
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
3-(4-Fluorobenzoyl)propionic acid
CAS:<p>3-(4-Fluorobenzoyl)propionic acid (3FBP) is a novel, orally active dopamine D4 receptor agonist. 3FBP binds to the D4 receptor with high affinity and has been shown to have potent antinociceptive effects in CD-1 mice. The compound has also been shown to be effective in reducing locomotor activity in rats, as well as inducing motor impairment and catalepsy in mice. 3FBP does not produce any significant changes in striatal dopamine levels, suggesting that it may have a different mechanism of action than traditional dopaminergic drugs.</p>Formula:C10H9FO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:196.18 g/molAQEE-30 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H245N47O56Purity:Min. 95%Molecular weight:3,674.9 g/molω-Agatoxin IVa trifluoroacetate
CAS:<p>Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).</p>Formula:C217H360N68O60S10Purity:Min. 95%Molecular weight:5,202.26 g/molEthyl 2-(2-chloroethoxy)acetate
CAS:<p>Please enquire for more information about Ethyl 2-(2-chloroethoxy)acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H11ClO3Purity:Min. 95%Molecular weight:166.6 g/molTetrabutylammonium acetate
CAS:<p>Tetrabutylammonium acetate is a complex of tetrabutylammonium with the trifluoroacetate anion. It has been used as a reagent for the preparation of α-hydroxylated ketones, including natural products. Tetrabutylammonium acetate can be used in titration calorimetry to measure the heat evolved during the reaction between hydroxyl group and sodium salts. The heat released corresponds to the amount of water produced from this reaction. In this way, it can be determined whether or not a molecule contains an active hydrogen atom. Tetrabutylammonium acetate also reacts with reactive compounds such as dpp-iv inhibitors, forming a reactive intermediate that cannot be isolated due to its instability. This intermediate is detected by analytical methods such as plasma mass spectrometry or infrared spectroscopy. Tetrabutylammonium acetate also reacts with asymmetric synthesis, forming an intram</p>Formula:C16H36N•C2H3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:301.51 g/molNeuropeptide EI (human, mouse, rat) trifluoroacetate salt
CAS:<p>Neuropeptide EI is a cyclic peptide that has been shown to have receptor activity in the caudate putamen, as well as locomotor activity and metabolic rate. Neuropeptide EI has also been shown to inhibit lymphatic vessels and amide sequences in fat cells. It has been shown to have various biological functions, such as an anti-inflammatory agent, an analgesic, and a chemotherapeutic agent. It is active against cancer cells and autoimmune diseases, but is inactive against bacteria.</p>Formula:C63H98N16O23Purity:Min. 95%Molecular weight:1,447.55 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molACTH (1-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N21O20SPurity:Min. 95%Molecular weight:1,680.88 g/molBiotinyl-Neuropeptide W-23 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H197N37O30S2Purity:Min. 95%Molecular weight:2,810.31 g/molH-Lys-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N6O5Purity:Min. 95%Molecular weight:388.46 g/molLys-Thymic Factor trifluoroacetate salt
CAS:<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H68N14O17Purity:Min. 95%Molecular weight:1,005.04 g/molNeuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H135N25O24Purity:Min. 95%Molecular weight:1,915.16 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molThymosin α1 acetate
CAS:<p>Thymalfasin is a peptide that belongs to the thymosin family. It is a biocompatible polymer with a number of biomedical applications, including as a component in wound dressings and anti-adhesive agents. Thymalfasin has been shown to be effective at inhibiting the replication of influenza A virus, which may be due to its ability to bind to toll-like receptor 4 (TLR4). This drug also has antitumor properties and has been shown to stimulate the production of IL-2 receptor in human monocytes. Thymalfasin also inhibits the growth of cancer cells, such as HL60 cells, by blocking DNA synthesis. The molecular weight of this compound is approximately 20-30 kDa.</p>Formula:C129H215N33O55•(C2H4O2)xPurity:Min. 95%Molecular weight:3,108.28 g/molL(+)-2,3-Diaminopropionic acid HCl
CAS:<p>L(+)-2,3-Diaminopropionic acid HCl is a chiral modifier that is used in the separation of organic compounds. It has been shown to selectively interact with borate, sulfate, and hydroxyapatite. This interaction changes the physical properties of these substances by modifying their surface charge or adsorption capacity. L(+)-2,3-Diaminopropionic acid HCl has also been shown to be useful in diastereoselective reactions. The technique of elution can be used to isolate specific compounds from mixtures using this compound as a modifier. Hydrogen bonding groups and moieties on the functional group are important factors in the specificity of this interaction.END>></p>Formula:C3H8N2O2·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:140.57 g/molDermcidin-1L (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Dermcidin-1L (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C210H359N57O71Purity:Min. 95%Molecular weight:4,818.44 g/molHepcidin-1 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Hepcidin-1 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H169N31O35S8Purity:Min. 95%Molecular weight:2,754.25 g/molβ-Casomorphin (1-4) (bovine) acetate salt
CAS:<p>Beta-Casomorphin (1-4) is a tetrapeptide that is derived from the amino acid sequence of bovine beta-casein. It inhibits the binding of opioid receptors and has been shown to have an inhibitory effect on muscle activity. Beta-Casomorphin (1-4) has also been shown to have a stabilizing effect on the genotype, which may be due to its ability to bind to DNA. Beta-Casomorphin (1-4) is detectable in urine and can be used as a marker for assessing the effectiveness of treatments in infants with Colic.</p>Formula:C28H34N4O6Purity:Min. 95%Molecular weight:522.59 g/molXenopsin-Related Peptide 1 (XP-1) trifluoroacetate salt
CAS:<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>Formula:C51H79N15O9Purity:Min. 95%Molecular weight:1,046.27 g/mol2-Phenylpropionic acid
CAS:<p>2-Phenylpropionic acid is a reactive chemical that can be synthesized by an asymmetric process. It has been used in the synthesis of nonsteroidal anti-inflammatory drugs, as it inhibits the activity of cyclooxygenase and lipoxygenase enzymes. This chemical also binds to the hydroxyl group on target proteins, inhibiting their function. 2-Phenylpropionic acid is metabolized by microbial metabolism and can inhibit the activity of drug-metabolizing enzymes such as CYP3A4 and CYP2D6. It may also interact with other drugs that are processed by these enzymes, including warfarin and carbamazepine. 2-Phenylpropionic acid is a competitive inhibitor that binds to the active site of an enzyme and blocks its access to its substrate molecule. The binding of 2-phenylpropionic acid to enzyme's active site prevents the reactant from entering and reacting with the enzyme, thereby preventing a</p>Formula:C9H10O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:150.17 g/molPalmitoleic acid methyl ester
