant tool for understanding biological pathways affected by neurotoxins.
Formula:C4H11ClN2O2Color and Shape:Off-White PowderMolecular weight:154.6 g/molRef: 3D-FA164055
Discontinued product4-Methoxy-3-nitrobenzotrifluoride
CAS:4-Methoxy-3-nitrobenzotrifluoride is a chemical that belongs to the group of reactants. It is used as a reagent, building block, or intermediate in organic synthesis. 4-Methoxy-3-nitrobenzotrifluoride has been shown to be an effective scaffold for the preparation of complex compounds with versatile building blocks and useful intermediates. It can also be used as a fine chemical with speciality chemical properties.
Formula:C8H6F3NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:221.13 g/molRef: 3D-FM69984
Discontinued productN-Propyl-1-ene-2,6-diethyl-4-phenylpyridinium tetrafluoroborate
CAS:N-Propyl-1-ene-2,6-diethyl-4-phenylpyridinium tetrafluoroborate (NPEEDPBF) is a fine chemical that has been used as a building block in research and industrial chemistry. The synthesis of NPEEDPBF typically involves the reaction of diethyl phenylpyridinium bromide with n propyl iodide. It can be used as a reagent for organic syntheses and as an intermediate for other compounds. NPEEDPBF is also a versatile building block for complex compounds.Formula:C18H22N•BF4Purity:Min. 95%Molecular weight:339.18 g/molRef: 3D-FP145686
Discontinued productPhosgeneiminium chloride
CAS:Phosgeneiminium chloride is a polycarboxylic acid that is synthesized by the reaction of phosphorus pentachloride and hydroxylamine. It has been shown to have an active form with regiospecificity in nucleophilic attack and amide synthesis. Phosgeneiminium chloride can be used as a reagent for the preparation of organic compounds, such as 3-hydroxybenzoic acid, which are intermediates for medicines such as tamoxifen. This compound also shows antitumor activity against leukemia cells and may be useful for fighting cancer. The efficient method of this compound is coordination chemistry.
Formula:C3H6Cl3NPurity:Min. 95%Molecular weight:162.44 g/molRef: 3D-FP41602
Discontinued product4-Amino-3-bromobenzonitrile
CAS:4-Amino-3-bromobenzonitrile is a chemical compound that is synthesized by the reaction of 4-amino-2-bromobenzonitrile and NaBH4. It can be used as a ligand for copper, nickel, and cobalt ions. The crystalline form of 4-amino-3-bromobenzonitrile has been studied using x-ray diffraction and ultraviolet irradiation. The absorption spectra of the compound are in agreement with its nature as an azobenzene derivative.
Formula:C7H5BrN2Purity:Min. 95%Color and Shape:PowderMolecular weight:197.03 g/mol4-Bromoveratrole
CAS:4-Bromoveratrole is a triphenylene with a molecular weight of 454.42 g/mol and a melting point of 90°C. It has been shown that this molecule binds to the receptor for acetylcholine, which is found in the central nervous system and on muscles. The binding of 4-bromoveratrole to this receptor leads to the release of chloride ions from the cell, which increases the activity of acetylcholine. The detection sensitivity of 4-bromoveratrole in solution was determined by adding malonic acid or hydrochloric acid, which led to an increase in fluorescence intensity. This molecule also has fatty acid and hydroxyl groups that have been shown to have anti-inflammatory properties.
Formula:C8H9BrO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:217.06 g/molRef: 3D-FB54906
Discontinued producto-Fluorobenzyl alcohol
CAS:O-Fluorobenzyl alcohol is a compound with the chemical formula of C6H5FO. It is a colorless liquid with a sweet odor and tastes like ether. This compound is soluble in water, ethanol, and acetone. O-Fluorobenzyl alcohol has been used as an analytical reagent for the determination of protonated molecules such as phenols or carbohydrates. It also has cytotoxic properties, which have been shown to be effective against cancer cells. O-Fluorobenzyl alcohol acts as a γ-secretase inhibitor by binding to the catalytic site of the enzyme, preventing proteolytic cleavage of amyloid precursor protein (APP) and subsequent production of amyloid β peptide (Aβ).
