
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
1-Pyridin-2-ylmethylpiperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-Pyridin-2-ylmethylpiperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O2Purity:Min. 95%Molecular weight:220.27 g/mol(D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molEthyl 2-((tert-butoxycarbonylamino)methyl)thiazole-4-carboxylate
CAS:<p>Please enquire for more information about Ethyl 2-((tert-butoxycarbonylamino)methyl)thiazole-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H18N2O4SPurity:Min. 95%Molecular weight:286.35 g/molBiotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C137H217N47O41S4Purity:Min. 95%Molecular weight:3,306.75 g/molMca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H110N22O20Purity:Min. 95%Molecular weight:1,675.84 g/molBenzimidazole-5-carboxylic acid
CAS:<p>Benzimidazole-5-carboxylic acid is a monoclonal antibody that binds to the amide group of an amino acid. It has been shown to be a potent inhibitor of cell growth in cervical cancer cells and rat liver microsomes. It also showed inhibitory activity against fatty acid and nucleotide synthesis. Benzimidazole-5-carboxylic acid is a benzimidazole compound that has been shown to have anti-inflammatory effects in animal models and also inhibits the replication of HIV. This drug can inhibit the replication of influenza A virus in vitro and may be useful as an antiviral agent for treatment of influenza A infection.</p>Formula:C8H6N2O2Purity:Min. 98%Color and Shape:PowderMolecular weight:162.15 g/molProkineticin 2 Isoform 2 (human) trifluoroacetate salt
CAS:<p>Prokineticin-2 is a protein that is encoded by the PROK2 gene. It has been shown to inhibit VEGF in vitro and to be anti-inflammatory. Prokineticin-2 binds to the receptor for colony stimulating factor 1 (CSF1) and promotes angiogenesis by inducing the production of angiogenic factors such as vascular endothelial growth factor (VEGF), erythropoietin, and granulocyte macrophage colony stimulating factor (GM-CSF). It also inhibits transcriptional regulation of genes involved in inflammation, including IL-10, which inhibits IL-12 production.</p>Formula:C379H606N114O101S13Purity:Min. 95%Molecular weight:8,792.43 g/mol(Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H158N32O23S2Purity:Min. 95%Molecular weight:2,192.62 g/mol(R)-2-Hydroxy-4-phenylbutanoic acid
CAS:<p>(R)-2-Hydroxy-4-phenylbutanoic acid is an ester compound that is produced by the conversion of (S)-malic acid to its enantiomer. This reaction is catalyzed by a phosphoric acid esterase. The kinetic, immobilization, and transfer mechanisms have been characterized. The solubilized form of the enzyme was found to be more active than the crystalline form. Enzyme inhibitors such as hydrogen chloride and hydrochloric acid were also investigated in order to determine their effect on the reaction rate and product distribution. A structural formula for (R)-2-Hydroxy-4-phenylbutanoic acid was determined using nuclear magnetic resonance spectroscopy and mass spectrometry, revealing a dinucleotide phosphate as a possible intermediate in the synthesis pathway.</p>Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/molNeuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H180N32O38Purity:Min. 95%Molecular weight:2,558.8 g/mol2,4,6-Trifluorobenzoic acid
CAS:<p>2,4,6-Trifluorobenzoic acid is a chemical compound that is an intermediate in the synthesis of stilbazole. It is prepared by chlorinating the 2,4,6-trichlorobenzoic acid with hydrogen peroxide and hydrochloric acid. The 2,4,6-trifluorobenzoic acid is then reduced to the desired product with sodium borohydride. This chemical has been detected in nature as a racemic mixture and can be used as a precursor in analytical methods for detecting other compounds. It is also used in dechlorination reactions to remove chlorine from organic molecules. This process can be monitored using UV detectors.</p>Formula:C7H3F3O2Purity:Min. 95%Molecular weight:176.09 g/mol(Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N15O10Purity:Min. 95%Molecular weight:1,122.32 g/molAbz-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H62N12O15SPurity:Min. 95%Molecular weight:1,019.09 g/mol6,8-Dichlorochromone-2-carboxylic acid
CAS:<p>6,8-Dichlorochromone-2-carboxylic acid is a fine chemical that is used as a building block in the synthesis of complex compounds. It is also a versatile building block that can be used in many reactions, such as nucleophilic substitution, electrophilic addition, and condensation reactions. This compound has CAS number 16722-38-6 and is a reagent for research purposes.</p>Formula:C10H4Cl2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:259.04 g/mol(Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molTRAF6 Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H238N34O44Purity:Min. 95%Molecular weight:3,161.64 g/mol(Des-acetyl)-a-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-acetyl)-a-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H107N21O18SPurity:Min. 95%Molecular weight:1,622.85 g/molGlycerophosphoric acid - 35% aqueous solution, mixture of isomers
CAS:<p>Mixture of 1, 2 and cyclic phosphates.<br>Glycerophosphoric acid is a fatty acid that is naturally found in the body. It has been shown to have an effect on the production of enzymes and proteins in cells, which may be related to its metabolic rate.</p>Formula:C3H9O6PPurity:Min. 35%Color and Shape:Colorless Clear LiquidMolecular weight:172.07 g/mol1-Oxo-indan-5-carboxylicacid
CAS:<p>Please enquire for more information about 1-Oxo-indan-5-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H8O3Purity:Min. 95%Molecular weight:176.17 g/molMonocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H98N18O22Purity:Min. 95%Molecular weight:1,411.52 g/mol(Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H296N54O56Purity:Min. 95%Molecular weight:4,292.77 g/mol2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid
CAS:<p>2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid is a fine chemical that is used in research and as a reagent. It is also used as a building block for more complex compounds and as a versatile scaffold in organic synthesis. 2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid can be reacted with other chemicals to create new compounds. This chemical has been shown to have antihistamine properties and may also function as an antipsychotic drug.</p>Formula:C9H6BrNO5Purity:Min. 95%Molecular weight:288.05 g/molC-Peptide (human) acetate salt
