Biochemicals and Reagents

<p>Mouse monoclonal Tuberculosis CFP10 antibody</p>

<p>Streptococcus group A antibody was raised in mouse using group A streptococci as the immunogen.</p>

<p>Mouse monoclonal Sialosyl-Tn antigen antibody</p>

<p>Peptide H-IYPTNGYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IYLDMLNVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Z-Gln-Gly is a protected dipeptide, which is commonly used as an intermediate in peptide synthesis. It is derived from the amino acids glutamine and glycine, with the N-terminal glutamine being protected by a benzyloxycarbonyl (Z or Cbz) group. This protective group is essential for preventing undesirable reactions at the amine site during peptide chain elongation.The primary mode of action for Z-Gln-Gly involves its use in solid-phase peptide synthesis, where the Z-group safeguards the amine functionality. This protection allows for selective reactions at other sites of the molecule until the final deprotection step, facilitating the sequential addition of amino acids.Z-Gln-Gly is used predominantly in research and development within biochemical and pharmaceutical laboratories. Its applications are critical in the synthesis of longer peptide chains and peptide-based drugs, where precision and control over the peptide structure are paramount for investigating biological processes and therapeutic functions.</p>

<p>H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe is a peptide that is activated by incubation with collagen. It has been shown to have an inhibitory effect on thrombin receptor and the activation of coagulation factors, which may be due to its ability to desensitize the receptor. HSLRAPAP can also be used in cancer therapy. In animal studies, it has been shown to inhibit tumor growth and metastasis. HSLRAPAP has also been shown to stimulate the production of platelets in animals, which may account for its antiplatelet properties.</p>

<p>Peptide H-GDTYPAELYITGSILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-PLARTLSVAGLPGKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PDEVKRKKKPYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>The Zika virus NS1 antibody is a monoclonal antibody that specifically targets the NS1 protein of the Zika virus. This antibody has been extensively studied in Life Sciences research and has shown promising results in various bioassays. It binds to the NS1 protein, inhibiting its function and preventing viral replication. The Zika virus NS1 antibody has also been shown to interact with β-catenin, a key signaling molecule involved in cell proliferation and differentiation. Additionally, this antibody has been used in electrode-based assays to detect the presence of Zika virus in human serum samples. Its high specificity and sensitivity make it a valuable tool for researchers studying the Zika virus and developing diagnostic methods.</p>

<p>Peptide H-HKKKHPDASV^NFSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-DEVDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-EKIEELQQA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EKIEELQQA-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EKIEELQQA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EKIEELQQA-OH at the technical inquiry form on this page</p>

<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur. This can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contributes to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased in and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>

<p>PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity. This product is available as an Acetate salt.</p>

<p>Bacillus anthracis (anthrax) antibody was raised in mouse using protective antigen of Bacillus anthracis as the immunogen.</p>

<p>H-STADGGTTSYAAPVEGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-STADGGTTSYAAPVEGR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-STADGGTTSYAAPVEGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-STADGGTTSYAAPVEGR-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Mouse anti Human IgG4 antibody</p>

<p>Rat monoclonal Ly6G antibody (FITC)</p>

<p>ANA Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ANA Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-GAYPLSIEPIGV^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SIINF^EKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FTLSVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-SLYSSSPGGAYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Purified recombinant p15, p17, p47 Treponema Pallidum protein</p>

<p>Peptide H-EDHLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH is a basic protein that is a member of the growth factor β1 family. It has been shown to increase collagen production and inhibit the transcription of pro-apoptotic proteins in the carcinoma cell lines. H-Gly-Arg-Ala-Asp-Ser-Pro-OH is also known as RGD peptides, which are derived from collagen. It has been found to induce genotoxic effects, such as chromosomal aberrations and sister chromatid exchanges, in cells.</p>