Formula:C7H7FOPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:126.13 g/molAllylpentafluorobenzene
CAS:Allylpentafluorobenzene is a monomer that can be used in coatings and polymers. It has a reactive functional group that reacts with phosphorus pentoxide to form a polymerization initiator. The polymerization initiator then reacts with other functional groups, such as 3-mercaptopropionic acid, to produce polymers. The diameter of these polymers is around 2 nm and they are hybridized. These polymers are able to absorb light efficiently, which makes them useful for energy efficiency applications. Allylpentafluorobenzene has been shown to react with iron oxides and phosphorus pentoxide in the presence of air to form an iron oxide-allylpentafluorobenzene complex. This complex is more stable than the original allylpentafluorobenzene, which decreases its reactivity with oxygen.
Formula:C9H5F5Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:208.13 g/molRef: 3D-FA75665
Discontinued product3-Fluoro-5-methoxybenzylamine hydrochloride
CAS:3-Fluoro-5-methoxybenzylamine hydrochloride is a chemical building block that can be used in organic synthesis. It is a versatile building block and can be used to synthesize complex compounds. 3-Fluoro-5-methoxybenzylamine hydrochloride is used as a reaction component and reagent for the production of pharmaceuticals, agricultural chemicals, and other organic compounds. It has CAS number 1158269-22-7 and can be found in the Chemical Abstract Services database.
Formula:C8H10FNO•HClPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:191.63 g/molRef: 3D-FF67172
Discontinued product2-Bromocarbazole
CAS:2-Bromocarbazole is an organic compound that binds to the mineralocorticoid receptor. It has been shown to be a potent inhibitor of sodium transport in both anhydrous and hydrated conditions. 2-Bromocarbazole is also a cationic polymerization agent, which can be used in photophysical studies. This compound has been shown to have fluorescence properties, as well as receptor α binding capabilities. 2-Bromocarbazole was also able to inhibit the enzyme picolinic acid carboxylase, which catalyzes the conversion of picolinic acid into nicotinamide adenine dinucleotide phosphate (NADP) and CO2. The molecular docking analysis of 2-bromocarbazole with human recombinant MRAPα confirms this inhibition.
Formula:C12H8BrNPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:246.1 g/molRef: 3D-FB33244
Discontinued productAcebutolol hydrochloride
CAS:Controlled ProductAcebutolol is a non-selective beta-blocker that is used for the treatment of hypertension and other conditions. It inhibits the ryanodine receptor and prevents calcium release, which has been shown to be responsible for the contraction of cardiac muscle. Acebutolol also inhibits phosphodiesterase, which leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. In addition, acebutolol has been shown to inhibit the production of inflammatory mediators by inhibiting prostaglandin synthesis. The most common adverse effects include drowsiness, dizziness, fatigue, and headache. Acebutolol hydrochloride can be found in wastewater as a result of its use in humans and animals. This drug can be detected in wastewater using solid phase microextraction followed by gas chromatography/mass spectrometry (GC/MS).
Formula:C18H28N2O4•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:372.89 g/molRef: 3D-FA16907
Discontinued product3,3',5-Triiodo thyropropionic acid
CAS:Triiodothyropropionic acid is a metabolite of thyroxine, an important hormone that regulates the basal metabolic rate. It has been shown to be involved in the repair mechanism of cardiac and liver cells. Triiodothyropropionic acid is also a major metabolite of thyroxine and it is produced by the action of hydroxylases on thyroxine with water vapor as the substrate. This compound has been shown to increase cardiac function and improve heart tissue repair at physiological levels. The uptake, distribution, and excretion of triiodothyropropionic acid are similar to those for thyroxine. The metabolism of triiodothyropropionic acid occurs mainly in the liver, where it is converted into fatty acids such as 3-hydroxybutyric acid. Triiodothyropropionic acid has been shown to have effects on protein genes and rat liver microsomes.