CAS:<p>C-Peptide (human) acetate salt H-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala -Gly Ser Leu Gln Pro Leu Ala Leu Glu Gly Ser Leu Gln Pro Leu Ala is a peptide that has been purified from the pancreas of human and bovine sources. It is used in blood sampling and rate constant experiments to measure the response element on a signal peptide. This experiment can be used to study insulin production, as well as other biological samples. C Peptide (human) acetate salt H Glu Ala Glu Asp Leu Gln Val Gly Gln Val Glu Leu Gly Gly Gly Pro Gly Ala Gly Ser Leu Gln Pro Leu Ala has inhibitory properties against</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molCyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.</p>Formula:C26H38N8O7Purity:Min. 95%Molecular weight:574.63 g/molNociceptin trifluoroacetate salt
CAS:<p>Nociceptin trifluoroacetate salt is an opioid with low potency that is used in the treatment of pain. It has been shown to bind to the protein and inhibit protease, which has been proposed as a possible mechanism for its analgesic effects. Nociceptin trifluoroacetate salt may also have indirect effects on brain functions by regulating levels of nociceptin, a neuropeptide that interacts with nociceptive neurons in the brain. This drug has been shown to have nootropic effects in mice, including increased locomotor activity and improved memory retention. Nociceptin trifluoroacetate salt inhibits kappa-opioid receptors and is therefore used as a pharmacological tool for research into opioid receptor function.</p>Formula:C79H129N27O22Purity:Min. 95%Molecular weight:1,809.04 g/molProp-1-en-2-ylboronic acid
CAS:<p>Prop-1-en-2-ylboronic acid is a chemical compound that belongs to the group of aromatic hydrocarbons. It is used in pharmaceutical preparations as a monomer and as a chiral building block for the synthesis of oxazolidinones, which are used in medicinal chemistry as protein inhibitors against cancers. Prop-1-en-2-ylboronic acid is also used as a reagent in preparative high performance liquid chromatography. This chemical has shown maximal response against colorectal carcinoma cells and has been shown to be an inhibitor of cholesterol ester transfer.</p>Formula:C3H7BO2Purity:90%MinMolecular weight:85.9 g/mol2-Iodo-5-methoxybenzoic acid
CAS:<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>Formula:C8H7IO3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.04 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/molAmyloid Bri Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H273N49O52S2Purity:Min. 95%Molecular weight:3,935.45 g/mol(Phe7)-Dynorphin A (1-7) acetate salt
CAS:<p>Dynorphin A (1-7) acetate salt is a potent analgesic that has been used to treat pain. It has been shown to be effective in the treatment of laryngitis and other laryngological disorders. Dynorphin A (1-7) acetate salt is a prodrug that is hydrolyzed in vivo to dynorphin A (1-7) by esterases, which can then bind to opioid receptors. This drug has been validated for use as a diagnostic agent in coatings and in algorithms for analysis of polygonal images from laryngoscopy. The dehydrogenase enzymes are added to the coating or algorithm for diagnosis of the presence of vocal cord pathology. Dynorphin A (1-7) acetate salt also shows promising results for analyzing waveforms from laryngoscopy, with the goal of classifying vocal cord pathology.</p>Formula:C43H58N10O9Purity:Min. 95%Molecular weight:858.98 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N10O18Purity:Min. 95%Molecular weight:1,023.05 g/mol2-Pyrimidine-carboxylic acid
CAS:<p>2-Pyrimidine-carboxylic acid is a biologically active molecule that can be found in the human body. It is a derivative of pyrimidine, which belongs to the group of purines. 2-Pyrimidine-carboxylic acid has been shown to inhibit the nicotinic acetylcholine receptor and α7 nicotinic acetylcholine receptor, which are receptors for acetylcholine. This molecule also has antihypertensive activity and has been shown to have therapeutic effects in psychotic disorders. 2-Pyrimidine-carboxylic acid binds to picolinic acid, which is an important intermediate in the metabolism of tryptophan, and hydroxyl group, which is essential for many biological functions. It also reacts with copper ions and forms a complex that is x-ray crystal structure confirmed. This complex may be used as a herbicide resistance inducer or as a chemical species for receptor binding studies or chemical reactions.</p>Formula:C5H4N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:124.1 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H93N15O14S2Purity:Min. 95%Molecular weight:1,204.51 g/mol4-Chlorophenylboronic acid
CAS:<p>4-Chlorophenylboronic acid is a chemical compound that is used in the industrial preparation of biphenyl. It is produced by the Friedel-Crafts reaction between chlorine and 4-methoxyphenylboronic acid. This reaction can be carried out using a variety of solvents, such as chloroform or carbon tetrachloride. The optimal reaction conditions are acidic pH values, which are achieved by adding sodium carbonate to the solution. The product can be purified by distillation or crystallization. 4-Chlorophenylboronic acid can also be used for the synthesis of organic compounds through cross-coupling reactions with organometallic reagents, such as palladium chloride and triphenylphosphine, or through asymmetric synthesis with chiral ligands like (S)-proline and 2-(diphenylphosphino)ferrocene.</p>Formula:C6H6BClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:156.37 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H72N14O8Purity:Min. 95%Molecular weight:1,081.27 g/mol4,4-Difluorocyclohexaneacetic acid
CAS:<p>Please enquire for more information about 4,4-Difluorocyclohexaneacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12F2O2Purity:Min. 95%Molecular weight:178.18 g/molAc-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H162N20O26Purity:Min. 95%Molecular weight:2,000.42 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H270N48O51S2Purity:Min. 95%Molecular weight:4,046.55 g/molTert-Butyl Trans-4-(2-Oxoethyl)Cyclohexylcarbamate
CAS:<p>Please enquire for more information about Tert-Butyl Trans-4-(2-Oxoethyl)Cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23NO3Purity:Min. 95%Molecular weight:241.33 g/molH-Lys-Lys-bNA acetate salt
CAS:<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N5O2Purity:Min. 95%Molecular weight:399.53 g/molCyclopropane-1,1-dicarboxylic acid, methylester