<p>Peptide H-AVPYPQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Neurotensin is a neuropeptide that is involved in the regulation of a variety of physiological functions, including neurotransmission, cardiovascular function, and appetite. It is composed of 13 amino acids and is primarily produced in the gastrointestinal tract and the central nervous system.<br>Neurotensin acts as a neurotransmitter and neuromodulator in the brain, where it is synthesized by neurons in several regions, including the hypothalamus, amygdala, and nucleus accumbens. In addition to its role in neurotransmission, neurotensin has been shown to be involved in the regulation of food intake and energy metabolism. It is thought to promote satiety and reduce food intake by interacting with the hypothalamus and other brain regions involved in appetite regulation.<br>Neurotensin has also been studied for its potential therapeutic applications as it has been shown to be associated with the pathophysiology of conditions such as Parkinson's disease, pain, schizophrenia, cancer and inflammatory bowel disease.<br>This product is available as a 0.5mg vial.</p>

<p>Boc-D-Ala-OH is a chiral amino acid that can be used in the synthesis of peptides. Boc-D-Ala-OH is a building block for the synthesis of amino acids, and it can also be used as a ligand to form metal complexes. This product has been shown to be effective in reducing optical activity through chemoenzymatic reduction processes. Boc-D-Ala-OH has also been shown to be hydrolyzed by various enzymes, including alcohols and acrylates.</p>

<p>H-TLWPILALI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TLWPILALI-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TLWPILALI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TLWPILALI-OH at the technical inquiry form on this page</p>

<p>The CA 19-9 antibody is a highly specific monoclonal antibody that targets the biomolecule CA 19-9. This biomarker is commonly used in the field of Life Sciences for diagnostic purposes, especially in the detection and monitoring of certain cancers, including pancreatic, colorectal, and ovarian cancer. The CA 19-9 antibody binds to the glycoprotein CA 19-9 present on tumor cells, allowing for its detection through various immunoassay techniques.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>

<p>Peptide Biot-EKKYFAATQFEPLAARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-ALRTSLAAL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALRTSLAAL-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALRTSLAAL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALRTSLAAL-OH at the technical inquiry form on this page</p>

<p>Tubulin ligand which promotes microtubule assembly and stabilises microtubule cytoskeleton against depolymerisation. The compound has anti-tumoral activity since its interference with cytoskeleton dynamics affects the assembly of mitotic spindle, segregation of chromosomes, cell division and blocks the cell cycle in G1 or M phase. The compound is also used for the purification of tubulin or microtubule-associated proteins.</p>

<p>Peptide H-DSGSPNPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-TESNKKFLPFQQFGRDIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLTSFLPAQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-GAAQNIIPASTGAAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GAAQNIIPASTGAAK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GAAQNIIPASTGAAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GAAQNIIPASTGAAK-OH at the technical inquiry form on this page</p>

<p>Peptide H-MSKQQPTQFINPETPGYVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NTVISVNPSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FTQAGSEVSALLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mosapride is a prokinetic 5-HT4 receptor agonist used to increase colon and gastric mobility. This drug allows the release of acetylcholine from enteric cholinergic neurons. Mosapride has also shown to provide relief when treating patients with constipation- type irritable bowel syndrome as it prevents abdominal pain.</p>

<p>Peptide H-TDPGVFIGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FL^DEFMEGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IGDFGLATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NTQPIMDTDGSYFVYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Octapeptide analog of Somatostatin; inhibits insulin and growth hormones</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-NLPQQCGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Antipain (supplied as the HCl salt) is a cytosolic and bound form of antipain. It binds to ATP-binding cassette transporter proteins, which are involved in the transport of substances across cell membranes, and inhibits their enzymatic activity. Antipain 2HCI also has inhibitory properties on enzymes such as DNA polymerase II and pyruvate kinase. It has been shown to have an effect on biochemical properties such as protein synthesis, enzyme activities, and polymerase chain reactions. This drug has been shown to be effective in preventing myocardial infarcts and cellular apoptosis by inhibiting the release of cytochrome c from mitochondria. Antipain 2HCI may also have some anti-inflammatory effects due to its inhibition of prostaglandin synthesis.</p>

<p>Peptide H-LQDAGVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Orally available prodrug of gemcitabine</p>