Formula:C15H11I3O4Purity:Min. 95%Color and Shape:PowderMolecular weight:635.96 g/mol2-(Ethyl-Fluorophosphoryl)Oxypropane
CAS:Controlled Product2-(Ethyl-Fluorophosphoryl)Oxypropane (EFOP) is a chemical substance that is used as an analytical reagent in the detection of volatile and semi-volatile organic compounds in urine samples. EFOP has a high detection sensitivity, which allows it to be used for the analysis of low levels of chemicals in complex matrices. The matrix effect can be reduced by using human serum as the sample preparation medium. EFOP has been shown to be useful for determining sarin exposure in humans and mass analyzer data has shown that EFOP can detect high values of this chemical substance.
Formula:C5H12FO2PPurity:Min. 95%Molecular weight:154.12 g/molcis-1,2-Dichloroethene
CAS:cis-1,2-Dichloroethene is a chlorinated aliphatic hydrocarbon that has a high affinity for hydrogen fluoride. The rate of the reaction is dependent on pH and temperature. cis-1,2-Dichloroethene is reactive with fatty acids, p-hydroxybenzoic acid, and other compounds containing chlorine atoms. Cis-1,2-Dichloroethene has been shown to be biologically degraded by microorganisms. It has also been shown to be stable in complex with diphenyl ethers and polymers. cis-1,2-Dichloroethene can be dechlorinated by rat liver microsomes in vitro.
Formula:C2H2Cl2Purity:Min. 96 Area-%Color and Shape:Clear LiquidMolecular weight:96.94 g/molRef: 3D-FD170967
Discontinued productCreatine zinc chloride
CAS:Creatine zinc chloride is a basic protein that is metabolized to creatinine and guanidinoacetate. Creatine zinc chloride has been shown to inhibit the mitochondrial membrane potential, leading to the inhibition of cardiac muscle contraction and myocardial infarct size. Creatine zinc chloride also has physiological functions in energy metabolism, cytosolic calcium regulation, and glomerular filtration rate. Creatine zinc chloride may be used for the treatment of metabolic disorders, such as obesity and diabetes mellitus type II.
Formula:C4H9N3O2·ZnCl2Purity:Min. 99%Color and Shape:PowderMolecular weight:267.43 g/mol4-Nitro-3-iodoanisole
CAS:4-Nitro-3-iodoanisole is a bauerine that is used as a ligand in asymmetric catalysis. It is an atropisomeric compound, meaning it can exist in two different forms. The two forms of 4-nitro-3-iodoanisole are identical except for the orientation of the axial ligands on opposite sides of the molecule. The axial ligands on one form are biphenyl and nitrous oxide, while the axial ligands on the other form are nitrous oxide and biphenyl. 4-Nitro-3-iodoanisole has been used to catalyze reactions such as alkylation and coupling reactions with a variety of substrates, including β-carbolines, phenols, and amines.
Formula:C7H6INO3Purity:Min. 95%Color and Shape:PowderMolecular weight:279.03 g/molRef: 3D-FN67687
Discontinued productDeschloro atovaquone
CAS:Deschloro atovaquone is a drug that is used to treat HIV. It is an antiretroviral drug with pharmacokinetic properties that are similar to those of chloroquine, which inhibits the growth of the virus by interfering with DNA synthesis. Deschloro atovaquone has been shown to decrease the plasma concentrations of HIV in patients and has been found to be useful in treating encephalitis caused by Toxoplasma gondii and other viruses. It has also been shown to be effective against patients with immunodeficiency diseases.