CAS:<p>Please enquire for more information about Cyclopropane-1,1-dicarboxylic acid, methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:144.13 g/molAc-Leu-Glu-His-Asp-AMC trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>Formula:C33H41N7O11Purity:Min. 95%Molecular weight:711.72 g/molMonocyte Chemotactic Protein-1 (human) acetate salt
CAS:<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C379H610N108O114S5Purity:Min. 95%Molecular weight:8,663.89 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H285N55O57SPurity:Min. 95%Molecular weight:4,271.69 g/molAcetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H333N63O54SPurity:Min. 95%Molecular weight:4,576.3 g/molMethoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H34N8O7Purity:Min. 95%Molecular weight:522.56 g/molMca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H105N19O19SPurity:Min. 95%Molecular weight:1,656.86 g/mol3-(4-Methoxybenzoyl)acrylic acid
CAS:<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H10O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.19 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:<p>Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.</p>Formula:C34H41N3O6Purity:Min. 95%Molecular weight:587.71 g/mol16-Hydroxyhexadecanoic acid
CAS:<p>16-Hydroxyhexadecanoic acid is a fatty acid that contains 16 carbons and 2 hydroxyl groups. It can be found in rat liver microsomes, where it binds to the cytochrome P450 enzyme, inhibiting its activity. The structural analysis of this compound has been shown to have intermolecular hydrogen bonding between the nitrogen atoms and the oxygen atoms in the hydroxyl group. 16-Hydroxyhexadecanoic acid also exhibits phase transition temperatures, which are increased by adding water molecules. This compound also has an inhibitory effect on recombinant cytochrome P450 enzymes from p. pastoris and can be used as a substrate for methyl myristate metabolism. In addition, 16-hydroxyhexadecanoic acid binds to dinucleotide phosphate (NADPH) and fluoresces when excited at 340 nm using a fluorescence detector.</p>Formula:C16H32O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:272.42 g/molSPLUNC1 (22-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O25Purity:Min. 95%Molecular weight:1,815.08 g/molH-Asn-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Asn-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O4Purity:Min. 95%Molecular weight:289.29 g/mol3-Methylsalicylic acid
CAS:<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>Formula:C8H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:152.15 g/mol(Dab 9)-Neurotensin (8-13) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H60N10O8Purity:Min. 95%Molecular weight:760.92 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formula:C65H118N18O15Purity:Min. 95%Molecular weight:1,391.74 g/molBNP-32 (rat) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C146H239N47O44S3Purity:Min. 95%Molecular weight:3,452.95 g/mol(+)-3-Bromo-10-camphorsulfonic acid monohydate
CAS:<p>Please enquire for more information about (+)-3-Bromo-10-camphorsulfonic acid monohydate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H15BrO4S•H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:329.21 g/mol[2-fluoro-4-(trifluoromethyl)phenyl]boronic Acid
CAS:<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>Formula:C7H5BF4O2Purity:Min. 95%Molecular weight:207.92 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS:<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Formula:C12H19NO5Purity:Min. 95%Molecular weight:257.28 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H228N38O51Purity:Min. 95%Molecular weight:3,259.53 g/molHuman CMV pp65 (495-503) trifluoroacetate salt
CAS:<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H74N10O12SPurity:Min. 95%Molecular weight:943.16 g/mol(β-Asp5)-δ-Sleep Inducing Peptide trifluoroacetate salt
CAS:<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>Formula:C35H48N10O15Purity:Min. 95%Molecular weight:848.81 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/molPreptin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H275N47O53Purity:Min. 95%Molecular weight:4,029.47 g/molMca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H89N17O17Purity:Min. 95%Molecular weight:1,332.46 g/molKR-12 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H127N25O15Purity:Min. 95%Molecular weight:1,570.93 g/molMethyl 2,2-difluoro-2-(fluorosulfonyl)acetate
CAS:<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>Formula:C3H3F3O4SPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:192.11 g/molOsteostatin (human) trifluoroacetate salt
CAS:<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>Formula:C142H228N42O58Purity:Min. 95%Molecular weight:3,451.58 g/mol4-Hydroxyphenylboronic acid
CAS:<p>4-Hydroxyphenylboronic acid is a potential anticancer agent that has been studied in vitro and in vivo. It has been shown to inhibit the activity of p-glycoprotein, which is a protein that pumps drugs out of cells, and it is also an inhibitor of lipid kinase. 4-Hydroxyphenylboronic acid binds to the ATP binding site of the enzyme and forms covalent bonds with Lys residues on the enzyme, inhibiting its function. The compound can be detected at low concentrations using fluorescence or chemiluminescence techniques. This compound may have therapeutic benefits for antimicrobial agents as well as for cancer treatment.</p>Formula:C6H7BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:137.93 g/molO-a-Hippuryl-L-argininic acid hydrochloride salt
CAS:<p>Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H20N4O5Purity:Min. 95%Molecular weight:336.34 g/molBNP-32 (porcine) trifluoroacetate salt
CAS:<p>BNP-32 is a porcine-specific antibody that is used to detect the presence of BNP in human serum. It is biotinylated and can be coated on a plate. The antibody binds to BNP, which has been labeled with peroxidase, and produces a colored reaction product. This product can be visualized by adding 3,3'-diaminobenzidine (DAB) as a substrate. The sealer then prevents the unbound antibody from binding to the plate and interfering with the assay.</p>Formula:C149H250N52O44S3Purity:Min. 95%Molecular weight:3,570.1 g/moltert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate
CAS:<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40FN3O6SPurity:Min. 95%Molecular weight:577.71 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>Formula:C60H87N19O13Purity:Min. 95%Molecular weight:1,282.45 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/moltert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N2O3Purity:Min. 95%Molecular weight:256.34 g/molPAR-3 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O8Purity:Min. 95%Molecular weight:576.6 g/molH-Gly-Pro-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Pro-Pro-OH trifluoroacetate salt is an amide with a high specificity and low energy. This compound is activated by sequences of collagen, which may be due to its ability to hydrate intracellular calcium concentrations. H-Gly-Pro-Pro-OH trifluoroacetate salt has been shown to have polymerase chain activation activity in the presence of lysine residues, and it can bind to regulatory sites on DNA. H-Gly-Pro-Pro-OH trifluoroacetate salt has also been shown to have hydroxyproline hydroxylase activity, which leads to a helical structure.</p>Formula:C12H19N3O4Purity:Min. 95%Molecular weight:269.3 g/mol(D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H72N14O12Purity:Min. 95%Molecular weight:1,085.22 g/mol4-tert-Butylphenylboronic acid
CAS:<p>4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.</p>Formula:C10H15BO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:178.04 g/mol(Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H287N55O57SPurity:Min. 95%Molecular weight:4,285.71 g/molDimercaptosuccinic acid
CAS:<p>Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.</p>Formula:C4H6O4S2Color and Shape:White PowderMolecular weight:182.22 g/mol(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester
CAS:<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>Formula:C12H16O3Purity:Min. 95%Color and Shape:LiquidMolecular weight:208.25 g/mol4-Acetyl-piperidine-1-carboxylic acid tert-butyl ester
CAS:<p>4-Acetylpiperidine-1-carboxylic acid tert-butyl ester is a tert-butyl ester of 4-acetylpiperidine. It can be prepared by the reaction of sodium azide with chloroform and tert-butyl alcohol. The resulting product is a white solid that can be used as an intermediate in organic synthesis.</p>Formula:C12H21NO3Purity:Min. 95%Molecular weight:227.3 g/molAc-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H66N12O9Purity:Min. 95%Molecular weight:871.04 g/molIloprost
CAS:<p>Iloprost is a cyclase inhibitor that is used to treat pulmonary hypertension. It relaxes the smooth muscle cells in the lungs, which causes an increase in blood flow and oxygen levels to the heart and other organs. Iloprost also decreases the production of PGE2 and lowers blood pressure. Iloprost has been shown to be effective in treating chronic viral hepatitis and pulmonary diseases such as primary pulmonary hypertension. This drug can cause hypotension, so it should not be taken by patients with low blood pressure or those who are taking other drugs that can cause hypotension.</p>Formula:C22H32O4Purity:Min. 95%Color and Shape:Solidified MassMolecular weight:360.49 g/molOsteostatin amide trifluoroacetate
CAS:<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O57•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,450.59 g/molTRAP-7 trifluoroacetate salt
CAS:<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>Formula:C39H63N11O10Purity:Min. 95%Molecular weight:845.99 g/molCyclopenten-1-ylboronic acid
CAS:<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>Formula:C5H9BO2Purity:Min. 95%Molecular weight:111.93 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H66Cl2N12O8S2Purity:Min. 95%Molecular weight:1,146.22 g/moltrans-4-[(2,5-Dihydro-2,5-dioxo-1H-pyrrol-1-yl)methyl]cyclohexanecarboxylic acid
CAS:<p>4-Maleimidomethylcyclohexanecaroboxylic acid (4MAMC) is a bifunctional molecule that is conjugated to a polymer, which has the ability to bind with cellular antigens and target tissue. It is used in clinical chemistry because it can be detected at low concentrations. 4MAMC has been shown to reduce cirrhosis caused by chronic liver injury. 4MAMC also increases the uptake of coagulation factors and decreases the expression of prothrombin, which leads to an increase in clotting time. The localization of 4MAMC is determined by the type of polymer conjugate it is bound with; for example, when it binds with human serum albumin, it localizes on the surface of cells.</p>Formula:C12H15NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:237.25 g/molH-Arg-Ser-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H19N5O4Purity:Min. 95%Molecular weight:261.28 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/molpTH (2-38) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H314N58O53S2Purity:Min. 95%Molecular weight:4,371.06 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H69ClN12O9S2Purity:Min. 95%Molecular weight:1,177.83 g/mol1-Naphthylphosphoric acid calcium
CAS:<p>1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.</p>Formula:C20H18O8P2•CaPurity:Min. 95%Color and Shape:PowderMolecular weight:488.38 g/molAndrostanolone acetate
CAS:Controlled Product<p>Androstanolone acetate is a synthetic androgen that has been shown to stimulate the production of testosterone in the testes. Androstanolone acetate has been shown to be effective in treating symptoms of male hypogonadism, as well as erectile dysfunction. The drug also has an antigenic effect, which stimulates the production of antibodies against it. Androstanolone acetate binds to cell specific antigens and stimulates cell proliferation. It has been used in cancer prevention studies, where it was found that it could suppress estrogen-induced endometrial cancer in animals. In addition, Androstanolone acetate is capable of stimulating light emission when incubated with cells and can be detected using chromatographic methods.</p>Formula:C21H32O3Purity:Min. 95%Color and Shape:PowderMolecular weight:332.48 g/molDodecylbenzenesulfonic acid, 70% in isopropanol
CAS:<p>Dodecylbenzenesulfonic acid is a sulfonic acid that is used in the production of polyaniline. It is also used as an organic reagent that can be applied in organic synthesis, including polymerization and electrochemical studies. Dodecylbenzenesulfonic acid has been shown to react with sodium salts to form dodecyl benzene, which can be observed by synchronous fluorescence spectroscopy. This chemical has a phase transition temperature of -9°C and a boiling point of 176°C. Dodecylbenzenesulfonic acid is soluble in water vapor, but insoluble in ethanol or acetone.</p>Formula:C18H30O3SPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:326.5 g/molGalanin-Like Peptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C292H451N83O84SPurity:Min. 95%Molecular weight:6,500.28 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2,5-Anhydro-3,4-dideoxy-erythro-hexaric acid - 98%