CAS:<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>Formula:C17H32O2Purity:Min. 95%Molecular weight:268.43 g/molFormyl-(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-(D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H77N17O12Purity:Min. 95%Molecular weight:1,228.36 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molBiotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C137H217N47O41S4Purity:Min. 95%Molecular weight:3,306.75 g/mol3-Methylbenzofuran-2-carboxylic acid
CAS:<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:176.17 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/molEnterotoxin STp (E. coli) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about Enterotoxin STp (E. coli) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H110N20O26S6Purity:Min. 95%Molecular weight:1,972.26 g/molNeuromedin B trifluoroacetate salt
CAS:<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/molDnp-Pro-TNF-α (71-82) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H94N22O21Purity:Min. 95%Molecular weight:1,423.49 g/molH-Glu-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/molGalanin-Like Peptide (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C281H443N81O78Purity:Min. 95%Molecular weight:6,204.02 g/molBoc-Arg-Val-Arg-Arg-AMC acetate salt
CAS:Controlled Product<p>Boc-Arg-Val-Arg-Arg-AMC acetate salt is a protease inhibitor that belongs to the group of basic proteins. It inhibits the action of serine proteases, which are enzymes that break down proteins in cells. Boc-Arg-Val-Arg-Arg-AMC acetate salt has been shown to inhibit leishmania and tumor cell growth. It also inhibits cancer cell proliferation and metastasis. The inhibition of these cancer cell lines by Boc-Arg-Val-Arg-Arg-AMC acetate salt may be due to its ability to inhibit protein synthesis, which is vital for tumor cell growth. Boc Arg Val Arg Arg AMC acetate salt also induces apoptosis (cell death) in some cancer cells through the activation of caspase 3, a cysteine protease that plays an important role in apoptosis signaling pathways.</p>Formula:C38H62N14O8Purity:Min. 95%Molecular weight:842.99 g/molBoc-L-glutamic acid γ-methyl ester
CAS:<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>Formula:C11H19NO6Purity:Min. 95%Molecular weight:261.27 g/molTetrahydro-3-furoic acid
CAS:<p>Tetrahydro-3-furoic acid is an organic acid that can be found in the form of its tautomers, alpha-methylene-gamma-butyrolactone and 3-hydroxy-2,4-pentadienoic acid. It is a proapoptotic compound that induces cell death in cancer cells by inhibiting protein synthesis. Tetrahydro-3-furoic acid has been shown to have low expression levels in most tissues, with high levels found in the liver. The mechanism behind this inhibition is not yet known but may be due to the formation of a Schiff base between the amine and the carbonyl group of tetrahydro-3-furoic acid. This reaction mechanism has been proposed as a possible explanation for why tetrahydro-3-furoic acid is more toxic than other furoates such as ethyl-, propyl-, butyl-, and amyl-. Tet</p>Formula:C5H8O3Purity:Min. 95%Molecular weight:116.12 g/molMca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H81N15O19Purity:Min. 95%Molecular weight:1,388.44 g/mol([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-[(2-Aminoethyl)dithio]propionic acid
CAS:<p>Dithiobis(3-mercaptopropionate) is an analog of 3-[(2-Aminoethyl)dithio]propionic acid (DTA). It has been used as a cross-linking agent for the synthesis of polymers with acidic pH. Dithiobis(3-mercaptopropionate) is also used for the synthesis of conjugates and bifunctional molecules. Dithiobis(3-mercaptopropionate) can be synthesized by reacting bis(sulfanylmethyl)amine with sodium azide in an acidic solution. The cross-linking reaction will produce a disulfide bond, which is a covalent linkage between two cysteine residues in two different polypeptides or proteins. This crosslink is irreversible, so it cannot be broken down by chemical processes, but can be broken down by enzymatic digestion.</p>Formula:C5H11NO2S2Purity:(%) Min. 95%Color and Shape:PowderMolecular weight:181.28 g/mol(2-Amino-2-oxoethoxy)acetic acid
CAS:<p>2-Amino-2-oxoethoxy)acetic acid is a product that can be used as a transport agent in the process of extracting glycosides. It has been shown to have strong adsorption properties and is able to extract glycosides from plant material. 2-Amino-2-oxoethoxy)acetic acid has a high affinity for calcium, which is an important component in the adsorption mechanism.</p>Formula:C4H7NO4Purity:Min. 95%Molecular weight:133.1 g/molH-Arg-Met-OH acetate salt
CAS:<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/moltrans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate
CAS:<p>Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H107N19O17SPurity:Min. 95%Molecular weight:1,494.76 g/mol(Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H189N33O36Purity:Min. 95%Molecular weight:2,682 g/molMca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H110N22O20Purity:Min. 95%Molecular weight:1,675.84 g/molDiethylenetriaminepenta(methylenephosphonic acid) sodiumsalt
CAS:<p>Diethylenetriaminepenta(methylenephosphonic acid) sodium salt (DTPMP) is a substance that can be found in the environment. It is toxic to living organisms and may cause toxic effects if it is swallowed or inhaled. DTPMP has been classified as a toxic substance by the United States Environmental Protection Agency (EPA).</p>Formula:C9H18N3Na10O15P5Purity:Min. 95%Color and Shape:LiquidMolecular weight:793.02 g/mol12-Doxyl stearic acid
CAS:<p>12-Doxyl stearic acid is a fatty acid that inhibits the vasoactive intestinal peptide (VIP). The inhibitory effect of 12-Doxyl stearic acid on VIP was demonstrated by incubating the cells with this fatty acid and measuring the change in mitochondrial Ca2+ concentration. This inhibition was shown to be due to the inhibition of fatty acids and not an effect on Ca2+ ion channels. Fatty acids are important for normal cellular function, such as maintaining membrane fluidity and aiding in signal transduction. 12-Doxyl stearic acid has been shown to inhibit the production of cardiac fatty acids and may be useful in treating cardiac disorders. 12-Doxyl stearic acid also has a fluorescence probe that can be used to study how cells react to different conditions, such as changes in water vapor or pH levels.</p>Formula:C22H42NO4Purity:Min. 95%Color and Shape:Yellow Clear LiquidMolecular weight:384.57 g/mol4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride
CAS:<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27N3O4•2HClPurity:Min. 95%Color and Shape:PowderMolecular weight:482.4 g/molCalcium-Like Peptide 3 trifluoroacetate salt
CAS:<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N10O9Purity:Min. 95%Molecular weight:881.07 g/mol3-Pyridineboronic acid
CAS:<p>3-Pyridineboronic acid is an antimicrobial agent that is used to treat bacterial and fungal infections. 3-Pyridineboronic acid is a prodrug that is metabolized to its active form, pyridinium boronate. This drug has been shown to be effective in the treatment of hypoxic tumors in mice, which are resistant to other anticancer drugs. 3-Pyridineboronic acid also has acidic properties and can be used as an antiseptic for the treatment of skin and eye infections. It can also be used as a hydrogen bonding partner when combined with halides, such as chloride or bromide ions. The drug binds to human serum proteins and forms an acidic complex that prevents bacterial growth by inhibiting protein synthesis. 3-Pyridineboronic acid also inhibits prostate cancer cells by competitively inhibiting the enzyme 4-pyridinylboronic acid reductase (4PBAR).</p>Formula:C5H6BNO2Purity:Min. 95%Molecular weight:122.92 g/molBenzimidazole-5-carboxylic acid
