Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,127 products)
- By Biological Target(99,160 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,742 products)
- Secondary Metabolites(14,222 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-VPLQQNFQDNQFQGK^-OH
<p>Peptide H-VPLQQNFQDNQFQGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-112/aa445 - 459
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,607.8 g/mol3-(4-Phenylbutyl)-4-propyloxetan-2-one
CAS:<p>Cis/trans-form of GK 563 [2351820-19-2]</p>Formula:C16H22O2Purity:Min. 95%Color and Shape:SolidMolecular weight:246.34 g/molCMVpp65 - 120 (HNPAVFTWPPWQAGI)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,721 g/molH-APEPVEIR^-OH
<p>Peptide H-APEPVEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Acetyl Hexapeptide-3
<p>Peptide Acetyl Hexapeptide-3 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTV^LGQPK^-OH
<p>Peptide H-LTV^LGQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-V^DPLETELGVK^-OH
<p>Peptide H-V^DPLETELGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>1a,25-Dihydroxyvitamin D3
CAS:<p>Calcitriol is a steroid hormone, vitamin D metabolite and agonist of vitamin D receptor (VDR), also known as calcitriol receptor. It regulates absorption of calcium from intestine, resorption of bone calcium and calcium excretion via kidneys. This compound also controls cell cycle, promotes cell differentiation, triggers apoptosis and acts as anti-inflammatory factor within the tumor microenvironment. It has anti-proliferative effects in malignant epithelial cells and in tumour-derived endothelial cells (TDEC). Also, it is a potent inhibitor of retinal neoangiogenesis in vitro.</p>Formula:C27H44O3Purity:Min. 98 Area-%Color and Shape:White Off-White PowderMolecular weight:416.32905H-Ser-Phe-Asn-Gly-Gly-Pro-NH2
CAS:<p>H-Ser-Phe-Asn-Gly-Gly-Pro-NH2 is a peptide that activates Protease Activated Receptor 1 (PAR1) and Protease Activated Receptor 3 (PAR3). It also has been shown to decrease blood pressure in mice, inhibit coagulation, and increase the breakdown of fibrin clots. This product is a ligand for PAR1 and PAR3. It has been shown to activate these receptors by binding to them through its amino acid sequence. HSPNP binds to proteases that cleave the peptide from the receptor, which leads to activation of the receptor. HSPNP can also bind to PAR3 and PAR4.</p>Formula:C25H36N8O8Purity:Min. 95%Molecular weight:576.61 g/molIle-Gln-Gly-Asn-Val-Thr-Ser-Ile-His-Ser-Leu-Leu-As
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C67H111N19O25Molecular weight:1,582.71 g/molH-ELTR-NH2
<p>Peptide H-ELTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QAKEVLNGEMEKSRRYGAPS-OH
<p>H-QAKEVLNGEMEKSRRYGAPS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QAKEVLNGEMEKSRRYGAPS-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QAKEVLNGEMEKSRRYGAPS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QAKEVLNGEMEKSRRYGAPS-OH at the technical inquiry form on this page</p>Purity:Min. 95%Yersinia pestis V Antigen antibody
<p>Mouse monoclonal Yersinia pestis V Antigen antibody</p>Purity:Min. 95%CMV antibody
<p>The CMV antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and neutralizes the cytomegalovirus (CMV), a common viral infection that can affect mesenchymal stem cells. This antibody has been extensively studied and proven to be effective in inhibiting CMV replication by blocking the interaction between the virus and cholinergic receptors on host cells. Additionally, it has shown to inhibit the activation of β-catenin, a key signaling molecule involved in cell proliferation and differentiation. The CMV antibody can be used in various bioassays to detect and quantify CMV infection, as well as to study the role of CMV in different cellular processes. Its high specificity and potency make it an essential tool for researchers studying CMV-related diseases and exploring potential therapeutic interventions.</p>Purity:Min. 95%H-NLHQPPLR^-OH
<p>Peptide H-NLHQPPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Anti-mGluR2 antibody - 1mg/mL
<p>Metabotropic glutamate receptors (mGluRs) are G protein-coupled receptors that have been divided into three groups based on sequence, putative signal transduction mechanisms, and pharmacologic properties. mGluR2 is a group II receptor, receptors in this group are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivity.</p>H-SRVEI-NH2
<p>Peptide H-SRVEI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Apraclonidine HCl - Bio-X ™
CAS:<p>Apraclonidine is an alpha adrenoreceptor agonist that is used in the treatment of raised intraocular pressure. This drug’s mechanism of action is not fully understood however, animal and human studies suggested that Apraclonidine reduces aqueous humor production and increases uveoscleral outflow.</p>Formula:C9H10Cl2N4•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:281.57 g/molLCBiot-FYWHCLDE-OH
<p>Peptide LCBiot-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Substance P (3-11)/Nona-Substance P
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C52H79N13O11SMolecular weight:1,094.35 g/molMobocertinib
CAS:<p>Mobocertinib is a small-molecule tyrosine kinase inhibitor, which is a targeted therapy derived from synthetic chemistry. It primarily exerts its effect by selectively inhibiting the activity of epidermal growth factor receptor (EGFR) with exon 20 insertion mutations. These mutations, which occur in the kinase domain of the EGFR, lead to aberrant activation of signaling pathways that promote oncogenic processes.</p>Formula:C32H39N7O4Purity:Min. 95%Color and Shape:PowderMolecular weight:585.7 g/molSIVmac239 - 41
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,677.9 g/molH-Ser-Leu-Ile-Gly-Lys-Val-OH
CAS:<p>H-Ser-Leu-Ile-Gly-Lys-Val-OH is a potent inhibitor of the enzyme soybean trypsin. It is a member of the class of chemical inhibitors that are active against enzymes that regulate cell signaling and inflammatory responses. H-Ser-Leu-Ile-Gly-Lys-Val-OH inhibits toll receptor signaling, which triggers an inflammatory response in cells. This compound has been shown to be effective in animal models for bowel disease and asthma. H Ser Leu Ile Gly Lys Val OH also has low potency, which may be due to its ability to form covalent bonds with other molecules, such as DNA polymerase.</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molLCBiot-HVPGGGSVQIVYKPVDLSKV-OH
<p>Peptide LCBiot-HVPGGGSVQIVYKPVDLSKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGYSSPGSPGTPGSR^-OH
<p>Peptide H-SGYSSPGSPGTPGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-ERQRRNKPKRSFFALRDQI-OH
<p>Ac-ERQRRNKPKRSFFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-ERQRRNKPKRSFFALRDQI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-ERQRRNKPKRSFFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-ERQRRNKPKRSFFALRDQI-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-KYSEEGDGPAQHAEQC-NH2