Formula:C22H20O3Purity:Min. 95%Color and Shape:Off-White To Yellow SolidMolecular weight:332.39 g/molRef: 3D-FD21153
Discontinued product4-Chloro-2-methylaniline
CAS:4-Chloro-2-methylaniline (CMA) is a chemical that belongs to the group of amines and is used as an intermediate in the manufacture of dyes, pesticides and pharmaceuticals. CMA has been shown to be toxic to humans through skin contact, inhalation or ingestion. This substance also disrupts the activity of enzymes such as acetylcholinesterase, which is responsible for breaking down acetylcholine and regulating muscle contractions. Long-term exposure to this chemical may lead to bladder cancer. CMA can also be used as a model for carcinogenic potential studies due to its ability to induce cancer in animals.
Formula:C7H8ClNPurity:Min. 95%Molecular weight:141.6 g/molRef: 3D-FC64323
Discontinued product3-Methoxy-5-(trifluoromethyl)aniline
CAS:3-Methoxy-5-(trifluoromethyl)aniline is a chemical building block that is used in the preparation of pharmaceuticals, agrochemicals, dyes, and other chemicals. 3-Methoxy-5-(trifluoromethyl)aniline is also a versatile intermediate that can be used to produce heterocyclic compounds. 3-Methoxy-5-(trifluoromethyl)aniline has been found to be high quality and useful for many reactions. It is an important compound for research use because it can be used as a reagent or scaffold for complex compounds.
Formula:C8H8F3NOPurity:Min. 95%Color and Shape:PowderMolecular weight:191.15 g/molRef: 3D-FM70659
Discontinued product3,3',5-Triiodo-L-thyronine
CAS:Triiodothyronine (T3) is a thyroid hormone that has a high affinity for the thyrotropin receptor. It regulates the metabolic rate, cell specific transcriptional regulation, and transcriptional regulation of genes involved in fatty acid synthesis. T3 is synthesized from the amino acid tyrosine through a series of reactions catalyzed by enzymes such as tyrosine hydroxylase, thyroperoxidase, and type 2 iodothyronine deiodinase. The enzyme thyroid peroxidase converts inactive T3 to the active form of T3 (triiodothyronine). In addition, triiodothyronine can be converted to reverse T3 (rT3), which is inactive. Triiodothyronine has an optimal ph of 7.4-8.0 and an optimum igf-i concentration of 100 ng/ml, where it can stimulate growth hormone release from the anterior pituitary gland.
Formula:C15H12I3NO4Purity:Min. 95 Area-%Color and Shape:Off-White PowderMolecular weight:650.97 g/molRef: 3D-FT28506
Discontinued product(S,E)-3-(6-Bromopyridin-2-yl)-2-cyano-N-(1-phenylethyl)acrylamide
CAS:(S,E)-3-(6-Bromopyridin-2-yl)-2-cyano-N-(1-phenylethyl)acrylamide (MBI-23) is a potential antineoplastic agent that has been shown to induce regression of bladder cancer in mice. MBI-23 induces apoptosis by inhibiting the proliferation of cancer cells and inducing differentiation of cancer stem cells. It is also shown to inhibit tumor growth and progression in glioma and prostate cancer models. MBI-23 binds to the KDR receptor subtype, which is activated by organic acids and inhibited by inorganic compounds. This binding leads to constitutive activation of the KDR receptor, thereby inducing apoptosis. The tautomers and stereoisomers of MBI-23 have not been fully elucidated yet.Formula:C17H14ON3BrPurity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:356.22 g/molRef: 3D-FB34118
Discontinued productEthyl dichlorophosphate
CAS:Controlled ProductEthyl dichlorophosphate is a chemical compound that inhibits the production of influenza virus by binding to the cap-dependent endonuclease. It also binds to the nitrogen atoms in guanine, which blocks the activity of phosphorodichloridate, an enzyme that cleaves DNA at the phosphate bonds. Ethyl dichlorophosphate has been shown to inhibit inflammation and protect against oxidative stress in human cells.