CAS:<p>Benzimidazole-5-carboxylic acid is a monoclonal antibody that binds to the amide group of an amino acid. It has been shown to be a potent inhibitor of cell growth in cervical cancer cells and rat liver microsomes. It also showed inhibitory activity against fatty acid and nucleotide synthesis. Benzimidazole-5-carboxylic acid is a benzimidazole compound that has been shown to have anti-inflammatory effects in animal models and also inhibits the replication of HIV. This drug can inhibit the replication of influenza A virus in vitro and may be useful as an antiviral agent for treatment of influenza A infection.</p>Formula:C8H6N2O2Purity:Min. 98%Color and Shape:PowderMolecular weight:162.15 g/molNeuropeptide S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H160N34O27Purity:Min. 95%Molecular weight:2,210.5 g/mols-2-(4-Aminobenyl)-diethylenetriamine penta-tert-butyl acetate
CAS:<p>Please enquire for more information about s-2-(4-Aminobenyl)-diethylenetriamine penta-tert-butyl acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:779.02 g/molKemptamide trifluoroacetate salt
CAS:<p>Kemptamide is a peptide that has been shown to have cytotoxic and anti-proliferative effects on renal cancer cells. It is a synthetic analogue of an endogenous peptide, Lys-Lys-Arg-Pro-Gln-Arg-Ala-Thr-Ser-Asn-Val-Phe, that is found in porcine kidney. Kemptamide’s cytotoxic activity may be due to its ability to inhibit the activity of phosphatases. Kemptamide also has regulatory properties and can modulate the expression of genes that are involved in cell growth and apoptosis. This peptide has been shown to be reactive with kidney cells, which may lead to its therapeutic effect on renal cancer.</p>Formula:C65H112N24O18Purity:Min. 95%Molecular weight:1,517.74 g/molH-Val-Ile-His-Thr-EDANS acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H48N8O8SPurity:Min. 95%Molecular weight:716.85 g/molPiperazinoacetic acid anilide dihydrochloride
CAS:<p>Piperazinoacetic acid anilide dihydrochloride is a high quality, reagent compound which can be used as a useful intermediate or a speciality chemical. Piperazinoacetic acid anilide dihydrochloride is a complex compound that has been shown to have a number of useful properties, such as being an effective building block for the synthesis of other compounds. It can also be used as a reaction component in the preparation of fine chemicals and research chemicals. This product is also versatile, allowing it to be built into different scaffolds to create new compounds.</p>Formula:C12H17N3O•(HCl)2Purity:Min. 95%Molecular weight:292.2 g/molAlloferon 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Alloferon 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H69N19O15Purity:Min. 95%Molecular weight:1,128.16 g/molAngiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that may act as a neurotransmitter or neuromodulator. It is one of the most important vasoconstrictor and aldosterone-secreting hormones produced by the renin-angiotensin system in mammals. Angiotensin II has been shown to stimulate cardiac contractility, increase vascular resistance, and regulate blood pressure. The effect of Angiotensin II on cardiac contractility is mediated through its binding to a response element in the promoter region of genes encoding for Ca2+ channels. This binding leads to increased Ca2+ influx into cardiac cells and increased myofibrillar Ca2+ sensitivity. Angiotensin II also activates reactive oxygen species (ROS) production, which causes injury to the renal tubular epithelium and induces tubulointerstitial injury in rats with diabetes. It also stimulates squamous cell carcinoma growth by inducing reactive oxygen species (ROS) production and activating signal trans</p>Formula:C50H71N13O12·xC2HF3O2Purity:Min. 95%Molecular weight:1,046.18 g/molAPL1b28 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H185N31O39SPurity:Min. 95%Molecular weight:2,585.89 g/mol(S)-(-)-4-Amino-2-hydroxybutyric acid
CAS:<p>(S)-(-)-4-Amino-2-hydroxybutyric acid is an antibacterial agent that binds to the bacterial ribosome and prevents protein synthesis. It has been shown to be active against a range of bacteria, including Mycobacterium tuberculosis, Salmonella typhimurium, Staphylococcus aureus, and Streptococcus pyogenes. (S)-(-)-4-Amino-2-hydroxybutyric acid is also used in the analytical determination of other substances such as trifluoroacetic acid and malic acid. The pH optimum for this compound's activity is between 6.5 and 8.5.</p>Formula:C4H9NO3Purity:Min. 95%Color and Shape:White To Yellow SolidMolecular weight:119.12 g/molSuc-Ala-Ala-Pro-Abu-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Ala-Ala-Pro-Abu-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H34N6O9Purity:Min. 95%Molecular weight:562.57 g/molα-Ketoglutaric acid potassium
CAS:<p>Intermediate in the Krebs cycle; nitrogen transporter</p>Formula:C5H5O5KPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:184.19 g/molα-Helical CRF (12-41) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alpha-Helical CRF (12-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H251N43O47S2Purity:Min. 95%Molecular weight:3,497.01 g/molProkineticin 2 Isoform 2 (human) trifluoroacetate salt
CAS:<p>Prokineticin-2 is a protein that is encoded by the PROK2 gene. It has been shown to inhibit VEGF in vitro and to be anti-inflammatory. Prokineticin-2 binds to the receptor for colony stimulating factor 1 (CSF1) and promotes angiogenesis by inducing the production of angiogenic factors such as vascular endothelial growth factor (VEGF), erythropoietin, and granulocyte macrophage colony stimulating factor (GM-CSF). It also inhibits transcriptional regulation of genes involved in inflammation, including IL-10, which inhibits IL-12 production.</p>Formula:C379H606N114O101S13Purity:Min. 95%Molecular weight:8,792.43 g/molPrepro-Neuromedin S (70-103) (human) trifluoroacetate salt
<p>Please enquire for more information about Prepro-Neuromedin S (70-103) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H271N49O44SPurity:Min. 95%Molecular weight:3,857.45 g/molPyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H57N13O9Purity:Min. 95%Molecular weight:827.93 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS:<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>Formula:C15H23N3O10Purity:Min. 95%Molecular weight:405.36 g/molPAR-4 (1-6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H42N8O8Purity:Min. 95%Molecular weight:618.68 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21N5O7Purity:Min. 95%Molecular weight:395.37 g/molAngiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Angiotensin I/II (1-7) trifluoroacetate salt is a selective inhibitor of angiotensin II. It blocks the activity of angiotensin II, and thereby prevents the activation of growth factor-β1, which leads to a decrease in pulmonary hypertension. The drug has also been shown to be effective in blocking dextran sulfate absorption, as well as preventing bowel disease by inhibiting receptor activity. Angiotensin I/II (1-7) trifluoroacetate salt has been shown to have an anti-inflammatory effect on the cardiovascular system by blocking cell signaling pathways and reducing blood pressure. This drug is used for treatment of metabolic disorders such as atherosclerotic lesion, cardiac diseases such as coronary heart diseases, and bowel disease.</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/molPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
