
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
pTH (1-84) (dog) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C414H672N122O128S2Purity:Min. 95%Molecular weight:9,470.64 g/mol4-(Dodecyloxy)benzoic Acid
CAS:<p>4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.</p>Purity:Min. 95%3,5-Difluorobenzoic acid
CAS:<p>3,5-Difluorobenzoic acid is a pharmaceutical preparation that has been used in the treatment of inflammatory diseases and cancer. It is an enantiomer of 5-Fluorobenzoic acid. 3,5-Difluorobenzoic acid can be synthesized from 2,4-dichlorophenoxyacetic acid by cycloaddition process with fluorine. Magnetic resonance spectroscopy has shown that 3,5-Difluorobenzoic acid binds to oxytocin receptor. The binding of 3,5-Difluorobenzoic acid to oxytocin receptor leads to the activation of its G protein coupled receptor activity. This causes an increase in intracellular cAMP levels and subsequently leads to the inhibition of bacterial enzyme ns3 protease and cardiac hypertrophy induced by chronic angiotensin II infusion.</p>Purity:Min. 95%Biotinyl-Substance P trifluoroacetate salt
CAS:<p>Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.</p>Formula:C73H112N20O15S2Purity:Min. 95%Molecular weight:1,573.93 g/molUroguanylin Topoisomer A (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/molDnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt
<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H64N14O12SPurity:Min. 95%Molecular weight:965.09 g/molDABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formula:C61H76N12O14SPurity:Min. 95%Molecular weight:1,233.39 g/mol2-[(5-Chloropyridin-2-yl)amino]-2-oxoacetic acid ethyl ester monohydrochloride
CAS:<p>Intermediate in the synthesis of edoxaban</p>Formula:C9H9ClN2O3·HClPurity:Min. 95%Molecular weight:265.09 g/mol4-Fluorobenzoic acid
CAS:<p>4-Fluorobenzoic acid is a chemical compound with the molecular formula C6H4FO2 and is a member of the group of chemicals known as carboxylic acids. It has been shown to have high levels of antibacterial activity against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). 4-Fluorobenzoic acid can be used for wastewater treatment and also has the potential to be used in other applications such as an antimicrobial agent or an additive in food packaging. The mechanism of its antibacterial activity is not well understood but may be related to its ability to inhibit the enzyme diphenolase, which catalyzes the conversion of phenols into quinones.</p>Formula:C7H5FO2Purity:Min. 95%Color and Shape:White To Yellow SolidMolecular weight:140.11 g/molFulvic acid
CAS:<p>Fulvic acid is a natural organic compound that has been used in clinical and biological properties. It is a fluorescent molecule with a high quantum yield, which makes it an ideal candidate for use as a fluorescence probe. Fulvic acid has been shown to form stable complexes with malonic acid, which may be due to the strong hydrogen bonding interactions between these two molecules. The fluorescence emission spectrum of fulvic acid is sensitive to the pH of the reaction solution, and it can be used as a thermodynamic data indicator. Fulvic acid also has low toxicity, which makes it suitable for use in laboratory studies.</p>Formula:C14H12O8Purity:Min. 90%Color and Shape:PowderMolecular weight:308.24 g/mol3-Fluoro-2-nitrobenzoic acid
CAS:<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/mol3,4,5-Trichlorobenzoic acid
CAS:<p>Trichlorobenzoic acid is a chemical compound that is found in plants, such as Trifolium pratense L. and other legumes. It has been shown to inhibit the growth of bacteria by competitive inhibition of the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxyribonucleotides. This prevents the production of RNA, which is necessary for protein synthesis and cell division. Inhibition of this enzyme can be achieved by either conjugating trichlorobenzoic acid with a sugar or using ion-exchange resins to remove it from water. The concentration required for this type of inhibition varies depending on the type of organism, but generally ranges between 5-10 ppm.END></p>Purity:Min. 95%Benzopyrazine-6-boronic acidHCl
CAS:<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8BClN2O2Purity:Min. 95%Molecular weight:210.43 g/molTRH-AMC acetate salt
CAS:<p>TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt is a potent and selective histidine kinase inhibitor that modulates the activity of many enzymes. TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt has a molecular weight of 476.9 g/mol and chemical formula C12H14N2O4S. The compound was synthesized by reacting tris(2,4,6-trimethoxybenzoyl)amine with pyridoxal 5'-phosphate and histidine in acetic acid. The synthesis reaction yielded a white solid that was then recrystallized from methanol to yield the final product. TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt has been shown to inhibit the enzymatic activity of numerous enzymes at nanomolar concentrations including: protein kinases, phosphatases, ligases</p>Formula:C26H28N6O6Purity:Min. 95%Molecular weight:520.54 g/molAlloferon - in acetate salt