CAS:<p>The synthesis of 2,5-anhydro-3,4-dideoxy-erythro-hexaric acid (2,5AHDHE) is described in detail. The reaction starts with the condensation of 3,4-dideoxy-erythro-hexose with aldehyde and furfural to give the hemiacetal. The ring opening of this hemiacetal leads to the formation of 2,5AHDHE and furfural. The protonation of 2,5AHDHE leads to proton release and bond cleavage. Furfural is reduced to 5-hydroxymethylfurfural (HMF). HMF is then oxidized to hydroxyl group by H2O2. The hydroxyl group reacts with a second molecule of 2,5AHDHE to form a new molecule of 2,5AHDHE and H2O2. This process can be repeated until</p>Formula:C6H8O5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:160.12 g/molSplenopentin acetate salt
CAS:<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>Formula:C31H51N9O9Purity:Min. 95%Molecular weight:693.79 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/molWRW4
CAS:<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H65N15O6Purity:Min. 95%Molecular weight:1,104.27 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/molH-Lys-Gly-Lys-OH acetate salt
CAS:<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>Formula:C14H29N5O4Purity:Min. 95%Molecular weight:331.41 g/molOvokinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H67N13O11Purity:Min. 95%Molecular weight:1,002.13 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C406H670N122O126S3Purity:Min. 95%Molecular weight:9,372.61 g/moltert-Butyl carbamate
CAS:<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>Formula:C5H11NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:117.15 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molNeurokinin A trifluoroacetate salt
CAS:<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>Formula:C50H80N14O14SPurity:Min. 95%Molecular weight:1,133.32 g/molNeuropeptide F trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide F trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C210H328N58O58Purity:Min. 95%Molecular weight:4,593.21 g/molH-Phe-AMC trifluoroacetate salt
CAS:<p>H-Phe-AMC Trifluoroacetate salt is a synthetic, protease inhibitor that inhibits the activity of serine and cysteine proteases. It binds to the active site of these enzymes and blocks their function. H-Phe-AMC trifluoroacetate salt has been used in food chemistry to hydrolyze proteins, and can be used to measure enzyme activities. This product also has been shown to have biological functions such as the inhibition of molting, physiological function, and the prevention of carcinogenesis.</p>Formula:C19H18N2O3Purity:Min. 95%Molecular weight:322.36 g/mol(4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid
CAS:<p>Please enquire for more information about (4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H11BO4Purity:Min. 95%Molecular weight:193.99 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H222N38O49Purity:Min. 95%Molecular weight:3,161.43 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/molAmyloid Dan Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H268N48O51S2Purity:Min. 95%Molecular weight:4,044.53 g/mol2-Amino-5-chloro-3-methylbenzoic acid
CAS:<p>2-Amino-5-chloro-3-methylbenzoic acid (ACMB) is a substructure of the insecticidal compound chlorantraniliprole. It is a solid at room temperature and has a molecular weight of 142.15 g/mol. ACMB can be extracted from n-hexane, chlorantraniliprole, or xylene using gravimetric analysis. The bioactivity of ACMB can be determined by an anthranilic assay, while its solubility data are available in the literature. ACMB has been shown to have insecticidal activity against lepidoptera larvae and cyanuric activity against mosquito larvae.</p>Formula:C8H8ClNO2Purity:Min. 95%Molecular weight:185.61 g/molAmyloid β-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H285N51O54SPurity:Min. 95%Molecular weight:4,143.64 g/mol(D-Phe2·6,Pro3)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H80N14O13Purity:Min. 95%Molecular weight:1,193.35 g/mol1-Pyreneboronic Acid (contains varying amounts of Anhydride)
CAS:<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>Formula:C16H11BO2Purity:Min. 95%Molecular weight:246.07 g/mol(Ile3)-Pressinoic acid
CAS:<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/molAdrenomedullin 5 (primate) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin 5 (primate) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C253H394N82O71S2Purity:Min. 95%Molecular weight:5,784.48 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/mol3,4,9,10-Perylenetetracarboxylic diimide
CAS:<p>3,4,9,10-Perylenetetracarboxylic diimide is a model system for studying the mechanism of protonated pyridine. It is a bicyclic heterocycle that contains two phenyl rings and one imide group. The nitrogen atoms in the molecule form hydrogen bonds with other molecules and can be substituted with chlorine or bromine. 3,4,9,10-Perylenetetracarboxylic diimide has been shown to have chemical stability under conditions of hydrochloric acid and heat. This compound also has a high melting point and is not soluble in water. 3,4,9,10-Perylenetetracarboxylic diimide has been used to study the reaction mechanisms of chemical reactions involving light emission. This compound absorbs light at wavelengths longer than 400 nm (e.g., ultraviolet) and emits light at wavelengths shorter than 400 nm (e.g.,</p>Formula:C24H10N2O4Color and Shape:PowderMolecular weight:390.35 g/molKemptide trifluoroacetate salt
CAS:<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>Formula:C32H61N13O9·xC2HF3O2Purity:Min. 95%Molecular weight:771.91 g/mol(Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molMca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H82N16O18Purity:Min. 95%Molecular weight:1,327.4 g/mol(D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C158H265N49O43Purity:Min. 95%Molecular weight:3,539.1 g/mol(Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molH-Gly-Gly-Lys-Ala-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N6O6Purity:Min. 95%Molecular weight:402.45 g/molNuclear Factor NF-KB Inhibitor SN50 trifluoroacetate salt
CAS:<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>Formula:C129H230N36O29SPurity:Min. 95%Molecular weight:2,781.5 g/molH-Met-Arg-OH acetate salt