CAS:<p>Pancreastatin is a cytosolic protein that inhibits the production of peptide hormones such as glucagon, insulin, and gastrin. It is used to treat bowel disease, including carcinoid syndrome and inflammatory bowel disease. Pancreastatin has been shown to inhibit the activity of cyclase enzymes that are responsible for the production of these hormones. Pancreatic beta-cells produce pancreatic polypeptide (PP), which is converted by pancreastatin into inactive PP2. Pancreatic alpha-cells produce somatostatin (SS), which is converted by pancreastatin into inactive SS2. Pancreatic delta cells produce pancreatic polypeptide (PP), which is not affected by pancreastatin. Pancreatic somatostatinomas secrete SS, which is not affected by pancreastatin.</p>Formula:C214H330N68O76SPurity:Min. 95%Molecular weight:5,103.39 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/mol(Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H158N32O23S2Purity:Min. 95%Molecular weight:2,192.62 g/mol2,2'-Biphenyldicarboxylic acid anhydride - 70%
CAS:<p>2,2'-Biphenyldicarboxylic acid anhydride is a diphenic anhydride that has a carboxylate group on one end and a phenyl group on the other. The nitrogen atoms in this molecule are part of the intramolecular hydrogen bonds that stabilize the molecule. 2,2'-Biphenyldicarboxylic acid anhydride is used in wastewater treatment as it reacts with amines to form ammonium salts. This process also releases hydrogen, which can be used for fuel cells or light emission. It is also used to produce other compounds such as malonic acid and phenylacetic acid.</p>Formula:C14H8O3Purity:(%) Min. 70%Color and Shape:Brown Beige PowderMolecular weight:224.21 g/mol3-Fluorophenyl boronic acid
CAS:<p>Please enquire for more information about 3-Fluorophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6BFO2Purity:Min. 95%Color and Shape:PowderMolecular weight:139.92 g/molH-Arg-Ala-OH acetate salt
CAS:<p>H-Arg-Ala-OH acetate salt (HAA) is a histidine analogue that has been found to have physiological function as an endogenous substrate for serine protease. HAA acts as a competitive inhibitor of the serine protease enzyme by binding to the active site serine in the active site. The molecule is a disulfide bond and can be synthesized by the microorganism Corynebacterium glutamicum. This salt was extracted from yellowtail and found to inhibit corynebacterium glutamicum. X-ray absorption studies showed that the molecule contains a single amino acid, which is an analog of histidine.</p>Formula:C9H19N5O3Purity:Min. 95%Molecular weight:245.28 g/mol(Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H240N44O38Purity:Min. 95%Molecular weight:3,171.7 g/mol5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester
CAS:<p>Please enquire for more information about 5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H7F3N2O2Purity:Min. 95%Molecular weight:208.14 g/mol((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt
CAS:<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H60N10O15S2Purity:Min. 95%Molecular weight:1,177.27 g/molBoc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt
CAS:<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>Formula:C34H52N8O10Purity:Min. 95%Molecular weight:732.82 g/molBuccalin trifluoroacetate salt
CAS:<p>Buccalin is a cholinergic pharmaceutical drug that has been shown to have metabolic, growth factor, and chemotactic activities. It has been used in the treatment of various autoimmune diseases and infectious diseases. The mechanism of action for buccalin is unknown. Buccalin has been shown to have receptor activity in a variety of diagnostic agents such as monoclonal antibodies and fatty acids. It binds to acetylcholine receptors at the neuromuscular junction, leading to activation of muscle fibers by acetylcholine release from nerve endings.</p>Formula:C45H72N12O15SPurity:Min. 95%Molecular weight:1,053.19 g/mol(R)-2-Hydroxy-4-phenylbutanoic acid
CAS:<p>(R)-2-Hydroxy-4-phenylbutanoic acid is an ester compound that is produced by the conversion of (S)-malic acid to its enantiomer. This reaction is catalyzed by a phosphoric acid esterase. The kinetic, immobilization, and transfer mechanisms have been characterized. The solubilized form of the enzyme was found to be more active than the crystalline form. Enzyme inhibitors such as hydrogen chloride and hydrochloric acid were also investigated in order to determine their effect on the reaction rate and product distribution. A structural formula for (R)-2-Hydroxy-4-phenylbutanoic acid was determined using nuclear magnetic resonance spectroscopy and mass spectrometry, revealing a dinucleotide phosphate as a possible intermediate in the synthesis pathway.</p>Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/molH-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H38N6O5Purity:Min. 95%Molecular weight:526.63 g/molKisspeptin-13 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H107N21O18Purity:Min. 95%Molecular weight:1,626.81 g/mol(2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester
CAS:<p>Please enquire for more information about (2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H23N5O7Purity:Min. 95%Molecular weight:493.47 g/mol3,5-di-tert-Butyl-4-hydroxyphenylpropionic acid methyl ester
CAS:<p>3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester is a compound that has been used as an analytical reagent and as a precursor to other chemicals. It is a white solid with a melting point of about 40°C. 3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester is soluble in hexane, benzene, and diethylether. It also reacts with fatty acids to produce polymers. 3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester has been shown to be an effective antibacterial agent against Gram negative bacteria such as Escherichia coli and Pseudomonas aeruginosa.</p>Formula:C18H28O3Purity:90%Color and Shape:Off-White PowderMolecular weight:292.41 g/molH-Trp-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>H-Trp-Nle-Arg-Phe-NH2 acetate salt is a muscle relaxant that binds to the muscle receptor site, which is responsible for contraction of skeletal muscles. It has been shown to be effective in treating anterior retractor mytilus in horses.</p>Formula:C32H45N9O4Purity:Min. 95%Molecular weight:619.76 g/mol(Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H76N18O9S2Purity:Min. 95%Molecular weight:1,209.45 g/molTri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate
CAS:<p>Tri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate (TBA) is a gadolinium chelate that is used as a contrast agent in magnetic resonance imaging. TBA binds to the malignant cells and shows an increase in uptake of the gadolinium contrast agent. TBA has been shown to be effective in the diagnosis of cancerous brain tissue and is also able to detect cancer cells in animals. TBA has shown some efficacy against bacterial infection by binding to the cell membrane and inhibiting protein synthesis. It is also able to act synergistically with antibiotics such as penicillin or ampicillin to kill bacteria more effectively.</p>Formula:C28H52N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:572.73 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/molLys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Lys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H114N18O22Purity:Min. 95%Molecular weight:1,595.79 g/molMethyl carbamate
CAS:<p>Methyl carbamate is a carbamate that inhibits a number of enzymes, including mitochondrial membrane potential, cell nuclei, and dinucleotide phosphate. It also inhibits the synthesis of DNA, RNA, and proteins. Methyl carbamate has been shown to inhibit the growth of infectious diseases such as malaria and tuberculosis. It is a potent inhibitor of hyperproliferative diseases such as cancer. Methyl carbamate is used in analytical chemistry to determine the amount of an unknown compound in a sample by measuring its concentration with mass spectrometry or other methods. The compound can be prepared in various ways depending on the type of analysis needed. Methyl carbamate is usually prepared by reacting methyl iodide with sodium cyanide at 150 °C for 24 hours.</p>Formula:C2H5NO2Purity:Min. 95%Molecular weight:75.07 g/mol2,6-Dichloro-5-fluoronicotinic acid
CAS:<p>2,6-Dichloro-5-fluoronicotinic acid (2,6-DCFNA) is a chlorinating agent that is activated in acidic solutions. It is used to produce the disinfectant peracetic acid and in the industrial process of producing phenol. 2,6-DCFNA reacts with chloride to form hypochlorous acid (HOCl), which causes inflammation in cells by activating inflammatory cells such as neutrophils and macrophages. 2,6-DCFNA also inhibits tyrosine kinase activity, which may contribute to its anti-inflammatory properties. The toxic effects of 2,6-DCFNA have been studied on hematopoietic cells in vitro. Studies show that this compound can cause apoptosis or death of these cells and may be useful for the treatment of inflammatory diseases such as rheumatoid arthritis. 2,6-DCFNA has also been shown to inhibit tumor growth when</p>Formula:C6H2Cl2FNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:209.99 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>Formula:C25H42N10O11SPurity:Min. 95%Molecular weight:690.73 g/molEnterostatin (human, mouse, rat) acetate salt
CAS:<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>Formula:C21H36N8O6Purity:Min. 95%Molecular weight:496.56 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS:<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>Formula:C8H14O4S2Purity:Min. 97%Color and Shape:Colorless Clear LiquidMolecular weight:238.33 g/molLinoleic acid - powder
CAS:<p>Linoleic acid is a polyunsaturated fatty acid that is an important component of cell membranes. It has been shown to inhibit oxidative injury and improve mitochondrial functions. Linoleic acid also has a role in energy metabolism, as it is the precursor for biosynthesis of eicosanoids and arachidonic acid. The physiological effects of linoleic acid have been studied using a model system consisting of isolated rat adipose tissue and mitochondria. This model system has been used to investigate the inhibitory properties of linoleic acid on caproic acid-induced lipid peroxidation. Linoleic acid has also been shown to have anion radical scavenging activity when in the presence of iron. This compound can be analyzed using gas chromatography-mass spectrometry (GC-MS) based on its chemical composition, which consists mainly of linear 18-carbon chains with two double bonds at positions 9 and 12.</p>Formula:C18H32O2Purity:Min. 95%Color and Shape:PowderMolecular weight:280.45 g/molH-Arg-Phe-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N6O4Purity:Min. 95%Molecular weight:392.45 g/mol(±)7-epiJasmonic acid
CAS:<p>(±)7-EpiJasmonic acid is a carotenoid ester that has been found to have biological properties for weed control. It is the methyl ester of jasmonic acid, which is a fatty acid. The compound has been shown to be effective in suppressing plant diseases such as powdery mildew. The chemical transformation of (±)7-epiJasmonic acid can occur through methylation, hydroxylation, or nitro group formation. This process leads to the production of methyl jasmonate and nitrophenol. These compounds have been shown to have fertility effects on lettuce plants by increasing the number of seeds and seedlings produced.</p>Formula:C12H18O3Purity:Min. 95%Molecular weight:210.27 g/mol(Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H286N54O56Purity:Min. 95%Molecular weight:4,222.63 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS:<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>Formula:C61H87N17O14Purity:Min. 95%Molecular weight:1,282.45 g/mol(7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C208H308N54O61SPurity:Min. 95%Molecular weight:4,573.06 g/molDefensin HNP-1 (human) trifluoroacetate salt
CAS:<p>Defensin HNP-1 is a trifluoroacetate salt of human defensin HNP-1. It has antimicrobial activity against Gram-negative and Gram-positive bacteria, including Mycobacterium tuberculosis, Staphylococcus aureus, Mycoplasma pneumoniae, Streptococcus pneumoniae, Haemophilus influenzae and Enterococcus faecalis. The purified protein also has broad-spectrum activity against cancer cells. Defensin HNP-1 is most active in neutrophils from humans with active cystic fibrosis. The protein binds to the bacterial cell membrane and causes the release of lysosomal enzymes that kill the bacteria. Defensin HNP-1 is also able to inhibit the growth of tumor cells as it can be internalized into these cells by endocytosis.</p>Formula:C150H222N44O38S6Purity:Min. 95%Molecular weight:3,442.04 g/molAdropin (34-76) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H293N55O68S2Purity:Min. 95%Molecular weight:4,499.82 g/molMethoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H34N8O7Purity:Min. 95%Molecular weight:522.56 g/mol2-Fluoro-6-methylbenzoic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H7FO2Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:154.14 g/molAmyloid β/A4 Protein Precursor770 (394-410) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (394-410) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H151N31O26S2Purity:Min. 95%Molecular weight:2,099.44 g/molLysozyme C (46-61) (chicken) trifluoroacetate salt
CAS:<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>Formula:C72H116N22O29Purity:Min. 95%Molecular weight:1,753.82 g/mol(Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H312N58O60SPurity:Min. 95%Molecular weight:4,557.07 g/mol3,4,5-Trimethoxybenzoic acid anhydride
CAS:<p>3,4,5-Trimethoxybenzoic acid anhydride is a synthetic chemical compound that is used as a pharmaceutical intermediate. It is mainly used to prepare potent anticancer agents and potent anticancer drugs. 3,4,5-Trimethoxybenzoic acid anhydride reacts with amines in the presence of a base to form substituted amides. This reaction has been shown by crystal x-ray diffraction to be sensitive to the solvent polarity and temperature of the reaction medium. The compound can also react with chloride ion to form 3,4,5-trichlorobenzoic acid anhydride (3TCBA).</p>Formula:C20H22O9Purity:(%) Min. 85%Color and Shape:PowderMolecular weight:406.38 g/molOxindole-4-boronic acid, pinacol ester