<p>Peptide Ac-KYSEEGDGPAQHAEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GENFTETDVK^-OH
<p>Peptide H-GENFTETDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLVTGLWGK^-OH
<p>Peptide H-SLVTGLWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Ala-Ala-Ala-pNA • HCl
CAS:<p>H-Ala-Ala-Ala-pNA • HCl is a porcine pancreatic elastase inhibitor. It is a chromogenic substrate that inhibits the proteolytic activity of elastase by binding to the active site and blocking its access to the peptide bond. H-Ala-Ala-Ala-pNA • HCl is used as an enzyme inhibitor in biochemistry and molecular biology research, and has been shown to inhibit enzymatic activity of human leukocyte elastase. The peptide is also a substrate for astacin, which cleaves it at the Cys residue.</p>Formula:C15H21N5O5•HClPurity:Min. 95%Molecular weight:387.83 g/molH-FNWYVDGVEVHNAKTKPR^-OH
<p>Peptide H-FNWYVDGVEVHNAKTKPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CLEDMPVDPDNEA-NH2
<p>Ac-CLEDMPVDPDNEA-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CLEDMPVDPDNEA-NH2 is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CLEDMPVDPDNEA-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CLEDMPVDPDNEA-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%H-FQTAAQR^-OH
<p>Peptide H-FQTAAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-QYIKANSKFIGITEL-OH
<p>Peptide Biot-QYIKANSKFIGITEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IYPTNGYTR^-OH
<p>Peptide H-IYPTNGYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IYLDMLNVYK^-OH
<p>Peptide H-IYLDMLNVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Z-Gln-Gly
CAS:<p>Z-Gln-Gly is a protected dipeptide, which is commonly used as an intermediate in peptide synthesis. It is derived from the amino acids glutamine and glycine, with the N-terminal glutamine being protected by a benzyloxycarbonyl (Z or Cbz) group. This protective group is essential for preventing undesirable reactions at the amine site during peptide chain elongation.The primary mode of action for Z-Gln-Gly involves its use in solid-phase peptide synthesis, where the Z-group safeguards the amine functionality. This protection allows for selective reactions at other sites of the molecule until the final deprotection step, facilitating the sequential addition of amino acids.Z-Gln-Gly is used predominantly in research and development within biochemical and pharmaceutical laboratories. Its applications are critical in the synthesis of longer peptide chains and peptide-based drugs, where precision and control over the peptide structure are paramount for investigating biological processes and therapeutic functions.</p>Formula:C15H19N3O6Purity:Min. 95%Molecular weight:337.33 g/molH-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe-NH2
CAS:<p>H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe is a peptide that is activated by incubation with collagen. It has been shown to have an inhibitory effect on thrombin receptor and the activation of coagulation factors, which may be due to its ability to desensitize the receptor. HSLRAPAP can also be used in cancer therapy. In animal studies, it has been shown to inhibit tumor growth and metastasis. HSLRAPAP has also been shown to stimulate the production of platelets in animals, which may account for its antiplatelet properties.</p>Formula:C83H120F3N21O24Purity:Min. 95%Anti-Osteopontin antibody - 2mg/mL
<p>Osteopontin (OPN) is in the small integrin-binding ligand N-linked glycoprotein (SIBLING) family. Osteopontin is a secreted matricellular cytokine with an important role in bone mass regulation. OPN is involved in osteoclast attachment to the mineralised bone matrix. The regulation of OPN is linked to the development of several bone-related diseases, including osteoporosis, rheumatoid arthritis, and osteosarcoma. It is a transformation-associated protein that binds to the integrin and CD44 cell membrane surface receptors. These receptors are correlated with biomineralisation, cell-mediated immunity, inflammation, fibrosis, as well as cell survival, tumorigenesis, and metastasis. OPN also has a role in cardiac health; acute increases can be protective, but chronic increases are linked to cardiovascular disease and other vascular diseases.</p>H-HYEGSTVPEK^-OH
<p>Peptide H-HYEGSTVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVQAFQFTDK-OH
<p>H-LVQAFQFTDK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LVQAFQFTDK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LVQAFQFTDK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LVQAFQFTDK-OH at the technical inquiry form on this page</p>Purity:Min. 95%E-64
CAS:<p>E-64 is a chemical inhibitor that binds to the ATP synthase in mitochondria, inhibiting oxidative phosphorylation. This inhibition of mitochondrial energy production leads to cell death by apoptosis. E-64 has been shown to inhibit tumor growth in vitro and in vivo by inducing autophagy and inhibiting cancer cell proliferation. E-64 has also been shown to have proteolytic activity against serum proteins, which may be due to its ability to bind to the phosphate groups of proteins.</p>Formula:C15H27N5O5H2OPurity:Min. 95%Molecular weight:366.42 g/molAnti-IL-11 antibody - 0.5mg/mL
<p>Interleukin-11 (IL-11) is a multifunctional haematopoietic cytokine implicated in several normal and pathological processes. It belongs to the interleukin-6 (IL-6) family of cytokines, which affect intracellular signalling pathways via interaction with the ubiquitously expressed signal-transducing receptor, gp130 and a non-signalling cytokine-specific receptor.</p>H-CREKA-OH
<p>Peptide H-CREKA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C23H43N9O8SMolecular weight:605.72 g/molAc-AGGKAGKDSGKAKTKAVSR-OH
<p>Peptide Ac-AGGKAGKDSGKAKTKAVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STDYGIFQINSR^-OH
<p>Peptide H-STDYGIFQINSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 196
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,831.2 g/molH-K^VLEHVVRV-OH
<p>Peptide H-K^VLEHVVRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-TSYQVYSK-OH
<p>Peptide LCBiot-TSYQVYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KDGIVNGVKA-NH2
<p>Peptide Ac-KDGIVNGVKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Prasugrel - Bio-X ™
CAS:<p>Prasugrel is a thienopyridine prodrug that inhibits the enzyme ADP-dependent P2Y purinergic receptor. Prasugrel inhibits platelet aggregation and the formation of blood clots by blocking the conversion of ADP to ATP on the surface of platelets, thus preventing the release of serotonin from platelets. The reaction products formed by prasugrel are similar to those formed by clopidogrel and include hydrogen sulfate ions and a thiol-containing metabolite. It has also been shown to have potent cytotoxic activity against melanoma cells and anti-inflammatory properties. <br>Prasugrel is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>Formula:C20H20FNO3SPurity:(%) Min. 95%Molecular weight:373.44 g/molHXB2 gag NO-100/aa397 - 411