<p>Amastatin is a synthetic product that inhibits peptidases. It is an inhibitor of the protease enzyme and can be used in the treatment of bladder infections caused by Chlamydia parvum. Amastatin has also been shown to inhibit Aminopeptidase, which is an enzyme that cleaves amino acids from proteins, thereby inhibiting protein synthesis. Amastatin has been shown to have an inhibitory effect on proteases in the striatal membranes of rats and may be useful in treating neurodegenerative disorders such as Parkinson's disease.</p>

<p>IgG Fc antibody was raised in mouse using immunoglobulin G Fc region as the immunogen.</p>

<p>Regaloside D is a natural product derived from plant sources, specifically isolated from certain species known for their bioactive properties. It functions as a glycoside, a compound in which a sugar is bound to a non-carbohydrate moiety, potentially influencing a variety of cellular processes through its interaction with specific molecular targets.</p>

<p>Protein A antibody was raised in chicken using protein A from Staphylococcus aureus as the immunogen.</p>

<p>Peptide H-ISTLNSHNLPILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goat anti-rat IgG/IgA/IgM (H+L) was raised in goat using rat IgG, IgA and IgM whole molecules as the immunogen.</p>

<p>Goat anti-rat IgG (H+L) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>Humanin is an endogenous peptide which is encoded for by mitochondrial DNA. It has been described as a rescue factor due to it demonstrating the capabilities of abolishing neuronal cell death, therefore is can be used to as a potential treatment of Alzheimer’s disease. Another function of Humanin is it can inhibit mitochondira-dependent apoptosis through preventing the formation of apoptotic bodies and the release of Cytochrome C.<br>Humanin has been found to be related to aging related cardiovascular disease (ACVDs) due to evidence of Humanin serum levels as age increases. Furthermore Humanin increases the expression of antioxidant defense system proteins and impedes complexes I and III from their activity in the electron transport chain in myocardial cells and mitochondria, therefore decreasing oxidative stress damage caused by H2O2. Humanin further reduces reactive oxygen species production and protects cardiomyocytes and fibroblasts, from oxidative stress.<br>Overall Humanin has a variety of protective functions such as mitochondrial homeostasis and redox systems regulation, anti-aging, prevention of myocardial fibrosis, anti-inflammation, metabolism improvement and autophagy promotion. It has also been found to improve beta-cell survival and thus can be used as a diabetes treatment due to it improving insulin secretion and resistance.<br>This Humanin product has had the serine at position 14 on the amino acid chain replaced with a Glycine. This modification has been known to enhance the cytoprotective activity of Humanin by 1000 fold and proves to be highly anti-apoptotic. Therefore this product is of scientific interest for research laboratories. It is available as a 0.5mg vial.</p>

<p>Complement Component 3C (C3c), Highly Purified (Lyophilised) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Complement Component 3C (C3c), Highly Purified (Lyophilised) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>ß-Endorphin, also known as Equine ß-Endorphin, is a polypeptide hormone that is a member of the endorphin family. It is a peptide consisting of nine amino acids. ß-Endorphin has been found in the pituitary gland and in other tissues in concentrations much higher than those of other endorphins. Beta-endorphin is thought to be involved in pain relief and stress relief.</p>

<p>Caloxin 2A1 is a peptide that has been shown to activate the receptor for bradykinin, a peptide hormone that causes vasodilation. The activation of this receptor by Caloxin 2A1 leads to the opening of ion channels in the cell membrane, which causes an influx of calcium ions into the cell. This influx activates enzymes that break down proteins and increases the permeability of blood vessels. Caloxin 2A1 also inhibits ligand-induced activation of phospholipase C. Caloxin 2A1 binds to an antibody against bradykinin, which can be used as a research tool or as a means to measure levels of bradykinin in blood plasma.<br>Caloxin 2A1 has a molecular weight of 543 g/mol and CAS number 350670-85-8.</p>

<p>Fmoc-L-Asn(Trt)-OH is an Fmoc-protected amino acid with a free amine group. It is used as a building block for peptide synthesis and can be used in the production of polymeric materials for drug delivery. The Fmoc-protected amino acids are stable, but can be deprotected by treatment with trifluoroacetic acid or other strong acid. They are also soluble in organic solvents, such as dimethylformamide and DMF, which makes them useful for peptide synthesis. This product has minimal activity.BR&gt;<br>BR&gt;<br>BR&gt;</p>