CAS:<p>Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18BNO3Purity:Min. 95%Molecular weight:259.11 g/mol2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid
CAS:<p>Please enquire for more information about 2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7N3O2S2Purity:Min. 95%Color and Shape:PowderMolecular weight:217.27 g/molO-Hippuryl-DL-b-phenyllactic acid sodium salt
CAS:<p>Please enquire for more information about O-Hippuryl-DL-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/mol3-Amino-4-hydroxybenzoic acid hydrochloride
CAS:<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>Formula:C7H8ClNO3Purity:Min. 95%Molecular weight:189.6 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/molH-Gly-Gly-Arg-anilide acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-anilide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H25N7O3Purity:Min. 95%Molecular weight:363.42 g/molD-Lactic acid benzyl ester
CAS:<p>D-Lactic acid benzyl ester is a chiral molecule that can be used as a feedstock for the production of D-lactic acid. It has been shown to catalyze hydrogenation reactions with an enhanced reaction rate and high selectivity when compared to other methods. The catalytic activity of D-lactic acid benzyl ester can be increased by using zeolites or iron catalyst, which are more expensive than the ligand used in this study. In addition, D-lactic acid benzyl ester was found to be more effective at catalysing the reaction between alkenes and hydrogen gas than other known catalysts. These findings indicate that it may be possible to use D-lactic acid benzyl ester as a cost-effective alternative to other catalysts in industrial processes.</p>Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/molPhylloseptin-L2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H126N18O19Purity:Min. 95%Molecular weight:1,595.92 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H209N41O38Purity:Min. 95%Molecular weight:3,014.36 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/molHCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H116N20O17Purity:Min. 95%Molecular weight:1,425.72 g/molCaloxin 2A1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.52 g/mol(D-Trp11)-Neurotensin acetate salt
CAS:<p>Acetate salt</p>Formula:C80H122N22O19Purity:Min. 95%Molecular weight:1,695.96 g/moltrans 4-Dimethylaminocrotonic acid HCl
CAS:<p>Intermediate in the synthesis of afatinib</p>Formula:C6H12ClNO2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:165.62 g/mol(Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H76N14O11Purity:Min. 95%Molecular weight:1,097.27 g/molSarafotoxin B trifluoroacetate salt
CAS:<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>Formula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C215H355N63O54SPurity:Min. 95%Molecular weight:4,718.58 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H78N14O19Purity:Min. 95%Molecular weight:1,179.24 g/mol(Phe7)-Dynorphin A (1-7) acetate salt
CAS:<p>Dynorphin A (1-7) acetate salt is a potent analgesic that has been used to treat pain. It has been shown to be effective in the treatment of laryngitis and other laryngological disorders. Dynorphin A (1-7) acetate salt is a prodrug that is hydrolyzed in vivo to dynorphin A (1-7) by esterases, which can then bind to opioid receptors. This drug has been validated for use as a diagnostic agent in coatings and in algorithms for analysis of polygonal images from laryngoscopy. The dehydrogenase enzymes are added to the coating or algorithm for diagnosis of the presence of vocal cord pathology. Dynorphin A (1-7) acetate salt also shows promising results for analyzing waveforms from laryngoscopy, with the goal of classifying vocal cord pathology.</p>Formula:C43H58N10O9Purity:Min. 95%Molecular weight:858.98 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/mol(Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N15O10Purity:Min. 95%Molecular weight:1,122.32 g/molMAGE-3 Antigen (168-176) (human) acetate salt
CAS:<p>Please enquire for more information about MAGE-3 Antigen (168-176) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H71N11O15Purity:Min. 95%Molecular weight:1,042.14 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H160N30O26S4Purity:Min. 95%Molecular weight:2,434.89 g/molBovine Pineal Antireproductive Tripeptide acetate salt
CAS:<p>Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.</p>Formula:C13H26N4O6Purity:Min. 95%Molecular weight:334.37 g/molSperm Peptide P10G trifluoroacetate salt
CAS:<p>Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H58N10O13Purity:Min. 95%Molecular weight:838.91 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C141H235N47O41·xC2H4O2Purity:Min. 95%Molecular weight:3,244.67 g/mol3-Acetyl-α-boswellic acid
CAS:<p>3-Acetyl-alpha-boswellic acid is a compound that has been derived from the plant Boswellia serrata. It has been shown to have antiinflammatory properties and may have clinical potential as an agent for the treatment of inflammatory diseases. 3-Acetyl-alpha-boswellic acid was found to inhibit the proliferation of myeloid leukemia cells, which were activated by cytokine stimulation. This compound also decreased the mitochondrial membrane potential in hl-60 cells, inhibited the plasma concentrations of proinflammatory cytokines, and had a two-way crossover study with healthy volunteers. In addition, it inhibits the production of 11-keto-beta-boswellic acid (KBA), which is a metabolite of 3AB that is associated with cancer progression. The antiinflammatory effects of 3AB are due to its ability to inhibit NFκB activation and downregulate IL1β and TNFα expression in leukemic cells.</p>Formula:C32H50O4Purity:Min. 95%Color and Shape:White PowderMolecular weight:498.74 g/molTRAP-5 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H51N9O6Purity:Min. 95%Molecular weight:633.78 g/molAnti-Kentsin trifluoroacetate salt
CAS:<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H45N11O6Purity:Min. 95%Molecular weight:559.66 g/molH-Leu-Trp-Met-Arg-Phe-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-OH acetate salt is a molecule that transports amino acids across the cell membrane of bacteria, preventing bacterial growth. It is produced by proctolin and functional groups in dental plaque. This compound has been shown to inhibit the growth of bacteria in vitro by binding to hypochlorous acid, which is part of the antimicrobial activity of human neutrophils. H-Leu-Trp-Met-Arg-Phe-OH acetate salt has been used as a tracer for studying amino acid transport in E. coli cells and its uptake into extracellular vesicles. The product can also be used as an antiplaque agent due to its ability to inhibit the acid transport system and uptake of amino acids from the environment.</p>Formula:C37H53N9O6SPurity:Min. 95%Molecular weight:751.94 g/molAc-Val-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H36F3N7O11Purity:Min. 95%Molecular weight:751.66 g/molAbz-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H62N12O15SPurity:Min. 95%Molecular weight:1,019.09 g/molIntermedin-53 (human) trifluoroacetate salt
<p>Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C247H395N83O73S3Purity:Min. 95%Molecular weight:5,791.49 g/molN,N'-Dibenzylethylenediamine diacetate