Formula:C2H5CI2O2PPurity:Min. 95%Molecular weight:192.94 g/mol7-Chloro-2H-pyrido[3,2-B]-1,4-oxazin-3(4H)-one
CAS:7-Chloro-2H-pyrido[3,2-B]-1,4-oxazin-3(4H)-one is a chemical which is used as a reagent and building block in the synthesis of more complex compounds. It has been reported to be an intermediate for the production of pharmaceuticals and agrochemicals. The compound can also be used as an intermediate for the synthesis of other valuable chemicals such as pesticides and dyes. 7-Chloro-2H-pyrido[3,2-B]-1,4-oxazin-3(4H)-one has a CAS number of 205748-05-6.
Formula:C7H5ClN2O2Purity:Min. 96 Area-%Color and Shape:PowderMolecular weight:184.58 g/molRef: 3D-FC66462
Discontinued product1,1,1,2,2,3,3,4,4,5,5,6,6-Tridecafluoro-6-Propan-2-Yloxyhexane
CAS:Controlled Product1,1,1,2,2,3,3,4,4,5,5,6,6-Tridecafluoro-6-Propan-2-Yloxyhexane (HFPO) is a perfluorinated compound that has been shown to be a potent inhibitor of HIV. It is used in biomedical research as an experimental treatment for HIV infection. HFPO inhibits the activity of phosphatase by binding to the active site and blocking the hydrolysis of phosphate groups from ATP. This prevents the release of energy from ATP and blocks protein synthesis. HFPO also binds to retroviruses and proviruses at their binding sites on RNA polymerase II during transcriptional elongation and inhibits viral replication.
Formula:C9H7F13OPurity:Min. 95%Molecular weight:378.13 g/molb-Chloro-L-alanine hydrochloride
CAS:b-Chloro-L-alanine hydrochloride (BCA) is a synthetic compound that has been shown to have anticarcinogenic and antioxidant effects. It can be produced by the hydrogen peroxide-dependent oxidation of b-chloroalanine. BCA's effect on cancer cells is attributed to its ability to inhibit the synthesis of sulfoxides, which are needed for the biosynthesis of pyrimidine nucleotides. BCA also inhibits oxidative stress by scavenging free radicals and reactive oxygen species. This product has been shown to be effective in treating Aeropyrum pernix infections, which are caused by a type of anaerobic bacteria with a metabolic pathway that includes sulfide oxidation.
Formula:C3H6NO2Cl·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:160 g/molPalmatine chloride
CAS:Palmatine chloride is an alkaloid that has been isolated from the roots of Corydalis yanhusuo. Palmatine chloride inhibits the activity of toll-like receptor 4, which is a key molecule in inflammation and autoimmunity. This compound also inhibits the synthesis of proinflammatory cytokines such as IL-1β, IL-6, and TNF-α. Palmatine chloride has also been shown to inhibit the production of inflammatory mediators such as nitric oxide (NO) and prostaglandin E2 (PGE2). Furthermore, palmatine chloride has been found to have anti-cancer properties through its inhibition of squamous cell carcinoma cells.
Formula:C21H22NO4ClPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:387.86 g/molRef: 3D-FP73849
Discontinued product4-Amino-5-chloro-2-ethoxybenzoic acid
CAS:4-Amino-5-chloro-2-ethoxybenzoic acid is a phenoxy compound that is synthesized in the laboratory. The chemical structure of this compound has been studied using high performance liquid chromatography and it was found to have pharmacokinetic properties that are consistent with those of other drugs in its class. This drug is being developed as an anti-depressant, targeting the 5HT4 receptor. The bioactive metabolite of 4-amino-5-chloro-2-ethoxybenzoic acid is 4-(4′ hydroxybutyl)phenol, which has been shown to be a potent inhibitor of phosphodiesterase activity.