<p>Charybdotoxin is a potent and selective ion channel inhibitor. It is a peptide that binds to the receptor site of the potassium channels that are found in nerve cells, blocking their activation. Charybdotoxin has also been shown to inhibit the activity of ligand-gated ion channels, such as acetylcholine receptors. This toxin has been used in research as a tool for studying protein interactions and has also been used in pharmacology as an experimental drug for treating hypertension.</p>

<p>Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.<br>One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD</p>

<p>(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu is a secretase inhibitor that inhibits the enzyme that cleaves amyloid precursor protein (APP) to release beta-amyloid. It has been shown to prevent the formation of plaques in the brain and may be used to treat Alzheimer's disease. (3,5-Difluorophenylacetyl)-Ala-Phg-OtBu has also been shown to inhibit the production of tumor necrosis factor alpha (TNFα), which is involved in inflammation and carcinogenesis. The drug has been shown to reduce myocardial infarct size by preventing cardiac cell death and reducing inflammation following a heart attack. It is also active against multiple types of cancer cells, including carcinoma cell lines and multidrug resistant cells.</p>

<p>Metastin is a peptide that activates the Kisspeptin receptor. It has been shown to inhibit protein interactions, activate ligands and receptors, and act as a research tool in cell biology. Metastin is an inhibitor of the G-protein coupled receptor, KISS1R. Metastin has been shown to activate the LGR5 receptor.</p>

<p>The outer membrane of gram-negative bacteria contains lipopolysaccharides (LPS) composed of lipid A. Lipid A is produced from the tetra-acylated precursor molecule, lipid IVA. As a part of a host's innate immune response there are toll-like receptor 4 (TLR4) and MD-2 which are expressed on immune cells. TLR4 and MD-2 recognize LPS leading to the activation of NFκB and pro-inflammatory cytokine production. Studies have suggested lipid A in Escherichia coli to be an agonist for both mouse and human TLR4, while lipid IVA can induce species specific TLR4 responses. For example for horse and mouse TLR4 and MD-2, Lipid IVA is an agonist where as it is an antagonist for TLR4 and MD-2 in humans.</p>

<p>Boc-D-Tyr(Br-Z)-OH is a sugar alcohol that has been shown to have anti-bacterial activity. It has been shown to inhibit the growth of dental plaque by inhibiting the synthesis of oligosaccharides, which are a major component of this type of biofilm. Boc-D-Tyr(Br-Z)-OH also inhibits transfer reactions in the bacterial cell wall, and is therefore able to prevent the formation of cell walls. This compound also has prebiotic properties, which may be due to its ability to stimulate insulin production. The enzyme responsible for Boc-D-Tyr(Br-Z)-OH synthesis is Tools for Peptide Synthesis (TPS). TPS catalyzes a chemical reaction that uses an acceptor molecule (e.g., ATP) and microbial metabolism as substrates. The product of this enzymatic reaction is fatty acids, which are then used in biosynthesis processes such as fatty acid</p>

<p>Leupeptin is a naturally occurring protease inhibitor that has been synthetically produced for use as an experimental tool. Leupeptin inhibits the activity of basic proteins and enzymes by binding to them at the active site, preventing their access to substrate. This inhibition can be reversed with reducing agents (e.g., dithiothreitol). Leupeptin has been shown to inhibit neuronal death during anoxia in experimental models and has also been shown to have neurotrophic effects, which may be due to its ability to prevent protein aggregation.</p>

<p>Glycerol-3 phosphate dehydrogenase antibody was raised in goat using glycerol-3-phosphate dehydrogenase isolated from rabbit muscle as the immunogen.</p>

<p>H-EQYNSTYRVVSVLTVLHQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EQYNSTYRVVSVLTVLHQ-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EQYNSTYRVVSVLTVLHQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EQYNSTYRVVSVLTVLHQ-OH at the technical inquiry form on this page</p>