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,752 g/molH-SVILLGR^-OH
<p>Peptide H-SVILLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ-OH
<p>Peptide H-ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SmMLCKp, Smooth-Muscle Myosin Light-Chain Kinase (796-815), Calmodulin Binding
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C98H168N38O25Molecular weight:2,278.7 g/molH-GLTLHLK^-OH
<p>Peptide H-GLTLHLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MQQVEASLQPETLR^-OH
<p>Peptide H-MQQVEASLQPETLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSLVGIGGQDLNEGNR^-OH
<p>Peptide H-FSLVGIGGQDLNEGNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Liraglutide
CAS:<p>Liraglutide is a glucagon-like peptide-1 analog that has been shown to be an effective treatment for obesity. Liraglutide targets the adipose tissue and reduces the amount of glucose in the blood by increasing insulin sensitivity, lowering food intake, and reducing appetite. In addition, Liraglutide has been shown to suppress postprandial hyperglycemia and lower plasma glucose levels in patients with type 2 diabetes mellitus. Liraglutide also inhibits neuronal death induced by apoptotic stimuli, which may have potential use as a model system for neurodegenerative diseases such as Parkinson's disease. Liraglutide has also been shown to be an effective therapy for infectious diseases including Crohn's disease and ulcerative colitis. This drug has shown some effectiveness against atherosclerosis in animal models by inducing apoptosis in macrophages that are associated with lesions. It has also been found to have beneficial</p>Formula:C17H265N43O51Purity:Min. 95%Molecular weight:3,751.29 g/molAc-GTLTVTSTLPC-NH2
<p>Ac-GTLTVTSTLPC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-GTLTVTSTLPC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-GTLTVTSTLPC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-GTLTVTSTLPC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%H-NIETIINTFHQYSVK^-OH
<p>Peptide H-NIETIINTFHQYSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>α Actinin protein
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been proven through extensive testing using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>Purity:Min. 95%HXB2 gag NO-96
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,827.2 g/molRisdiplam
CAS:<p>Modifier of the SMN2 gene splicing</p>Formula:C22H23N7OPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:401.46 g/molHIV - 1 MN ENV - 137
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,667 g/molALX 40-4C Trifluoroacetate
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C58H114F3N37O12Molecular weight:1,464.74 g/molCONSENSUS B Tat - 01
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,788.1 g/molH-FALNAANAR^-OH
<p>Peptide H-FALNAANAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQEKVSPLTLLKLGN-NH2
<p>Peptide H-NQEKVSPLTLLKLGN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ANA Positive Human Serum
<p>ANA Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ANA Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-GAYPLSIEPIGV^R-OH
<p>Peptide H-GAYPLSIEPIGV^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CONSENSUS B Tat -03
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,666.9 g/molH-SIINF^EKL-OH
<p>Peptide H-SIINF^EKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FTLSVDR^-OH
<p>Peptide H-FTLSVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-SLYSSSPGGAYC-NH2
<p>Peptide Biot-SLYSSSPGGAYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TRAP-5 amide
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C30H51N9O6Molecular weight:633.79 g/molH-EDHLFR^-OH
<p>Peptide H-EDHLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-QRFVTGHFGGLYPANG-OH
<p>Peptide LCBiot-QRFVTGHFGGLYPANG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IL^DTAGKEEY-OH
<p>Peptide H-IL^DTAGKEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-D-Trp-OH
CAS:<p>Boc-D-Trp-OH is a trisubstituted, enantiomerically pure, excitatory amino acid. It has been shown to stimulate the release of neurotransmitters in the central nervous system and to have potent antitumor activity. Boc-D-Trp-OH is an unsaturated ketone that can be used as a building block for peptide synthesis. The disulfide bond present in this molecule may be reduced by the addition of DTT or DTE. This compound has also been shown to have cardiac hypertrophy inhibiting effects, due to its ability to inhibit PDE5 enzyme activity.</p>Formula:C16H20N2O4Purity:Min. 95%Molecular weight:304.34 g/molAzasetron hydrochloride
CAS:<p>Serotonin 5-HT3 receptor antagonist; anti-emetic</p>Formula:C17H20ClN3O3•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:386.27 g/molMelogliptin
CAS:<p>Melogliptin is a synthetic drug that inhibits the enzyme dipeptidyl peptidase-4 (DPP-4), which regulates the production of insulin. It has a potent inhibitory effect on DPP-IV, which is an enzyme that breaks down the incretin hormones glucagon-like peptide 1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP). Melogliptin has been shown to reduce blood sugar levels in patients with type 2 diabetes mellitus. The drug is also an analog of pioglitazone, a thiazolidinedione antidiabetic agent. Melogliptin binds to fatty acid receptors in cells and inhibits the activity of serine proteases, such as DPP-IV, which are involved in regulating insulin resistance.</p>Formula:C15H21FN6OPurity:Min. 95%Molecular weight:320.37 g/molH-RPTLR^-OH
<p>Peptide H-RPTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Gly-Arg-Gly-Arg-Gly-Arg-Gly-Arg-Gly-Arg-Gly-Arg-Gl
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C160H302N100O41Molecular weight:4,282.76 g/molUrotensin II (Human) Antiserum
<p>Urotensin II (Human) Antiserum is a research tool for the study of ion channels and receptors. Urotensin II is a peptide that interacts with the G-protein coupled receptor, UTA1. The purified antibody can be used to detect the presence of this peptide in a sample by Western blotting or ELISA. This product is supplied in high purity and has not been shown to react with any other protein.</p>Purity:Min. 95%Fmoc-Pro-OH
CAS:<p>Fmoc-Pro-OH is a peptide that contains the Fmoc protecting group. It is used in the synthesis of peptides and has been shown to be effective against microbial infections with marine sponges. The synthesis of this compound can be carried out on an on-line automated peptide synthesizer. The Fmoc protecting group is removed by treatment with trifluoroacetic acid (TFA) in dichloromethane, which leaves the side chain unprotected. This compound has a high binding affinity for the receptor site of fibrinogen and can potentially inhibit the growth of bacteria that cause bacterial infection, such as Staphylococcus aureus and Pseudomonas aeruginosa.<br>Fmoc-Pro-OH can also be used to synthesize other functional groups such as sulfamoyl groups or acetonitrile groups, depending on the desired outcome.</p>Formula:C20H19NO4Purity:Min. 98 Area-%Molecular weight:337.38 g/molBoc-D-Ala-OH