CAS:<p>H-Met-Arg-OH acetate salt is a metabolite of the amino acid L-methionine. It is also a dipeptide, which consists of two amino acids that are linked by an amide bond. The linkage between the amino acids in this compound is clockwise instead of the usual left to right orientation. This means that H-Met-Arg-OH acetate salt is not an essential amino acid and can be synthesized by the body. Salmonella typhimurium uses H-Met-Arg-OH acetate salt as a precursor for its synthesis of L-arginine and L-methionine, which are essential to bacterial growth and survival. Residues have been found in foods such as milk and eggs, and it has been shown that cotransduction can lead to resistance against antibiotics such as streptomycin and tetracycline.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/molH-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>Formula:C22H37N9O10Purity:Min. 95%Molecular weight:587.58 g/mol4,6-Dichloro-2-methylnicotinic acid
CAS:<p>Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-Arg-OH acetate salt is a polycarboxylic acid that is found in human immunoglobulins. It has been used as a synthetic substrate for the study of radiation enhancement. H-Arg-Arg-Arg-OH acetate salt is also an allergen and can cause allergic reactions, such as itching and swelling. This compound can be used to study the neutral pH, chemical reactions, protein synthesis, and the hydroxyl group.</p>Formula:C18H38N12O4Purity:Min. 95%Molecular weight:486.57 g/molcis-4-Aminocyclohexanecarboxylic acid methyl ester hcl
CAS:<p>cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl is a chemical compound that is used in research and industry. It is an efficient isomer of 4-aminocyclohexanecarboxylic acid methyl ester hydrochloride. cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl has been used as a model for the study of glimepiride, an insulin secretagogue, and has been shown to be active against Toxoplasma gondii.</p>Formula:C8H15NO2·HClPurity:Min. 95%Color and Shape:SolidMolecular weight:193.67 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/molH-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H32N8O9Purity:Min. 95%Molecular weight:504.5 g/molpTH-Related Protein (1-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>Formula:C180H288N58O47Purity:Min. 95%Molecular weight:4,016.58 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/molL-Glutamic acid α-amide
CAS:<p>L-Glutamic acid alpha-amide is an ester hydrochloride that is a tissue culture amide. It is a cyclic peptide analog and a hydroxyl group. L-glutamic acid alpha-amide has been shown to inhibit the inflammatory response in the bowel disease, Crohn's disease, by blocking the toll-like receptor 4 and 5. This drug also inhibits protein synthesis, which may be due to its ability to bind to fatty acids, thereby inhibiting the production of proteins vital for cell division.</p>Formula:C5H10N2O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:146.14 g/molN-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt
CAS:<p>The N-[(RS)-1-carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is a synthetic substrate for the study of metalloendopeptidase. This compound was used to develop a model system to study the function of human liver, and has been shown to inhibit the growth of PC12 cells. The N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is also an experimental model for congestive heart failure. This compound has been shown to increase glomerular filtration rate in experimental animals as well as basic fibroblast growth factor activity in cell culture by increasing intracellular calcium levels.</p>Formula:C32H36N4O7Purity:Min. 95%Molecular weight:588.65 g/molFmoc-L-aspartic acid β-methylpentyl ester
CAS:<p>Fmoc-L-aspartic acid b-methylpentyl ester is a solid phase synthesis of Asp(OtBu)-OH that has been synthesized by reacting aspartic acid with piperidine and methylbenzene. This synthesis has been shown to be effective at temperatures below 25°C, to minimize the formation of water, and to be resistant to treatments with strong acids or bases. The synthesis has also been optimized for the peptidyl bond formation and peptide synthesis, resulting in enhanced yields.</p>Formula:C25H29NO6Purity:Min. 95%Color and Shape:White PowderMolecular weight:439.5 g/molC5a Anaphylatoxin (37-53) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about C5a Anaphylatoxin (37-53) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H141N27O22SPurity:Min. 95%Molecular weight:1,889.23 g/mol4-Methoxyphenyl boronic acid
CAS:<p>4-Methoxyphenyl boronic acid is a molecule with a hydroxyl group and a boronic acid. It is synthesized by reacting biphenyl with trifluoroacetic acid in the presence of sodium carbonate and palladium-catalyzed coupling. 4-Methoxyphenyl boronic acid has shown to bind to the receptor for fatty acids, which may be due to its structural similarity to p-hydroxybenzoic acid. The protonated form of this molecule has been shown to react with an electrophilic carbon atom and an electron-deficient alkyl or vinyl halide, resulting in ring formation. This reaction is known as the Suzuki coupling reaction.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:PowderMolecular weight:151.96 g/molSPARC (119-122) (mouse) acetate salt
CAS:<p>SPARC (119-122) (mouse) is an acetate salt of H-Lys-Gly-His-Lys-OH. SPARC (119-122) has been shown to be a mimetic of the c-terminal region of the protein SPARC and can bind to many metal ions including Zn2+, Mn2+, Cu2+, Co2+, Ni2+ and Mg2+. The binding affinity for these metals is dose dependent, with saturation occurring at high concentrations. This property may make this compound a therapeutic target for drug discovery strategies.</p>Formula:C20H36N8O5Purity:Min. 95%Molecular weight:468.55 g/molH-Val-Lys-Lys-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H47N9O5Purity:Min. 95%Molecular weight:529.68 g/mol(Gly14)-Humanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly14)-Humanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C118H202N34O31S2Purity:Min. 95%Molecular weight:2,657.21 g/mol(D-Trp6)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13·xC2H4O2Purity:Min. 95%Molecular weight:1,311.45 g/mol(D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H106N22O12Purity:Min. 95%Molecular weight:1,375.67 g/molAcetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N32O21Purity:Min. 95%Molecular weight:2,240.7 g/molDL-4-Hydroxymandelic acid