<p>Boc-γ-Abu-OH is a model drug used in peptide synthesis. It is a building block that can be used to form the amino acid γ-Abu. This amino acid has an unusual β-amino group, which is coupled with the Boc group using photorelease chemistry. The resulting compound can be used as a building block for dendrimer or convergent syntheses.<br>Boc-γ-Abu-OH reacts with dimethoxybenzene and dendron to form γ-Abu. The resulting product can be reacted with other molecules, such as diamines and benzyl halides, to produce analogues of γ-Abu. This process allows for the synthesis of new compounds that have not been previously reported in the literature.</p>

<p>Aprotinin is a pharmacological agent that inhibits the activity of enzymes such as plasmin, kallikrein, and trypsin. It is used to prevent or reduce the severity of ischemia-reperfusion injury in heart surgery. Aprotinin also inhibits platelet aggregation and promotes blood coagulation. The drug has been shown to inhibit the activity of x-ray crystallographic inhibitor molecules that are involved in intermolecular hydrogen bonding and multivariate logistic regression. Aprotinin has been shown to have effects on eosinophil cationic protein (ECP), which may be related to its anti-inflammatory properties.</p>

<p>UDP-β-L-Rhamnose is a pentose sugar that is used as a research tool and an activator. It has been shown to be an inhibitor of ion channels and protein interactions, as well as a ligand for certain receptors. This compound has high purity and can be used in the study of cell biology, pharmacology, and immunology.</p>

<p>Ubenimex is a peptide-based inhibitor of aminopeptidase enzymes that act on the N-terminus of amino acid chains. It is also an inhibitor of Leucine aminopeptidase 3 (LAP3) and a potent irreversible inhibitor of Leukotriene A4 (LTA4) hydrolase. It is used in the treatment of non-alcoholic steatohepatitis. Ubenimex binds to the active site of aminopeptidases and inhibits their activity, thus preventing degradation of peptides. Ubenimex has been shown to inhibit aminopeptidase A and B, but not C or D. As a result, it prevents cleavage of the N-terminal amino acids from proteins, which may be involved in inflammatory processes. Furthermore Bestatin has been shown to exhibit antibacterial properties against P. gingivalis and F. nucleatum and is available in the salt form: Hydrochloride.</p>

<p>RAGE antibody was raised in goat using a peptide; PKKPPQRLEWKLNTGRTE, as the immunogen.</p>

<p>Ac-CHAPYRNISQRISVDPVT-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CHAPYRNISQRISVDPVT-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CHAPYRNISQRISVDPVT-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CHAPYRNISQRISVDPVT-NH2 at the technical inquiry form on this page</p>

<p>Inhibitor of PDE4 enzyme; anti-inflammatory</p>

<p>H-IPLENLQIIR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IPLENLQIIR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IPLENLQIIR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IPLENLQIIR-OH at the technical inquiry form on this page</p>

<p>H-Ser-Phe-Leu-Leu-Arg-OH is a cyclic peptide that has been shown to have cytotoxic effects against cells of the atherosclerotic lesion in vivo. It also has antioxidant properties and can be used as a biocompatible polymer for the treatment of autoimmune disease. This drug is not potent enough to be used as an antibacterial agent but is effective against some strains of Mycobacterium tuberculosis and Mycobacterium avium complex. This drug binds to integrin receptors on cells, which may account for its low potency.</p>

<p>HEXIM1 antibody was raised in mouse using recombinant Human Hexamethylene Bis-Acetamide Inducible 1</p>

<p>CHGB antibody was raised in Rabbit using Human CHGB as the immunogen</p>

<p>Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.</p>

<p>SARS-CoV-2/Flu A/Flu B/RSV Negative Human Nasal Swab (UTM) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-2/Flu A/Flu B/RSV Negative Human Nasal Swab (UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>MBP protein is a cytotoxic and neutralizing protein that plays a crucial role in various life sciences applications. It acts as an acetyltransferase, transferring an acetyl group from acetyl-CoA to target proteins. MBP protein is commonly used in research as a marker for myelin-producing cells and has been extensively studied for its cholinergic properties. It can bind to specific receptors, such as the interleukin-6 receptor, and modulate signaling pathways involved in cell growth and differentiation. Additionally, MBP protein has been used in genotoxicity studies to evaluate the potential effects of various substances on DNA damage. With its unique properties and diverse applications, MBP protein is a valuable tool for researchers in the field of life sciences.</p>