Formula:C9H10ClNO3Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:215.63 g/molRef: 3D-FA71234
Discontinued product4,5-Dimethoxy-1,2-phenylenediamine hydrochloride
CAS:Produces fluorescent benzimidazole derivatives; detects aromatic aldehydes
Formula:C8H14N2O2•xHClPurity:Min. 98%Color and Shape:Purple PowderMolecular weight:241.11 g/mol[2-(Pyridin-2-ylthio)ethyl]amine dihydrochloride
CAS:2-(Pyridin-2-ylthio)ethyl]amine dihydrochloride is a chemical compound that has been used as a research reagent. It reacts with other compounds to produce new substances, and it can be used as a building block for more complex compounds. 2-(Pyridin-2-ylthio)ethyl]amine dihydrochloride is soluble in water and organic solvents such as acetone and ethanol, making it useful for reactions that require both types of solvents. This product also has CAS No. 40379-31-5, which means it is listed on the Chemical Abstracts Service registry. 2-(Pyridin-2-ylthio)ethyl]amine dihydrochloride has an interesting chemical structure that makes it a versatile building block or intermediate for many different reactions.
Formula:C7H10N2S•(HCl)2Purity:Min. 95%Color and Shape:PowderMolecular weight:227.15 g/molRef: 3D-FP121658
Discontinued product5-Chloroindole
CAS:5-Chloroindole is a molecule that can bind to the CB2 cannabinoid receptor. It has been shown in experiments to be an allosteric modulator of this receptor. 5-Chloroindole has been found to have an inhibitory effect on degenerative diseases, such as Huntington's disease and Alzheimer's disease, and may have therapeutic potential for these disorders. 5-Chloroindole binds to a metal surface by forming hydrogen bonds with the oxygen atom of its carboxyl group and the metal surface. The nucleophilic nature of 5-chloroindole allows it to react with chloride ions present in solution. 5-Chloroindole reacts with the carbon source in tissue culture, which leads to receptor activity and inhibition of cell proliferation.
Formula:C8H6ClNColor and Shape:White PowderMolecular weight:151.59 g/mol4-(Trifluoromethylthio)benzyl alcohol
CAS:4-(Trifluoromethylthio)benzyl alcohol (4TFABA) is a chemical that is used as a reagent in organic synthesis. It can be used to synthesize a variety of compounds, including pharmaceuticals and agrochemicals. 4TFABA has been found to be an excellent building block for the synthesis of complex molecules. It is also widely used as a reaction component in high-quality research chemicals, such as chiral ligands and heteroaryl ligands.
Formula:C8H7F3OSPurity:Min. 95%Color and Shape:PowderMolecular weight:208.2 g/molTris(triphenylphosphine)rhodium(I) chloride
CAS:Homogeneous hydrogenation catalyst
Formula:C54H45ClP3RhPurity:Min. 95%Color and Shape:PowderMolecular weight:925.21 g/mol1-Chloro-2,2,3-Trifluoropropane
CAS:Controlled Product1-Chloro-2,2,3-trifluoropropane is a chemical compound that belongs to the group of chlorinating agents. It is a preparative agent for chlorine and hydrochloric acid. 1-Chloro-2,2,3-trifluoropropane has been used in thermoelectric applications as an intermediate in the production of hydrogen fluoride. It has also been used as a reagent for producing fluorine gas or hydrofluoric acid. This chemical is also used in preparative methods to produce diode lasers or monofluorides.
Formula:C3H4ClF3Purity:Min. 95%Molecular weight:132.51 g/molMethyltriphenylphosphine bromide
CAS:Methyltriphenylphosphine bromide is a chemical inhibitor that binds to the active site of mitochondrial enzymes, disrupting their function. It has been shown to be a potent chemical inhibitor of congestive heart failure in an electrochemical impedance spectroscopy study. Methyltriphenylphosphine bromide may also inhibit the production of antimicrobial peptides by interfering with the activity of proteases and lipases. This drug could be used for the treatment of metabolic disorders such as diabetes mellitus or obesity. Methyltriphenylphosphine bromide is not effective against vancomycin-resistant Staphylococcus aureus (VRSA) or methicillin-resistant Staphylococcus aureus (MRSA).