CAS:<p>DL-4-Hydroxymandelic acid is a phenolic acid that belongs to the family of organic acids. It is synthesized from 4-hydroxyphenylpyruvate and p-hydroxybenzoic acid by an enzyme called hydroxylase in the liver. The frequency shift in DL-4-Hydroxymandelic acid is caused by the hydrogen bonding between its hydroxyl group and pyran ring. This reaction occurs spontaneously, with no need for a catalyst or a change in pH. The reaction mechanism starts with the addition of water to the molecule, which results in an intermediate that breaks down into two molecules of formaldehyde and one molecule of formate. The reaction solution was found to be acidic because it contained H+ ions (H+).</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molCRAMP (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H302N50O46Purity:Min. 95%Molecular weight:3,878.61 g/molPeptide YY (3-36) trifluoroacetate salt
CAS:<p>Peptide YY (PYY) is a 36-amino acid peptide. It is cleaved from the larger protein, pancreatic polypeptide, by the enzyme dipeptidyl peptidase IV and circulates in plasma as PYY(3-36). The postprandial plasma levels of PYY are dose-dependent and increase with increasing doses of injected PYY. This response reflects the physiological effects of this hormone. A linear regression analysis revealed that PYY(3-36) has a significant effect on body weight loss and body mass index in humans. The effective dose for weight loss is yet to be determined, but it may be higher than 10 μg/kg/day.</p>Formula:C176H272N52O54Purity:Min. 95%Molecular weight:3,980.36 g/molAngiotensin (1-12) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin (1-12) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N19O17Purity:Min. 95%Molecular weight:1,572.81 g/molN-Methyliminodiacetic Acid
CAS:<p>N-Methyliminodiacetic acid is a monosodium salt that is produced by the reaction of methylamine and malonic acid. It has been shown to have an inhibitory effect on enzymes and metabolic rates in the human body. The structure of N-methyliminodiacetic acid contains a hydroxyl group, which can form hydrogen bonding interactions with nitrogen atoms in proteins, forming a chelate ligand. This type of binding is thought to be responsible for its ability to inhibit enzyme activities and metabolic rate.</p>Formula:C5H9NO4Purity:Min. 95%Molecular weight:147.13 g/mol3-(2-Cyanopropan-2-yl)benzoic acid
CAS:<p>Please enquire for more information about 3-(2-Cyanopropan-2-yl)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2Purity:Min. 95%Molecular weight:189.21 g/molDibenzoyl-D-(+)-tartaric acid monohydrate
CAS:<p>Dibenzoyl-D-(+)-tartaric acid monohydrate is a weak organic acid that can be used as a neutralizing agent. It has been shown to react with hydrochloric acid, calcium carbonate, and other inorganic acids to form water soluble salts. This compound is also useful for the separation of enantiomers in chromatography and for the determination of the rate of reaction between an organic molecule and an inorganic acid. Dibenzoyl-D-(+)-tartaric acid monohydrate has been used as a template molecule for determining thermodynamic data on various molecules.</p>Formula:C18H14O8·H2OPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:376.31 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/mol(Tyr9)-β-MSH (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H140N24O30SPurity:Min. 95%Molecular weight:2,202.4 g/molO-Hippuryl-L-b-phenyllactic acid sodium salt
CAS:<p>Please enquire for more information about O-Hippuryl-L-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/molDnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H64N14O11Purity:Min. 95%Molecular weight:977.08 g/mol4-Fluoro-2-(trifluoromethyl)phenylboronic acid
CAS:<p>The process development of 4-fluoro-2-(trifluoromethyl)phenylboronic acid (4FTFPBA) is a simplified procedure that can be scaled up and used for medicinal chemistry. This compound was synthesized by a boronic acid process using the Suzuki-Miyaura cross coupling reaction. The major factor to consider in this synthesis is the placement of the fluorine atom, which determines the relative reactivity and stability of the compound. In order to mimic these factors, an environment with low water content and a sequence that minimizes exposure to air are required.</p>Formula:C7H5BF4O2Purity:Min. 95%Color and Shape:PowderMolecular weight:207.92 g/molβ-Casomorphin (1-4) (bovine) acetate salt
CAS:<p>Beta-Casomorphin (1-4) is a tetrapeptide that is derived from the amino acid sequence of bovine beta-casein. It inhibits the binding of opioid receptors and has been shown to have an inhibitory effect on muscle activity. Beta-Casomorphin (1-4) has also been shown to have a stabilizing effect on the genotype, which may be due to its ability to bind to DNA. Beta-Casomorphin (1-4) is detectable in urine and can be used as a marker for assessing the effectiveness of treatments in infants with Colic.</p>Formula:C28H34N4O6Purity:Min. 95%Molecular weight:522.59 g/molAbz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H114N26O18Purity:Min. 95%Molecular weight:1,595.81 g/molD-Aspartic acid
CAS:<p>D-Aspartic acid is a basic protein that binds to glutamate. It has been shown to be effective in the prevention and treatment of bone cancer in mice. D-Aspartic acid also has an inhibitory effect on the production of estradiol benzoate, which is an enzyme responsible for bone resorption. D-Aspartic acid may also be used as a dietary supplement for bowel disease and bowel motility.<br>D-Aspartic acid has been shown to have receptor activity in humans and to have physiological effects on the locomotor activity of rats. The complex enzyme d-aspartate oxidase can be inhibited by d-aspartic acid.</p>Formula:C4H7NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:133.1 g/molEtiroxate carboxylic acid
CAS:<p>Please enquire for more information about Etiroxate carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H13I4NO4Purity:Min. 95%Molecular weight:790.9 g/molC-Peptide (human) trifluoroacetate salt
CAS:<p>C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molNeuropeptide Y (22-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (22-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H139N29O21Purity:Min. 95%Molecular weight:1,903.2 g/mol(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Controlled Product<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2·C12H23NPurity:Min. 95%Molecular weight:370.53 g/molA-VI-5 acetate salt
CAS:<p>Please enquire for more information about A-VI-5 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H40N6O10Purity:Min. 95%Molecular weight:548.59 g/molBombesin trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C71H110N24O18SPurity:Min. 95%Molecular weight:1,619.85 g/mol1-(Mercaptomethyl)cyclopropaneacetic acid