CAS:<p>Boc-D-Ala-OH is a chiral amino acid that can be used in the synthesis of peptides. Boc-D-Ala-OH is a building block for the synthesis of amino acids, and it can also be used as a ligand to form metal complexes. This product has been shown to be effective in reducing optical activity through chemoenzymatic reduction processes. Boc-D-Ala-OH has also been shown to be hydrolyzed by various enzymes, including alcohols and acrylates.</p>Formula:C8H15NO4Purity:Min. 95%Molecular weight:189.21 g/molH-TLWPILALI-OH
<p>H-TLWPILALI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TLWPILALI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TLWPILALI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TLWPILALI-OH at the technical inquiry form on this page</p>Purity:Min. 95%[Lys(Ac)9]-Histone H3 (1-21), H3K9(Ac)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C96H174N36O29Molecular weight:2,296.7 g/molH2N-Gly-Ala-Val-Gly-Val-Gly-Lys-Ser-Ala-Leu-COOH
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C37H67N11O12Molecular weight:857.99 g/molTAPI-1
CAS:<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>Formula:C26H37N5O5Purity:Min. 95%Molecular weight:499.60 g/molTroponin I antibody (Cardiac)
<p>Troponin I antibody (cardiac) was raised in mouse using human cardiac troponin I (N-Terminal) as the immunogen.</p>Purity:Min. 95%Vesicular Stomatitis Virus peptide
<p>Peptide Vesicular Stomatitis Virus peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C44H66N12O12Molecular weight:955.09 g/molAc-AAVDGRDYHFVTSSSSC-NH2
<p>Ac-AAVDGRDYHFVTSSSSC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-AAVDGRDYHFVTSSSSC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-AAVDGRDYHFVTSSSSC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-AAVDGRDYHFVTSSSSC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Arg(NO2)-OH
CAS:<p>Boc-Arg(NO2)-OH is an activated molecule that is used as an anticoagulant. It inhibits the serine protease, which has an inhibitory effect on heparin-induced thrombocytopenia, and also inhibits platelet aggregation. Boc-Arg(NO2)-OH has been shown to have a potent inhibition of the enzyme that converts prothrombin into thrombin. This effect can be reversed by adding protamine sulfate. The clinical data suggest that this drug may be beneficial for patients with severe or life-threatening conditions who are taking heparin therapy or undergoing surgery and need anticoagulation. The prognosis of this drug is unclear, but it appears to be safe when administered in conjunction with other medications such as aspirin and warfarin.</p>Formula:C10H19NO4Purity:Min. 95%Molecular weight:319.32 g/molH-NGGLEVWLPR-OH
<p>H-NGGLEVWLPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NGGLEVWLPR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NGGLEVWLPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NGGLEVWLPR-OH at the technical inquiry form on this page</p>Purity:Min. 95%Biot-EKKYFAATQFEPLAARL-OH
<p>Peptide Biot-EKKYFAATQFEPLAARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>FMRF-like neuropeptide flp-7-2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C55H93N19O15S2Molecular weight:1,324.5 g/molH-DSGSPNPAR^-OH
<p>Peptide H-DSGSPNPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>IL2 protein (Mouse)
<p>Region of IL2 protein corresponding to amino acids PTSSSTSSST AEAQQQQQQQ QQQQQHLEQL LMDLQELLSR MENYRNLKLP RMLTFKFYLP KQATELKDLQ CLEDELGPLR HVLDLTQSKS FQLEDAENFI SNIRVTVVKL KGSDNTFECQ FDDESATVVD FLRRWIAFCQ SIISTSPQ.</p>Purity:Min. 95%K-252A
CAS:<p>K-252A is an antimicrobial agent that inhibits the growth of bacteria. It binds to the response element in the promoter region of genes and blocks gene transcription, thereby preventing protein synthesis. K-252A has been shown to inhibit the growth of bacteria that are resistant to many other antibiotics, including ampicillin, chloramphenicol, clindamycin, erythromycin, gentamicin and kanamycin. This drug also induces significant up-regulation of cyclic nucleotide phosphodiesterases (PDE) and cytosolic Ca2+ in vitro. K-252A has been shown to cause neuronal death in vitro by inhibiting axonal growth. K-252A also inhibits leukemia inhibitory factor (LIF) from binding to its receptor on mouse lymphocytes.</p>Formula:C27H21N3O5Purity:Min. 95%Molecular weight:467.49 g/molNY-ESO-1 (161-180)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-ESTLHLVLRLR^GG-hydrazide
<p>Peptide H-ESTLHLVLRLR^GG-hydrazide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-TESNKKFLPFQQFGRDIA-OH
<p>Peptide LCBiot-TESNKKFLPFQQFGRDIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLTSFLPAQLLR^-OH
<p>Peptide H-LLTSFLPAQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAAQNIIPASTGAAK-OH
<p>H-GAAQNIIPASTGAAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GAAQNIIPASTGAAK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GAAQNIIPASTGAAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GAAQNIIPASTGAAK-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-MSKQQPTQFINPETPGYVC-NH2
<p>Peptide H-MSKQQPTQFINPETPGYVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GYAGTLQSL-NH2
<p>Peptide Ac-GYAGTLQSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTVISVNPSTK^-OH
<p>Peptide H-NTVISVNPSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>IA-2 797-805 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-FTQAGSEVSALLGR^-OH
<p>Peptide H-FTQAGSEVSALLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mosapride citrate - Bio-X ™
CAS:<p>Mosapride is a prokinetic 5-HT4 receptor agonist used to increase colon and gastric mobility. This drug allows the release of acetylcholine from enteric cholinergic neurons. Mosapride has also shown to provide relief when treating patients with constipation- type irritable bowel syndrome as it prevents abdominal pain.</p>Formula:C27H33ClFN3O10Purity:Min. 95%Color and Shape:PowderMolecular weight:614.02 g/molH-TDPGVFIGVK^-OH
<p>Peptide H-TDPGVFIGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amitryptylline hydrochloride - Bio-X ™
CAS:Controlled Product<p>Amitryptylline is a tricyclic antidepressant that is used to treat depression and to relieve depression associated anxiety. Although its mechanism is not fully understood, it is suggested that this drug inhibits norepinephrine and serotonin thus increasing their concentrations at the synaptic clefts. Additionally, Amitryptylline has shown to have anticholinergic properties.</p>Formula:C20H23N•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:313.86 g/molH-FL^DEFMEGV-OH
<p>Peptide H-FL^DEFMEGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Imiquimod - Bio-X ™