<p>This is a monoclonal antibody that binds to the alpha-integrin receptor. The alpha-integrin receptor is an integrin that is involved in cell adhesion and migration, as well as the activation of several signaling pathways. This antibody has been shown to inhibit the binding of alpha-integrins to phospholipid membranes, which may be due to inhibition of protein kinase C (PKC). This antibody also inhibits thrombin receptor activation and dextran sulfate-induced cytosolic calcium mobilization.</p>

<p>Cyclin D1 is a key regulator of cell proliferation and its expression and accumulation within cells is under tight control. Cyclin D1 is the regulatory subunit of cyclin-dependent kinases 4 and 6. These activated cyclin dependent kinases then phosphorylate the retinoblastoma protein (Rb) and drive G1 to S phase progression. Cyclin D1 promotes cell proliferation through interaction with transcription factors such as the oestrogen receptor and specificity protein 1 (Sp1). Cell proliferation is extremely sensitive to altered levels of cyclin D1, with even modest changes in its expression having noticeable effects on cell cycle progression. Cyclin D1 is a proto-oncogene and its overexpression is one of the most frequent alterations seen in multiple cancer types._x000D_<br>_x000D_<br>This antibody is conjugated to Alexa Fluor® 488. Alexa Fluor® 488 is a popular bright green fluorescent dye with high pH-stability.</p>

<p>H-His-D-Trp-D-Lys-Trp-D-Phe-Lys-NH2 is an inhibitor of cyclase that blocks the conversion of ATP to cAMP. It has shown to have potential as a biomarker for cancer tissues and can be used in experimental models of cancer. HHDLKPDTDLKYSHN2 also inhibits phosphodiesterase, which is involved in the breakdown of cAMP, and can be used to treat bowel disease.</p>

<p>Bivalirudin is a synthetic cyclic peptide that binds to the ATP-binding cassette transporter and inhibits the activity of the proteolytic enzyme, angiotensin-converting enzyme (ACE). ACE inhibition prevents the conversion of angiotensin I to angiotensin II. Bivalirudin has been shown to be effective in reducing mortality in patients with acute coronary syndrome or undergoing percutaneous coronary intervention. It has also been shown to have pharmacokinetic properties that are similar to those of heparin. The drug has a low dose and is not associated with an increased risk of bleeding. Bivalirudin is an inhibitor and can cause drug interactions when combined with other drugs that are inhibitors or substrates for this type of transporter.</p>

<p>Alkaline phosphatase antibody was raised in rabbit using alkaline phosphatase isolated from calf intestine as the immunogen.</p>

<p>Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.</p>

<p>Diprotin B is a colony-stimulating factor protein that has inhibitory properties in the colon. It has been shown to be effective in reducing symptoms of bowel disease and inflammatory bowel disease, as well as reducing the recurrence of colon cancer. Diprotin B inhibits the release of inflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6). The inhibition of these proinflammatory cytokines may contribute to the anti-inflammatory effects observed with Diprotin B treatment. Diprotin B also prevents cytosolic calcium accumulation, which can lead to cell lysis. This process is mediated by antimicrobial peptides called defensins that are expressed in Paneth cells found in the small intestine and colon. Defensins have also been shown to induce cell lysis through their ability to bind to bacterial membranes.</p>

<p>Human growth hormone antibody was raised in mouse using purified human growth hormone as the immunogen.</p>

<p>Region of TGF alpha protein corresponding to amino acids VVSHFNDCPD SHTQFCFHGT CRFLVQEDKP ACVCHSGYVG ARCEHADLLA.</p>

<p>GsMTx-4 is a peptide that is an inhibitor of the G protein. It has been shown to inhibit the activity of GsMTx-2, which is a G protein that regulates cell proliferation and differentiation. It has been used as a research tool for studying the interactions between proteins in cells. GsMTx-4 also inhibits the binding of Ligands to receptors, inhibiting their activation. This molecule can be used as an antibody against other peptides or proteins.</p>