CAS:Controlled Product<p>N,N'-Dibenzylethylenediamine diacetate is a diagnostic agent that is used to detect penicillin in blood samples. It reacts with the drug by forming a red-colored product, which can be detected with an ultraviolet light. This reaction is inhibited by cefapirin sodium and benzathine. The detection of penicillin in maternal blood has been shown to be significantly higher during the first trimester of pregnancy than during any other time period. Penicillin has also been shown to be effective against syphilis and streptococcal pharyngitis (strep throat), although it is not recommended for treatment trials because of its tendency to cause allergic reactions.</p>Formula:C16H20N2•(C2H4O2)2Purity:Min. 95%Molecular weight:360.45 g/molGastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C214H324N58O63SPurity:Min. 95%Molecular weight:4,749.28 g/mol([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Formula:C28H34N4O7SPurity:Min. 95%Molecular weight:570.66 g/molAcetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H333N63O54SPurity:Min. 95%Molecular weight:4,576.3 g/mol2,7-Naphthalenedisulfonic acid disodium salt
CAS:<p>2,7-Naphthalenedisulfonic acid disodium salt is a heteronuclear molecule that is synthesized by the reaction of 2,7-naphthalenedisulfonyl chloride with sodium sulfite in water. It has been used in the manufacture of dyes and pigments, as a corrosion inhibitor for steel and aluminum, and as an intermediate in the synthesis of pharmaceuticals. The compound has been detected in groundwater samples at concentrations up to 10 mg/L. The compound is also found in geothermal waters at concentrations up to 0.6 mg/L.</p>Formula:C10H6Na2O6S2Purity:Min. 95%Molecular weight:332.26 g/molH-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
CAS:<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>Formula:C29H54N8O10Purity:Min. 95%Molecular weight:674.79 g/mol4-Nitro benzenebutanoic acid
CAS:<p>4-Nitro benzenebutanoic acid is a synthetic molecule that has not been extensively studied in biological systems. It is a calcium-binding molecule and may be used to study the mechanisms of calcium binding. 4-Nitrobenzenebutanoic acid has also shown some bifunctional activity and is used as a substrate in pharmacokinetic studies. The synthesis of this compound can be achieved by reacting azobenzene with butyric acid in the presence of an amine and inulin. This reaction produces nitrobenzenebutanoic acid, which undergoes hydrolysis to yield 4-nitrobenzenebutanoic acid.</p>Formula:C10H11NO4Purity:Min. 95%Molecular weight:209.2 g/molH-Cys(NPys)-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/molNeuropeptide VF (56-92) (human) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H304N52O51S2Purity:Min. 95%Molecular weight:4,256.95 g/molExendin-4 (1-8) trifluoroacetate salt
CAS:<p>Please enquire for more information about Exendin-4 (1-8) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N11O13Purity:Min. 95%Molecular weight:833.85 g/molH-Lys-Gly-Trp-Lys-OtBu acetate salt
CAS:<p>The acetate salt of H-Lys-Gly-Trp-Lys is a peptide that has been modified with an acetyl group. The acetate salt is neutral and does not react with other compounds. This compound is a superoxide scavenger and can be used to prevent the formation of reactive oxygen species in biological systems.</p>Formula:C29H47N7O5Purity:Min. 95%Molecular weight:573.73 g/molTLQP-21 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N40O26Purity:Min. 95%Molecular weight:2,432.75 g/molAmyloid β-Protein (20-29) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (20-29) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H66N12O17Purity:Min. 95%Molecular weight:1,023.05 g/molMethyl benzofuran-6-carboxylate
CAS:<p>Methyl benzofuran-6-carboxylate is a synthetic retinoid that is a conformationally constrained analogue of retinoic acid, which is one of the most powerful biological molecules. Methyl benzofuran-6-carboxylate has been shown to be an effective anti-inflammatory agent and may be useful in the treatment of inflammatory skin diseases. It also inhibits the production of proinflammatory cytokines and chemokines, such as TNF-α, IL-1β, IL-8, CCL2, CXCL1, and CXCL2. Methyl benzofuran-6-carboxylate binds to specific receptors on cell surfaces to inhibit the production of inflammatory mediators. The drug also has been shown to have antiangiogenic activity. This property may be due to its ability to inhibit the production of vascular endothelial growth factor (VEGF) and other angiogenic factors.</p>Formula:C10H8O3Purity:Min. 95%Molecular weight:176.17 g/mol(Z)-2-(2-Aminothiazol-4-yl)-2-(hydroxyimino)acetic acid
CAS:<p>Please enquire for more information about (Z)-2-(2-Aminothiazol-4-yl)-2-(hydroxyimino)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H5N3O3SPurity:Min. 95%Molecular weight:187.18 g/molTIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H189N33O35S3Purity:Min. 95%Molecular weight:2,882.3 g/molAc-D-Ala-D-lactic acid
CAS:<p>Please enquire for more information about Ac-D-Ala-D-lactic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H13NO5Purity:Min. 95%Molecular weight:203.19 g/molα-Conotoxin MI trifluoroacetate salt
CAS:Controlled Product<p>A component of Conus venom; antagonist of nicotinic acetylcholine receptors</p>Formula:C58H88N22O17S4Purity:Min. 95%Molecular weight:1,493.72 g/molBiotinyl-Hepcidin-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H184N36O33S10Purity:Min. 95%Molecular weight:3,015.66 g/molAPL1b27 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b27 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H174N30O38SPurity:Min. 95%Molecular weight:2,472.73 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N54O56SPurity:Min. 95%Molecular weight:4,328.86 g/molDiethyldithiocarbamic acid sodium trihydrate
CAS:<p>Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.</p>Formula:C5H11NS2•Na•(H2O)3Purity:Min. 95%Color and Shape:PowderMolecular weight:226.32 g/mol(Des-Gly10,D-Pyr 1,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/mol(Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct
CAS:<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/mol3,4-Dibromobenzoic acid ethyl ester
CAS:<p>3,4-Dibromobenzoic acid ethyl ester is a high quality reagent that can be used as an intermediate for the synthesis of complex compounds. It is also useful as a building block for the synthesis of speciality chemicals and research chemicals. 3,4-Dibromobenzoic acid ethyl ester can be used in reactions such as Friedel-Crafts reactions, reducing reactions, and condensations. This chemical is a versatile building block that can be used to construct organic molecules with diverse structures. 3,4-Dibromobenzoic acid ethyl ester is a fine chemical with CAS number 60469-88-7.</p>Formula:C9H8Br2O2Purity:Min. 95%Molecular weight:307.97 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H183N45O26Purity:Min. 95%Molecular weight:2,455.83 g/molTRAF6 Control Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Control Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H232N34O42Purity:Min. 95%Molecular weight:3,051.53 g/mol(Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C169H279N53O51S2Purity:Min. 95%Molecular weight:3,933.48 g/mol(Des-Gly10,tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>Formula:C59H84N16O12•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,209.4 g/molAcetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H63N9O8Purity:Min. 95%Molecular weight:822.01 g/moltert-Butyl oxazol-5-ylcarbamate