CAS:<p>Imiquimod is a toll-like receptor 7 agonist drug that is used for the treatment of genital warts, basal cell carcinoma and condyloma acuminata. This drug works by relieving and controlling wart production. Studies in mice have shown that this drug may induce cytokines such as interleukins. Imiquimod helps to increase apoptosis of diseased tissues and an infiltration of lymphocytes into tumor lesions.</p>Formula:C14H16N4Purity:Min. 95%Color and Shape:PowderMolecular weight:240.3 g/molFmoc-Lys(Fmoc)-OH
CAS:<p>Fmoc-Lys(Fmoc)-OH is an antibacterial agent that can be synthesized from a number of precursors. It has been shown to inhibit the uptake of mannose by staphylococcus cells and its subsequent use in the synthesis of bacterial cell walls. Fmoc-Lys(Fmoc)-OH also inhibits the growth of viruses, such as HIV, and human immunodeficiency virus type 1 (HIV-1), by binding to mannose receptors on the surface of macrophage-like cells. Intramolecular hydrogen bonds stabilise this complex, which prevents it from breaking down. This allows Fmoc-Lys(Fmoc)-OH to remain in the body for a longer period of time than other antibiotics that are broken down by enzymes. Fmoc-Lys(Fmoc)-OH has also been shown to be an effective antibacterial agent against Staphylococcus a</p>Formula:C36H34N2O6Purity:Min. 98.0 Area-%Molecular weight:590.67 g/molAc-CKGPNVAAIVGGTVV-NH2
<p>Ac-CKGPNVAAIVGGTVV-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CKGPNVAAIVGGTVV-NH2 is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CKGPNVAAIVGGTVV-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CKGPNVAAIVGGTVV-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%H-MVTAVASALSSR^-OH
<p>Peptide H-MVTAVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Anti-Jak2 antibody R1G - 0.4mg/mL
<p>Janus kinase-2 (JAK2) is a non-receptor tyrosine kinase implicated in signalling via members of the type II cytokine receptor family (such as interferon receptors), the GM-CSF receptor family (IL-3R, IL-5R and GM-CSF-R), the gp130 receptor family (e.g., IL-6R), and the single chain receptors (e.g. Epo-R, Tpo-R, GH-R, PRL-R). The JAK/signal transducer and activator of transcription (STAT) pathway is a key cellular pathway which is involved in immunity, cell division, cell death and tumour formation. The JAK/STAT pathway is activated by leptin and the leptin receptor and results in phosphorylation of STAT3 and its translocation to the nucleus where it activates the transcription of various target genes.Mutations and gene fusions involving JAK2 have been implicated in polycythemia vera, essential thrombocythemia, and myelofibrosis as well as other myeloproliferative disorders and leukaemia.</p>H-VTVMGGFK^-OH
<p>Peptide H-VTVMGGFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-Asp(OBzl)-OH
CAS:<p>Boc-Asp(OBzl)-OH is a cyclic peptide analog with an amino acid sequence homologous to the natural substrate of soybean trypsin. It has been shown to inhibit thrombin by intramolecular hydrogen bonding. Boc-Asp(OBzl)-OH has also been used as a prodrug for the synthesis of other analogs, such as Asp(OBzl)-Bz-NH2, which inhibits human immunodeficiency virus type 1 (HIV-1) protease. This inhibitor has been found to be effective in vitro and in vivo against HIV-1 strains that are resistant to other protease inhibitors, such as saquinavir, indinavir, and ritonavir.</p>Formula:C16H21NO6Purity:Min. 95%Molecular weight:323.34 g/molH-YTFELSR^-OH
<p>Peptide H-YTFELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Glepaglutide
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C197H325N53O55Molecular weight:4,316.01 g/molH-TAVEQAAAELGDTGR^-OH
<p>Peptide H-TAVEQAAAELGDTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTQPIMDTDGSYFVYSK^-OH
<p>Peptide H-NTQPIMDTDGSYFVYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-KKRYDREFLLGF-OH
<p>Peptide LCBiot-KKRYDREFLLGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IEVASSVK-OH
<p>H-IEVASSVK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IEVASSVK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IEVASSVK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IEVASSVK-OH at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Trp(Boc)-OH
CAS:<p>Fmoc-Trp(Boc)-OH is a building block for the synthesis of peptides and other bioactive molecules. It is used in the synthesis of daptomycin, an antibiotic that is used to treat bacterial infections caused by methicillin-resistant Staphylococcus aureus (MRSA). Fmoc-Trp(Boc)-OH is also used as a synthon in the production of natural products such as kynurenine, which has been shown to have anti-cancer properties.</p>Formula:C31H30N2O6Purity:Min. 95%Molecular weight:526.59 g/molSIVmac239 - 100
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,708.9 g/molAc-LYDRLASTVI-NH2
<p>Peptide Ac-LYDRLASTVI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Eflornithine HCl monohydrate
CAS:<p>Inhibitor of ornithine decarboxylase</p>Formula:C6H12F2N2O2·HCl·H2OPurity:(Hplc) Min. 98%Color and Shape:White Off-White PowderMolecular weight:236.64 g/molH-GFPSVLR^-OH
<p>Peptide H-GFPSVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FMAEATPML-OH
<p>H-FMAEATPML-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FMAEATPML-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FMAEATPML-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FMAEATPML-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-YTFAFGGNYDR^-OH
<p>Peptide H-YTFAFGGNYDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QNQYVHISSSPQNTGRTASP-OH
<p>H-QNQYVHISSSPQNTGRTASP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QNQYVHISSSPQNTGRTASP-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QNQYVHISSSPQNTGRTASP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QNQYVHISSSPQNTGRTASP-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-CSAQPKLLQMEKRPSL-NH2
<p>Ac-CSAQPKLLQMEKRPSL-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CSAQPKLLQMEKRPSL-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CSAQPKLLQMEKRPSL-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CSAQPKLLQMEKRPSL-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Melittin
CAS:<p>Melittin is a major component of bee venom that has been shown to have antibacterial efficacy against gram-positive bacteria, including methicillin-resistant Staphylococcus aureus. It also demonstrates anti-viral activity, for example it inhibits human immunodeficiency virus and herpes simplex virus. Furthermore it can be used in the treatment of inflammatory-related illnesses due to it inhibiting the phospholipase A2 enzyme. In addition to this Melittin's abaility to inhibit inflammatory mediators such as nitric oxide and cyclooxygenase-2 aids in the treatment of inflammatory diseases. As a result of Melittin having the capabilities of attacking lipid membranes and it surpressing COX-2 mRNA expression it can also be used in the treatment of tumours. The bound form of melittin is not toxic to mammalian cells, but it is toxic when it is released into the cell cytoplasm. Melittin has been shown to inhibit transcriptional regulation and locomotor activity in mice. This may be due to its ability to bind DNA, preventing transcription and translation of certain genes. Lastly It has strong hemolytic activity and been seen to increase insulin secretion via depolarization of pancreatic beta-cells. Melittin is a diverse peptide which can be used ina whole spectrum of research and therapeutic areas.</p>Formula:C131H229N39O31Purity:Min. 95%Molecular weight:2,846.47 g/molAc-TATKSGSTTKNR-NH2