<p>Boc-D-Asp(OcHex)-OH is a peptide that belongs to the group of activators. It binds to the receptor and induces a conformational change in the receptor protein, which leads to activation of an ion channel. Boc-D-Asp(OcHex)-OH is also known as orexin A, which is a peptide that regulates appetite and sleep. This compound has been shown to stimulate the release of histamine from mast cells and inhibit tumor necrosis factor production. It has been used as a research tool for studying protein interactions and ligand binding. Boc-D-Asp(OcHex)-OH has been shown to be an inhibitor of calcium channels, potassium channels, and sodium channels in vitro at low concentrations (10 μM).</p>

<p>SLIT2</p>

<p>SNX-482 is a peptide inhibitor that blocks the interaction of receptor and ligand, thus inhibiting the biological response. It can be used as a research tool in cell biology, pharmacology, and other scientific fields. SNX-482 has a purity of 99% or higher and is supplied as lyophilized powder.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>TCTU Reagent is a coupling reagent that is used to synthesize peptides. TCTU Reagent is a building block for peptide synthesis, which can be used to produce peptides of different lengths. TCTU Reagent also has the ability to condense two amino acids together in sequence to form a dipeptide. This reagent has been shown to be compatible with most amino acids, except glycine and tryptophan, and can be used for both automated or manual peptide syntheses.</p>

<p>Phosphoramidon is a phosphonate compound that inhibits the binding of two enzymes, cholinesterase and butyrylcholinesterase. It has been shown to cause a bronchoconstrictor response in mice, inhibit mesenteric enzyme activities, and inhibit cardiac enzyme activity in rats. Phosphoramidon is used as an experimental drug for treatment of myocardial infarcts. It also has an effect on the central nervous system by acting on neurokinin-1 receptors and kappa-opioid receptors.<br>Phosphoramidon is a monosodium salt with biochemical properties similar to those of other members of this class of drugs.</p>

<p>PAMP (human) is a peptide that binds to the G-protein coupled receptor, M3. It activates the ion channel and induces an influx of calcium ions into cells. This can lead to cell proliferation and differentiation, as well as increased blood flow in the brain. PAMP has been shown to inhibit ligand-induced activation of M3 receptors by competing with the natural ligands for binding sites on these receptors. It has also been shown to have high purity (&gt;95%), and is currently under research for its use in various medical applications such as cancer therapy, pain management, and treatment of respiratory diseases.</p>

<p>Cardiolipin sodium salt from Bovine Heart</p>

<p>Boc-D-Ser(Bzl)-OH is a synthetic molecule that can be used in peptide synthesis. It is a potent inhibitor of galactose and tetrazole, and it inhibits the activities of enzymes involved in the synthesis of proteins, such as methionine synthase. Boc-D-Ser(Bzl)-OH has been shown to inhibit atherosclerotic lesions by blocking secretagogue activity and also inhibits the production of inflammatory mediators. This compound has potent inhibitory effects on piperidine.</p>

<p>Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is an enzyme substrate that acts as a competitive inhibitor of the hepatitis C protease. It has been shown to inhibit the activity of the hepatitis C protease in cell culture, and can be used to identify other inhibitors of this protease. Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is a peptide with an amino acid sequence that is not found in any known proteins.</p>

<p>Boc-Gln-Ala-Arg-AMC is a peptide inhibitor of the human voltage-gated potassium channel Kv1.2. It is a competitive antagonist of the Kv1.2 channel and has been shown to inhibit the proliferation of human cancer cells in vitro and in vivo. Boc-Gln-Ala-Arg-AMC binds to the S4 segment of Kv1.2, which is located on the surface of the channel. This binding prevents opening of the voltage sensor domain and thereby reduces or eliminates current flow through the channel. Boc-Gln-Ala-Arg-AMC can be used as a research tool for studying protein interactions with ion channels, as well as for understanding receptor activation mechanisms and ligand binding sites.</p>

<p>Fmoc-Acc-OH is a proteolytic amino acid with an apical profile. It is used as a building block for peptide synthesis and as a tool for the synthesis of peptides, proteins, and other biomolecules. Fmoc-Acc-OH has been shown to induce apoptosis in cancer cells and viruses. This amino acid also has biochemical properties that include reversine-treated apoptotic signaling and anti-inflammatory activities.</p>