CAS:<p>Please enquire for more information about tert-Butyl oxazol-5-ylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12N2O3Purity:Min. 95%Molecular weight:184.19 g/molBig Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt )
CAS:<p>Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H236N38O47S5Purity:Min. 95%Molecular weight:3,628.17 g/molDihydro-5-furylboronic acid pinacol ester
CAS:<p>Please enquire for more information about Dihydro-5-furylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BO3Purity:Min. 95%Molecular weight:196.05 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>Formula:C139H231N43O39SPurity:Min. 95%Molecular weight:3,160.65 g/molMca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H122N22O19Purity:Min. 95%Molecular weight:1,756.02 g/molH-D-Pro-Pro-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Pro-Pro-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/molMethyl diethylphosphonoacetate
CAS:<p>Methyl diethylphosphonoacetate is a chemical compound that contains a hydroxy group, an alkynyl group and a disulfide bond. It is used as a control agent in the production of polyurethane foams, and has also been shown to inhibit the growth of bladder cancer cells. The UV absorption peak at 220 nm can be used to identify this chemical compound. Methyl diethylphosphonoacetate reacts with proton to form diethylphosphonoacetate, which then undergoes an elimination reaction with fatty acids to form aliphatic hydrocarbons. This reaction mechanism was first proposed by Stork and co-workers in 1960. Methyl diethylphosphonoacetate also binds to thrombin receptor, which may lead to anti-inflammatory effects.</p>Formula:C7H15O5PPurity:Min. 95%Molecular weight:210.16 g/molLHRH (1-2) (free acid) acetate salt
CAS:<p>LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is an analog of the natural hormone LHRH. It is a member of the amide category and has been shown to have a constant level in human serum. LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is resistant to renal proximal tubule uptake and has an acidic pH optimum, which inhibits its uptake into cells. This drug also has an inhibitory effect on the reaction products of hydrogen chloride and proximal tubules.</p>Formula:C11H14N4O4Purity:Min. 95%Molecular weight:266.25 g/molMethyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate
CAS:<p>Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate is a metabotropic glutamate receptor antagonist. It blocks the glutamate receptor and prevents the transmission of nerve impulses in the central nervous system. This drug is used to treat neurological disorders such as anxiety, depression, and schizophrenia. Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate has been shown to have a number of side effects including drowsiness, nausea, dizziness and headache.</p>Formula:C11H10O3Purity:Min. 95%Molecular weight:190.2 g/molTumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt
<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C94H174N32O22S2Purity:Min. 95%Molecular weight:2,168.72 g/mol(d(CH2)51,Tyr(Me)2,Thr4, Orn 8,Tyr-NH29)-Vasotocin trifluoroacetate salt
CAS:<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br>br><br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>Formula:C54H79N11O13S2Purity:Min. 95%Molecular weight:1,154.4 g/molCRAMP-18 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP-18 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H171N27O24Purity:Min. 95%Molecular weight:2,147.61 g/molNeuronostatin-13 (human, canine, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H110N20O16Purity:Min. 95%Molecular weight:1,415.68 g/mol(Des-acetyl)-a-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-acetyl)-a-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H107N21O18SPurity:Min. 95%Molecular weight:1,622.85 g/mol4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt
CAS:<p>Please enquire for more information about 4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H6Cl2Na2O8S3Purity:Min. 95 Area-%Color and Shape:White Off-White PowderMolecular weight:491.25 g/mol4-bromo-5-chloro-2-fluorobenzoic Acid
CAS:<p>Please enquire for more information about 4-bromo-5-chloro-2-fluorobenzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H3BrClFO2Purity:Min. 95%Molecular weight:253.45 g/mol(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid
CAS:<p>(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is an antibacterial agent that inhibits the enzyme acetylcholine esterase. This inhibition prevents the breakdown of acetylcholine, leading to increased levels of this neurotransmitter in the brain and an enhancement of cholinergic transmission. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid has been shown to be effective against bacterial strains resistant to β-lactam antibiotics. The synthesis of taxol as well as other β-amino acids has been demonstrated using a variety of enzymatic methods. A reaction scheme for the synthesis of nicotinic acetylcholine has also been proposed. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is a dipept</p>Formula:C10H10F3NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:233.19 g/mol(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H251N49O40S2Purity:Min. 95%Molecular weight:3,625.2 g/molBiotinyl-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H258N52O44S5Purity:Min. 95%Molecular weight:3,690.34 g/mol2-Hydroxy nicotinic acid
CAS:<p>2-Hydroxy nicotinic acid is a carboxylate with a hydroxyl group. The compound has been shown to produce light emission in the presence of ultraviolet radiation and picolinic acid, which is an electron acceptor. This reaction is catalyzed by NADH oxidase and requires the presence of molecular oxygen. 2-Hydroxy nicotinic acid has also been shown to inhibit the activity of enzymes that are involved in the synthesis of nicotinamide adenine dinucleotide (NAD), including nicotinamide phosphoribosyltransferase (NAMPT), which produces NAD from niacinamide, and nicotinate phosphoribosyltransferase (NPT). The optimum concentration for this compound is between 1-2 mM. 2-Hydroxy nicotinic acid can be synthesized from natural compounds such as vitamin B3 or nicotinamide riboside through hydrolysis.</p>Formula:C6H5NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:139.11 g/molIndole-3-acetic-L-alanine
CAS:<p>Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.</p>Formula:C13H14N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:246.26 g/mol3-Hydroxy-3-methylglutaric acid
CAS:<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>Formula:C6H10O5Purity:Min. 95%Molecular weight:162.14 g/mol3-Methylthiopropionic acid
CAS:<p>3-Methylthiopropionic acid is a bacterial metabolite that can serve as an alternative carbon source for the production of amino acids. 3-Methylthiopropionic acid is used to study the effect of matrix on enzyme activities, and has been shown to have protein-binding properties. The compound also serves as a precursor in the synthesis of tiglic acid, which is a lysine precursor. 3-Methylthiopropionic acid has been found to be effective in slowing the growth of cancer cells. It has been shown to inhibit fatty acid synthesis, and may also inhibit methionine synthetase activity and cell proliferation.</p>Formula:C4H8O2SPurity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:120.17 g/mol