<p>Peptide Ac-TATKSGSTTKNR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VV^GADGVGK^-OH
<p>Peptide H-VV^GADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amastatin
CAS:<p>Amastatin is a synthetic product that inhibits peptidases. It is an inhibitor of the protease enzyme and can be used in the treatment of bladder infections caused by Chlamydia parvum. Amastatin has also been shown to inhibit Aminopeptidase, which is an enzyme that cleaves amino acids from proteins, thereby inhibiting protein synthesis. Amastatin has been shown to have an inhibitory effect on proteases in the striatal membranes of rats and may be useful in treating neurodegenerative disorders such as Parkinson's disease.</p>Formula:C21H38N4O8Purity:Min. 95%Molecular weight:474.55 g/molH-DLQNFLK^-OH
<p>Peptide H-DLQNFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Gly-Arg-Gly-Asp-Asn-Pro-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Asn-Pro-OH is a peptide that is used in the detection of damaged tissue. This peptide has been shown to have significant cytotoxicity, with an EC50 at around 100 nM. H-Gly-Arg-Gly-Asp-Asn-Pro-OH has also been shown to be reactive with integrin receptors, which are found on the surface of pluripotent cells and are involved in cell adhesion. The fluorescence intensity of this peptide increases when it binds to the integrin receptor, indicating that it may be useful for measuring changes in cellular calcium levels.</p>Formula:C23H38N10O10Purity:Min. 95%Molecular weight:614.62 g/molH-MVLQNSGKFRAESRGDC-NH2
<p>Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>S100 Beta antibody
<p>The S100 Beta antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the S100 Beta protein, which is involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying S100 Beta levels in biological samples.<br><br>One of the key applications of the S100 Beta antibody is its use in assays to measure the activity of urokinase plasminogen activator (uPA). By binding to S100 Beta, this antibody inhibits the interaction between uPA and its target molecule, thus preventing the activation of uPA. This inhibition leads to a decrease in cytotoxic effects associated with uPA activity.<br><br>Furthermore, the S100 Beta antibody has been utilized in studies investigating adipose tissue biology. It has shown promising results in identifying and characterizing specific markers expressed by adipocytes. By targeting these markers, researchers can gain valuable insights into adipose tissue function and metabolism.<br><br>In addition to its role in research, this</p>H-GIIFNNGPTWK^-OH
<p>Peptide H-GIIFNNGPTWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Regaloside D
CAS:<p>Regaloside D is a natural product derived from plant sources, specifically isolated from certain species known for their bioactive properties. It functions as a glycoside, a compound in which a sugar is bound to a non-carbohydrate moiety, potentially influencing a variety of cellular processes through its interaction with specific molecular targets.</p>Formula:C18H24O10Purity:Min. 95%Color and Shape:PowderMolecular weight:400.38 g/molFmoc-Ser(tBu)-Gly-OH
CAS:<p>Fmoc-Ser(tBu)-Gly-OH is a building block for the synthesis of dipeptides. It contains a free amino group and can be used to synthesize peptides containing serine and glycine. This reagent can also be used in the synthesis of other dipeptides, such as Fmoc-Leu-OH, Fmoc-Phe-OH, and Fmoc-Ile-OH.</p>Formula:C24H28N2O6Purity:Min. 95%Molecular weight:440.49 g/molH-Met-Asp-OH
CAS:<p>H-Met-Asp-OH is a synthetic formyl peptide that was designed to be hydrolyzed by proteolytic enzymes. It has been shown to be able to inhibit the formation of β-amyloid, which is associated with Alzheimer's disease. H-Met-Asp-OH also has been shown to have physicochemical properties similar to aspirin, and can be used as an antiplatelet agent. In addition, it has been shown to act as a catalase inhibitor in vitro and may have some therapeutic potential for the treatment of diabetes mellitus type 2.</p>Formula:C9H16N2O5SPurity:Min. 95%Color and Shape:White PowderMolecular weight:264.3 g/molH-LPDATPTELAK^-OH
<p>Peptide H-LPDATPTELAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPPRPRGRRQKPPGVWPA-OH
<p>H-FPPRPRGRRQKPPGVWPA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FPPRPRGRRQKPPGVWPA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FPPRPRGRRQKPPGVWPA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FPPRPRGRRQKPPGVWPA-OH at the technical inquiry form on this page</p>Purity:Min. 95%Des-Acyl Ghrelin (Rat)
CAS:<p>Des-Acyl Ghrelin (Rat) is a Des-Octanoylated Ghrelin product available in the Trifluoroacetate Salt form and as a 0.1mg vial. Ghrelin is a peptide horone which plays a role in regulating energy balance, stimulating appetite, nutrient sensing and meal initiation. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.</p>Formula:C139H231N45O41Purity:Min. 95%Molecular weight:3,188.6 g/molMouse anti Human IgM antibody
<p>Mouse anti Human IgM antibody was raised in Mouse using ChromPure Human IgM (myeloma), whole molecule as the immunogen.</p>H-VEPQKFAEELIHRLAAVQ-OH
<p>H-VEPQKFAEELIHRLAAVQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VEPQKFAEELIHRLAAVQ-OH is provided at greater that >75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VEPQKFAEELIHRLAAVQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VEPQKFAEELIHRLAAVQ-OH at the technical inquiry form on this page</p>Purity:Min. 95%Caloxin 2A1
CAS:<p>Caloxin 2A1 is a peptide that has been shown to activate the receptor for bradykinin, a peptide hormone that causes vasodilation. The activation of this receptor by Caloxin 2A1 leads to the opening of ion channels in the cell membrane, which causes an influx of calcium ions into the cell. This influx activates enzymes that break down proteins and increases the permeability of blood vessels. Caloxin 2A1 also inhibits ligand-induced activation of phospholipase C. Caloxin 2A1 binds to an antibody against bradykinin, which can be used as a research tool or as a means to measure levels of bradykinin in blood plasma.<br>Caloxin 2A1 has a molecular weight of 543 g/mol and CAS number 350670-85-8.</p>Formula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.5 g/molFmoc-Asn(Trt)-OH