Formula:C19H18P·BrPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:357.22 g/molRef: 3D-FM11476
Discontinued product4-Fluoroandrostenedione
CAS:Controlled Product4-Fluoroandrostenedione is a synthetic, nonsteroidal compound that has been shown to be an effective androgen ablation agent. It binds to the androgen receptor, which prevents conversion of testosterone into dihydrotestosterone (DHT). 4-Fluoroandrostenedione has been used in clinical trials for the treatment of prostate cancer. This drug has also been shown to inhibit the production of estrogens by binding to the aromatase enzyme, which converts androgens into estrogens. Substitutions on the a-ring have been shown to increase its activity as an anti-cancer agent. 4-Fluoroandrostenedione can be synthesized from androstenedione by substituting a fluorine atom on one of the carbons in the a-ring.
Formula:C19H25FO2Purity:Min. 95%Molecular weight:304.4 g/molTriphenylchlorosilane
CAS:Triphenylchlorosilane is a reactive compound that has been used as a model system for studying the reaction of congestive heart failure. It has been shown to inhibit energy metabolism and cell factor, which are important factors in the progression of congestive heart failure. Triphenylchlorosilane also reacts with p-hydroxybenzoic acid to form an unstable intermediate, which undergoes intramolecular hydrogen transfer to give the final product. The reaction mechanism is proposed to be a coordination geometry involving three chlorine atoms. This compound is not reactive with sodium salts or structural analysis, but it does bind signal peptide in vivo models and can be used as a probe for protein-protein interactions.
Formula:C18H15ClSiPurity:Min. 95%Color and Shape:PowderMolecular weight:294.85 g/mol2-(4-Acetophenoxy)-3-chloro-5-trifluoromethyl pyridine
CAS:Please enquire for more information about 2-(4-Acetophenoxy)-3-chloro-5-trifluoromethyl pyridine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C14H9ClF3NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:315.67 g/molRef: 3D-FA168837
Discontinued product2-Bromo-5-chlorophenylacetonitrile
CAS:2-Bromo-5-chlorophenylacetonitrile is an organic compound that is used as a reagent and building block in the synthesis of other chemicals. It is a colourless liquid that can be used to synthesize complex compounds. 2-Bromo-5-chlorophenylacetonitrile has been shown to be useful in the synthesis of pharmaceuticals, pesticides, and herbicides. This chemical can be used as a versatile intermediate or building block for the production of high quality research chemicals and specialty chemicals. 2-Bromo-5-chlorophenylacetonitrile is not on the list of chemical substances classified as hazardous according to EU regulation (EINECS) No. 231-1003.
Formula:C8H5BrClNPurity:Min. 95%Color and Shape:PowderMolecular weight:230.49 g/molRef: 3D-FB66910
Discontinued productSodium fluorosilicate
CAS:Controlled ProductSodium fluorosilicate is an inorganic acid that can be prepared by dissolving sodium carbonate and hydrogen fluoride in water. It is used as a sample preparation agent for electrochemical impedance spectroscopy, as well as a reagent for the determination of acidic properties. Sodium fluorosilicate has been shown to inhibit the growth of epidermal cells, which may be due to its ability to cause an increase in the mitochondrial membrane potential. This compound also inhibits the synthesis of proteins from RNA, which may result from its coordination geometry or hydrogen-bonding interactions. Sodium fluorosilicate has been used in analytical methods involving x-ray diffraction data and plasma mass spectrometry.