CAS:<p>1-(Mercaptomethyl)cyclopropaneacetic acid is a reaction product of hydrolysis, transfer, and industrialization. It is used in the synthesis of organic compounds such as quinolinediols and thioureas. 1-(Mercaptomethyl)cyclopropaneacetic acid is typically prepared by the reaction of an alkylsulfonyl chloride with an inorganic base such as lithium or sodium carbonate in an organic solvent such as acetonitrile. The compound is also used to produce other organosulfur compounds, including imino sulfides and disulfides.</p>Formula:C6H10O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:146.21 g/molMatrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt
CAS:<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H75N9O11·C2HF3O2Purity:Min. 95%Molecular weight:1,080.2 g/molAngiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Angiotensin I/II (1-7) trifluoroacetate salt is a selective inhibitor of angiotensin II. It blocks the activity of angiotensin II, and thereby prevents the activation of growth factor-β1, which leads to a decrease in pulmonary hypertension. The drug has also been shown to be effective in blocking dextran sulfate absorption, as well as preventing bowel disease by inhibiting receptor activity. Angiotensin I/II (1-7) trifluoroacetate salt has been shown to have an anti-inflammatory effect on the cardiovascular system by blocking cell signaling pathways and reducing blood pressure. This drug is used for treatment of metabolic disorders such as atherosclerotic lesion, cardiac diseases such as coronary heart diseases, and bowel disease.</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/molCorticostatin I (rabbit) trifluoroacetate salt
CAS:<p>Please enquire for more information about Corticostatin I (rabbit) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C163H259N63O44S6Purity:Min. 95%Molecular weight:3,997.59 g/molAmyloid β-Protein (1-42) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-42) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O60SPurity:Min. 95%Molecular weight:4,514.04 g/molTri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate
CAS:<p>Tri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate (TBA) is a gadolinium chelate that is used as a contrast agent in magnetic resonance imaging. TBA binds to the malignant cells and shows an increase in uptake of the gadolinium contrast agent. TBA has been shown to be effective in the diagnosis of cancerous brain tissue and is also able to detect cancer cells in animals. TBA has shown some efficacy against bacterial infection by binding to the cell membrane and inhibiting protein synthesis. It is also able to act synergistically with antibiotics such as penicillin or ampicillin to kill bacteria more effectively.</p>Formula:C28H52N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:572.73 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt is a peptide that binds to the α5β1 integrin receptor. It has been shown to inhibit the growth of carcinoma cell lines and induce apoptosis in tumor cells by binding to receptors on the surface of cancer cells. H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt has also been shown to be effective against damaged tissue, such as adhesions, and promote wound healing by stimulating collagen production. This agent also has genotoxic effects and can cause DNA damage. H-Gly-Arg-Ala-Asp-Ser-Pro -OH trifluoroacetate salt may also have an antiapoptotic effect through its ability to bind with basic proteins, proapoptotic proteins, and epidermal growth factor receptor.</p>Formula:C23H39N9O10Purity:Min. 95%Molecular weight:601.61 g/molEthyl diphenylacetate
CAS:<p>Ethyl diphenylacetate is a trifluoromethyl group that has the potential for use as a fungicide. The hydrochloride salt of this compound exhibits high activity against various fungi, such as Rhizoctonia solani, Sclerotium rolfsii, and Botrytis cinerea. Ethyl diphenylacetate has also been shown to be an effective herbicide in plants, as it inhibits the enzyme acetolactate synthase and prevents the formation of branched-chain amino acids. It can also inhibit germination of seeds.</p>Formula:C16H16O2Purity:Min. 95%Molecular weight:240.3 g/mol6-Maleimidocaproic acid N-hydroxysuccinimide ester
CAS:<p>6-Maleimidocaproic acid N-hydroxysuccinimide ester (6MCA-NHS) is a fluorescent probe that reacts with the hydroxyl group of fatty acids in human serum and other biological samples. 6MCA-NHS binds to the carboxylic acid group at the end of a fatty acid molecule, forming a covalent bond. This process generates light emission that can be detected by a fluorescence probe to measure changes in pH or other chemical properties within the solution. 6MCA-NHS has been used as a tumor treatment, where laser ablation is used to break up tumor cells and release 6MCA-NHS into the cytoplasm. The drug can then bind to DNA molecules and inhibit protein synthesis, which results in cell death.</p>Formula:C14H16N2O6Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:308.29 g/mol5-bromo-2-(trifluoromethyl)benzoic Acid
CAS:<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H4BrF3O2Purity:Min. 95%Molecular weight:269.02 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Molecular weight:555.63Lysozyme C (46-61) (chicken) trifluoroacetate salt
CAS:<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>Formula:C72H116N22O29Purity:Min. 95%Molecular weight:1,753.82 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/mol(Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H312N58O60SPurity:Min. 95%Molecular weight:4,557.07 g/mol3,4,5-Trimethoxybenzoic acid anhydride
CAS:<p>3,4,5-Trimethoxybenzoic acid anhydride is a synthetic chemical compound that is used as a pharmaceutical intermediate. It is mainly used to prepare potent anticancer agents and potent anticancer drugs. 3,4,5-Trimethoxybenzoic acid anhydride reacts with amines in the presence of a base to form substituted amides. This reaction has been shown by crystal x-ray diffraction to be sensitive to the solvent polarity and temperature of the reaction medium. The compound can also react with chloride ion to form 3,4,5-trichlorobenzoic acid anhydride (3TCBA).</p>Formula:C20H22O9Purity:(%) Min. 85%Color and Shape:PowderMolecular weight:406.38 g/molNeuropeptide S (1-10) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H68N14O14SPurity:Min. 95%Molecular weight:1,025.14 g/mol3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid
CAS:<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>Formula:C12H12O4F2Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:258.22 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%GRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/mol