CAS:<p>Fmoc-L-Asn(Trt)-OH is an Fmoc-protected amino acid with a free amine group. It is used as a building block for peptide synthesis and can be used in the production of polymeric materials for drug delivery. The Fmoc-protected amino acids are stable, but can be deprotected by treatment with trifluoroacetic acid or other strong acid. They are also soluble in organic solvents, such as dimethylformamide and DMF, which makes them useful for peptide synthesis. This product has minimal activity.BR><br>BR><br>BR></p>Formula:C38H32N2O5Purity:Min. 98.0 Area-%Molecular weight:596.69 g/molCharybdotoxin
CAS:<p>Charybdotoxin is a potent and selective ion channel inhibitor. It is a peptide that binds to the receptor site of the potassium channels that are found in nerve cells, blocking their activation. Charybdotoxin has also been shown to inhibit the activity of ligand-gated ion channels, such as acetylcholine receptors. This toxin has been used in research as a tool for studying protein interactions and has also been used in pharmacology as an experimental drug for treating hypertension.</p>Formula:C176H277N57O55S7Purity:Min. 95%Molecular weight:4,295.9 g/molTeduglutide
CAS:<p>Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.<br>One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD</p>Formula:C164H252N44O55SPurity:Min. 95%Molecular weight:3,752.16 g/mol(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu
CAS:<p>(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu is a secretase inhibitor that inhibits the enzyme that cleaves amyloid precursor protein (APP) to release beta-amyloid. It has been shown to prevent the formation of plaques in the brain and may be used to treat Alzheimer's disease. (3,5-Difluorophenylacetyl)-Ala-Phg-OtBu has also been shown to inhibit the production of tumor necrosis factor alpha (TNFα), which is involved in inflammation and carcinogenesis. The drug has been shown to reduce myocardial infarct size by preventing cardiac cell death and reducing inflammation following a heart attack. It is also active against multiple types of cancer cells, including carcinoma cell lines and multidrug resistant cells.</p>Formula:C23H26N2O4F2Purity:Min. 95%Molecular weight:432.47 g/molH-TTEPVSELLK^-OH
<p>Peptide H-TTEPVSELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Kisspeptin-10 (Human) / Metastin (Human, 45-54)
CAS:<p>Metastin is a peptide that activates the Kisspeptin receptor. It has been shown to inhibit protein interactions, activate ligands and receptors, and act as a research tool in cell biology. Metastin is an inhibitor of the G-protein coupled receptor, KISS1R. Metastin has been shown to activate the LGR5 receptor.</p>Formula:C63H83N17O14Purity:Min. 95%Molecular weight:1,302.4 g/molGlutaryl-Gly-Gly-Phe-AMC
CAS:<p>Glutaryl-Gly-Gly-Phe-AMC is a proteolytic peptide which is used in the study of the proteasome. It has been shown to have affinity for the proteasome, and can be used as a monoclonal antibody for both immunohistochemical analysis and two-dimensional electrophoresis. The peptide was sequenced and found to have no homology to any known protein or peptide. Glutaryl-Gly-Gly-Phe-AMC has been shown to bind specifically to β amyloid (Aβ) subunits in cell homogenates and cytosol, as well as nuclei in tissue sections from AD brain. In addition, it has been shown that this peptide can be fluorescently labeled with Alexa Fluor 488 or 594 dye for use in microscopy studies.</p>Formula:C28H30N4O8Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:550.56 g/molH-HEVKIKHFSPY-OH
<p>H-HEVKIKHFSPY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HEVKIKHFSPY-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HEVKIKHFSPY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HEVKIKHFSPY-OH at the technical inquiry form on this page</p>Purity:Min. 95%2-Furoyl-LIGRLO-amide acetate salt
CAS:<p>2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn-NH2 is a synthetic peptide that binds to the 5HT3 receptor. It has been shown to have an effect on locomotor activity and growth factor secretion in wild type mice and cell culture, as well as binding to acetylcholine receptors in C57/BL6 mice. 2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn was synthesized by the reaction of furoic acid with L -alanine, L -glycine, L -arginine and L -ornithine. The product is a white powder.</p>Formula:C36H63N11O8Purity:Min. 95%Molecular weight:777.96 g/mol5TAMRA-QEPEPPEPFEYIDD-OH
<p>Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>For-Met-Leu-pNA
CAS:<p>For-Met-Leu-pNA is a synthetic peptide that can be used as a research tool for studying protein interactions. It has been shown to inhibit ion channels and may be useful in the treatment of epilepsy, especially in cases of drug resistant seizures. For-Met-Leu-pNA is also an inhibitor and can be used as an anticonvulsant.</p>Formula:C18H26N4O5SPurity:Min. 95%Molecular weight:410.5 g/molH-CQSTPLSPPPLTPK-OH
<p>H-CQSTPLSPPPLTPK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CQSTPLSPPPLTPK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CQSTPLSPPPLTPK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CQSTPLSPPPLTPK-OH at the technical inquiry form on this page</p>Purity:Min. 95%Poly-L-Lysine Hydrobromide
CAS:<p>Poly-L-Lysine Hydrobromide is a neurotrophic factor that is used to stimulate nerve growth in the peripheral nervous system. It has been shown to increase the production of nerve growth factor, which is important for neuronal development and regeneration. Poly-L-Lysine Hydrobromide also has biological properties against human erythrocytes, enabling it to bind to the erythrocyte membrane and subsequently cause hemolysis. This process is mediated by Toll-like receptors. The active form of this drug has been shown to have antiviral activity against HIV and other viruses in transfection experiments using cells from mice, as well as an ability to inhibit replication of herpes simplex virus type 1 (HSV-1) in a model system consisting of rat neurons grown on a polymer substrate. Poly-L-Lysine Hydrobromide can be cleaved into smaller pieces by enzymes such as DNase I or terminal transferases, forming polymers</p>Purity:Min. 95%Ac-Arg-Gly-Lys(Ac)-MCA
CAS:<p>Ac-Arg-Gly-Lys(Ac)-MCA is a peptide that is used as a histone deacetylase substrate. It is an enzyme substrate in the histone deacetylase reaction and it has been shown to inhibit the growth of many bacterial strains. Ac-Arg-Gly-Lys(Ac)-MCA has been shown to inhibit the growth of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa.</p>Formula:C28H40N8O7Purity:Min. 95%Molecular weight:600.68 g/molGSK 962040
CAS:Controlled Product<p>Agonist of motilin receptor</p>Formula:C25H33FN4OPurity:Min. 95%Color and Shape:PowderMolecular weight:424.55 g/molβ-Defensin-2 (Human) Antiserum
<p>β-defensin-2 Antiserum is a research tool that can be used to study the interactions of ion channels, receptor and ligand. It is likely to be used in pharmacology and protein interactions. β-defensin-2 Antiserum is purified and has an affinity for antibody proteins.</p>Purity:Min. 95%H-SGEATDGARPQAL^PEPMQESK^-OH
<p>Peptide H-SGEATDGARPQAL^PEPMQESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Carbimazole - Bio-X ™