Formula:Na2SiF6Purity:Min. 95%Molecular weight:188.06 g/mol3-Amino-3-(4-bromophenyl)propanoic acid
CAS:3-Amino-3-(4-bromophenyl)propanoic acid is a versatile building block that is used in the synthesis of many different compounds. It is a reagent, useful as a research chemical and as a speciality chemical. 3-Amino-3-(4-bromophenyl)propanoic acid has been used in the synthesis of a number of complex compounds, including pharmaceuticals and pesticides. This compound is a good choice for use in organic synthesis because it reacts readily with an array of functional groups, such as carboxylic acids and amines.Formula:C9H10BrNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:244.09 g/molRef: 3D-FA140126
Discontinued productN-[6-Chloro-5-(2-methoxyphenoxy)-(2,2-bipyrimidine)4-4-yl]-(1,1-dimethylethyl)-benzenesulfonamide
CAS:N-[6-Chloro-5-(2-methoxyphenoxy)-(2,2-bipyrimidine)4-4-yl]-(1,1-dimethylethyl)-benzenesulfonamide is a reagent that can be used as a reaction component in the synthesis of complex compounds. It has high quality and is a versatile building block for the synthesis of speciality chemicals. N-[6-Chloro-5-(2-methoxyphenoxy)-(2,2-bipyrimidine)4-4-yl]-(1,1-dimethylethyl)-benzenesulfonamide is also a useful intermediate in the synthesis of fine chemicals.
Formula:C25H24ClN5O4SPurity:Min. 95%Color and Shape:White PowderMolecular weight:526.01 g/molRef: 3D-FC20113
Discontinued productN-(2-(3,4-dimethoxyphenyl)ethyl)(4-chlorophenyl)formamide
CAS:Controlled ProductPlease enquire for more information about N-(2-(3,4-dimethoxyphenyl)ethyl)(4-chlorophenyl)formamide including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FD169719
Discontinued product2-Bromo-3-hydroxybenzoic acid
CAS:2-Bromo-3-hydroxybenzoic acid is an inhibitor of HIV protease that has potent antiviral activity. It inhibits the enzyme responsible for the cleavage of the gag and pol polyproteins in HIV, preventing the formation of new virus particles. 2-Bromo-3-hydroxybenzoic acid is orally bioavailable and can be used as a prodrug for other benzamides or urethanes with antiviral potency. This drug is a cyclic inhibitor that binds to the hydrophobic pocket on the surface of HIV protease and prevents it from functioning as an enzyme.
Formula:C7H5BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:201.02 g/molRef: 3D-FB33765
Discontinued product
![7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carbo…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFA30404.webp&w=3840&q=75)
![2-[(Ethylamino)methyl]-4-aminophenol dihydrochloride](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFE23131.webp&w=3840&q=75)
![3-[5-(4-Fluorophenyl)-5-hydroxy-1-oxopentyl]-4-phenyl-2-oxazolidinone](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFF23467.webp&w=3840&q=75)
![Ethyl2-(acetylamino)-3-[3,5-diiodo-4-(4-methoxyphenoxy)phenyl]propanoate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFE149894.webp&w=3840&q=75)
![(4'-Bromo-[1,1'-biphenyl]-4-yl)(phenyl)methanone](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FIN%2Fthumb-webp%2FDA003KSK.webp&w=3840&q=75)
![2-[Methyl[(tridecafluorohexyl)sulphonyl]amino]ethyl acrylate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFM96258.webp&w=3840&q=75)
![4-[[4-(4-Chlorophenyl)-2-thiazolyl]amino]phenol](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFC137468.webp&w=3840&q=75)
![7-Chloro-2H-pyrido[3,2-B]-1,4-oxazin-3(4H)-one](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFC66462.webp&w=3840&q=75)
![[2-(Pyridin-2-ylthio)ethyl]amine dihydrochloride](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFP121658.webp&w=3840&q=75)
![N-[6-Chloro-5-(2-methoxyphenoxy)-(2,2-bipyrimidine)4-4-yl]-(1,1-dimethylethyl)-benzenesulfonamide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFC20113.webp&w=3840&q=75)