<p>Amino acids 47-57 of the Human Immunodeficiency Virus (HIV) viral coat trans-activator of transcription protein (TAT protein). TAT is a cell penetrating peptide meaning it has the ability to transport itself across cell membranes and into a cell's nucleus independently. Cell penetrating peptides (CPPs) can be used to carry other molecules into the cell and therefore can be used in many applications. Such applications may include: drug delivery, where small drug peptides or nucleic acids can be delivered into target cells or where CPPs are conjugated to imaging agents such as fluorescent dyes or radiolabeled molecules they can be used for in vivo or in vitro imaging in diagnostics. <br>This product is available as a trifluroacetate salt.</p>

<p>OVA Peptide (323-339) is a Chicken ovalbumin fragment that has been shown to have an immune checkpoint activity. It has been shown to be reactive with ISQAVHAAHAEINEAGR and can be used in the treatment of infectious diseases. This peptide is also used for histological analysis of microglia and toll-like receptor expression in skin cancer. OVA Peptide (323-339) also has the potential for use as a basic protein in α7 nicotinic acetylcholine therapy.</p>

<p>The endothelium is a layer of cells that lines the inner surface of blood vessels and lymphatic vessels, forming a barrier between circulating blood or lymph and the rest of the body. It is involved in maintaining vascular homeostasis as well as in inflammation. The endothelium regulates vascular tone and blood pressure through release of nitric oxide (NO) and other substances, such as prostacyclin, vasoactive peptides, endothelin-1, tumor necrosis factor-α, interleukin-1β, and thromboxane A2. Endothelial cells are activated by various means such as increased intracellular Ca2+ concentration or basic fibroblast growth factor (bFGF). This activation can be inhibited by receptor antagonists such as neurokinin-1 receptor antagonists.</p>

<p>Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.</p>

<p>Clostridum difficile toxin B antibody was raised in mouse using toxin B of Clostridium difficile as the immunogen.</p>

<p>Alpha-Mating Factor is a peptide that belongs to the group of ligands. It has been shown to bind to the androgen receptor with high affinity and act as an activator for this receptor. Alpha-Mating Factor is also able to bind to the beta-adrenergic receptor. This protein has been shown to have ion channel activity, which may be due to its inhibition of potassium channels. Alpha-Mating Factor is used in research as a tool for studying cell biology and cell signalling pathways.</p>

<p>Hexadentate chelator</p>

<p>H-SGCKNGQIL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SGCKNGQIL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SGCKNGQIL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SGCKNGQIL-OH at the technical inquiry form on this page</p>

<p>6-(4-((3-(Benzyloxy)benzyl)oxy)-6-methoxybenzofuran-2-yl)-2-methoxyimidazo[2,1-b][1,3,4]thiadiazole (6BZT) is a high purity chemical reagent that is used in the field of Life Sciences for research purposes and as a pharmacological tool. 6BZT has been shown to activate the G protein coupled receptor (GPCR). 6BZT binds to the agonist binding site on the GPCR and activates it by increasing intracellular cAMP levels. The activation of this receptor can be observed in cell biology experiments using immunofluorescent staining or western blotting. Research using 6BZT has shown that it inhibits both potassium and sodium ion channels, which are important for cellular function. It also inhibits peptide ligand interactions with its receptor. 6BZ</p>

<p>Peptide H-FSVYWAQADR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-KVPRNQDWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-GLHTSATNLYLH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Felodipine is a calcium channel blocker and a member of the 1,4-dihydropyridine class of calcium channel blockers that is used to treat high blood pressure and related conditions. Felodipine increases the level of natriuretic peptide in the blood and reduces levels of infectious diseases such as influenza A virus and respiratory syncytial virus (RSV).<br>Felodipine is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready to use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Hemoglobin antibody was raised in goat using human hemoglobin as the immunogen.</p>

<p>Goat polyclonal CRP antibody</p>

<p>The Zika virus NS1 antibody is a highly specialized antibody that targets the NS1 protein of the Zika virus. This protein plays a crucial role in viral replication and pathogenesis. The antibody has been extensively studied and shown to effectively neutralize the virus by binding to the NS1 protein, preventing its interaction with host cells.</p>