CAS:<p>Carbimazole is an imidazole antithyroid agent that is used to treat hyperthyroidism. It reduces the production of diiodotyrosine and thyroxine, as well as the uptake and concentration of inorganic iodine by the thyroid. Once it has been converted to methimazole, the thyroid peroxidase enzyme is inhibited from coupling and iodinating the tyrosine residues on thyroglobulin therefore lowering the production of the thyroid hormones T3 and T4.</p>Formula:C7H10N2O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:186.23 g/molMyricetin 3-β-glucoside
CAS:<p>Myricetin 3-β-glucoside is a flavonoid glucoside, which is a naturally occurring compound found in various fruits, vegetables, and herbs such as Myrica rubra. As a derivative of myricetin, it belongs to the class of polyphenolic compounds known for their potent biological activities. The compound functions primarily as an antioxidant, scavenging free radicals and thereby protecting cellular components from oxidative damage. In this role, it interrupts oxidative stress pathways that contribute to cellular aging and degenerative diseases.</p>Formula:C21H20O13Purity:Min. 95%Color and Shape:PowderMolecular weight:480.4 g/molS-Rolipram
CAS:<p>Inhibitor of PDE4 enzyme; anti-inflammatory</p>Formula:C16H21NO3Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:275.34 g/molAc-GKLRGARYQPGAC-NH2
<p>Ac-GKLRGARYQPGAC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-GKLRGARYQPGAC-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-GKLRGARYQPGAC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-GKLRGARYQPGAC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Luteinizing Hormone β antibody
<p>Luteinizing hormone beta antibody was raised in mouse using human luteinizing hormone as the immunogen.</p>Purity:Min. 95%H-TFPGFFSPMLGEFVSETESR^-OH
<p>Peptide H-TFPGFFSPMLGEFVSETESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GCSF antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Its effectiveness has been extensively studied using advanced techniques such as patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>Fluorescent Brightener 119
CAS:<p>FluOrescent Brightener 119 is a fluorescent brightener that is stable in the presence of sulfate and UV light. It can be used to monitor the level of water in a pool by measuring the intensity of the fluorescence. FluOrescent Brightener 119 is soluble and can be used with x-ray films or cyclodextrin to produce a strong fluorescent effect. This chemical has a wavelength at 585 nm, which is visible to the human eye. It also emits light in the blue region at 475 nm, making it an ideal choice for optical brightening agents.</p>Purity:Min. 95%IGFBP4 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to be highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>Abz-Gly-Phe(NO2)-Pro-OH
CAS:<p>Abz-Gly-Phe(NO2)-Pro-OH is a peptide that has been shown to have antihypertensive activity. It also has radical scavenging properties, and it can be used as an amino acid composition marker. Abz-Gly-Phe(NO2)-Pro-OH has been shown to inhibit the growth of faecalis and subtilis, which are both Gram positive bacteria. The peptide has also been shown to have inhibitory properties against proteolytic enzymes from bovine casein, human serum and rat blood pressure.</p>Formula:C23H25N5O7Purity:Min. 95%Molecular weight:483.48 g/molH-Ala-Tyr-Pro-Gly-Lys-Phe-NH2
CAS:<p>H-Ala-Tyr-Pro-Gly-Lys-Phe-NH2 is a selective inhibitor of aminopeptidase N. It has been shown to inhibit neutrophil and leukocyte recruitment in rat peritonitis models, as well as to reduce the severity of carrageenan induced paw edema in rats. H-Ala-Tyr-Pro-Gly-Lys-Phe NH2 also inhibits the activation of platelets by aspirin and reduces their aggregation, which may be due to inhibition of PAR4.<br>PAR4 is a G protein coupled receptor that is activated by proteases such as thrombin and trypsin. Activation of PAR4 induces proinflammatory cytokines, leading to increased leukocyte recruitment and inflammation.</p>Formula:C34H48N8O7Purity:Min. 95%Molecular weight:680.80 g/molH-IGEVDVEQHTLAK^-OH
<p>Peptide H-IGEVDVEQHTLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Dabcyl-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Edans
CAS:<p>Dabcyl-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Edans is a bifunctional peptide that inhibits HIV protease. The peptide binds to the active site of the enzyme and blocks access to the catalytic triad, inhibiting its function. This peptide has been shown to inhibit viral life in human cells infected with HIV type 1 (HIV1), as well as virions, which are released into the bloodstream. Dabcyl is a small molecule inhibitor of HIV1 protease that also inhibits cellular proteases. It has been shown to inhibit viral life in human T cell lines (THP1) and other cells infected with HIV type 1 (HIV1).</p>Formula:C73H97N17O18SPurity:Min. 95%Molecular weight:1,532.75 g/molH-L^VAASQAALGL-OH
<p>Peptide H-L^VAASQAALGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SULT1B1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SULT1B1 antibody, catalog no. 70R-2607</p>Purity:Min. 95%Fmoc-11-aminoundecanoic acid
CAS:<p>Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.</p>Formula:C26H33NO4Purity:Min. 98.0 Area-%Molecular weight:423.56 g/molAc-DDKVAQSLC-NH2
<p>Ac-DDKVAQSLC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-DDKVAQSLC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-DDKVAQSLC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-DDKVAQSLC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Oxyma Pure®
CAS:<p>OxymaPure® is a hydrogen bond-based molecular probe that binds to the hydroxamic acid group of bacterial cell walls. It has been shown to have an antibacterial activity against Staphylococcus aureus and Escherichia coli. OxymaPure® is soluble in water, making it suitable for oral administration. The safety profile of OxymaPure® includes studies in rats, indicating that it does not cause any toxic effects at doses up to 2000 mg/kg body weight. OxymaPure® can be synthesized on a solid phase by using carbodiimides as reactive agents and linkers as additive materials. This process is relatively rapid and produces high yields of the desired product.</p>Formula:C5H6N2O3Purity:Min. 95%Molecular weight:142.12 g/molH-Gly-Tyr-Pro-Gly-Lys-Phe-NH2
CAS:<p>This is a synthetic peptide that mimics the endogenous human epidermal growth factor (EGF) and binds to the toll-like receptor. It has been shown to stimulate physiological function in experimental models of bowel disease and cardiac disease, as well as cancer tissues. The peptide also binds to the guanine nucleotide-binding protein, polymerase chain reaction, and inflammatory bowel disease genes. In vivo studies have confirmed that this peptide enhances the production of EGF in maternal blood and stimulates squamous carcinoma growth in an animal model.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.78 g/mol