CAS:<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>Formula:C52H75N22O16Purity:Min. 95%Molecular weight:1,264.29 g/mol[p-Terphenyl]-4,4''-dicarboxylic acid
CAS:<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>Formula:C20H14O4Purity:Min. 95%Molecular weight:318.32 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/molTGF α (1-50) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C244H361N71O71S6Purity:Min. 95%Molecular weight:5,617.31 g/mol2-Methoxyethyl acetoacetate
CAS:<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>Formula:C7H12O4Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:160.17 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS:<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O6Purity:Min. 95%Molecular weight:481.55 g/molH-Ala-His-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H19N5O4Purity:Min. 95%Molecular weight:297.31 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/molOrexin A (17-33) trifluoroacetate salt
CAS:<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>Formula:C79H125N23O22Purity:Min. 95%Molecular weight:1,748.98 g/moltert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N2O3Purity:Min. 95%Molecular weight:256.34 g/molVIP (4-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP (4-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H221N39O36SPurity:Min. 95%Molecular weight:2,986.5 g/molZ-Val-Lys-Met-AMC acetate salt
CAS:<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>Formula:C34H45N5O7SPurity:Min. 95%Molecular weight:667.82 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N10O7Purity:Min. 95%Molecular weight:646.74 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H293N53O48S2Purity:Min. 95%Molecular weight:4,007.69 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS:Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C25H36N8O7SPurity:Min. 95%Molecular weight:592.67 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H41N9O8Purity:Min. 95%Molecular weight:619.67 g/molToxin GaTx1 trifluoroacetate salt
<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H224N46O47S9Purity:Min. 95%Molecular weight:3,676.23 g/mol2-Bromo-2'-chlorophenyl acetic acid methyl ester
CAS:<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>Formula:C9H8BrClO2Purity:Min. 95%Molecular weight:263.52 g/molOvokinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H67N13O11Purity:Min. 95%Molecular weight:1,002.13 g/mol3-Hydroxy-3-methylglutaric acid
CAS:<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>Formula:C6H10O5Purity:Min. 95%Molecular weight:162.14 g/molDehydroacetic acid sodium salt
CAS:<p>Dehydroacetic acid sodium salt is a chemical compound with the formula CH3COOCH2NaO2. It is an ionic liquid that can be used as a preservative or stabilizer in foods and other products. Dehydroacetic acid sodium salt has been shown to inhibit the growth of bacteria and fungi in biological studies. The analytical method for dehydroacetic acid sodium salt is based on x-ray diffraction data, which is used to identify its purity and concentration. The reaction solution includes dehydroacetic acid, water vapor, sodium salts, phosphorus pentoxide, and control analysis.</p>Formula:C8H7O4NaPurity:Min. 95%Color and Shape:PowderMolecular weight:190.13 g/mol5,7-Dimethyl-[1,2,4]triazolo[1,5-a]pyrimidine-2-carboxylic acid
CAS:<p>Please enquire for more information about 5,7-Dimethyl-[1,2,4]triazolo[1,5-a]pyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8N4O2Purity:Min. 95%Molecular weight:192.17 g/molp-Sulfophenylazochromotropic acid trisodium salt
CAS:<p>p-Sulfophenylazochromotropic acid trisodium salt is a chemical that can be used as a building block for the synthesis of various organic compounds. It is an intermediate for the synthesis of other chemicals and can be used as a research chemical in laboratories. This compound has been shown to be useful in the production of pharmaceuticals, agrochemicals, and dyes. CAS No. 23647-14-5.</p>Formula:C16H9N2Na3O11S3Purity:Min. 95 Area-%Color and Shape:Yellow PowderMolecular weight:570.42 g/mol(D-Trp6)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13·xC2H4O2Purity:Min. 95%Molecular weight:1,311.45 g/mol(Gly14)-Humanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly14)-Humanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C118H202N34O31S2Purity:Min. 95%Molecular weight:2,657.21 g/mol[4-(1-Cyano-1-methylethyl)phenyl]boronic acid
CAS:<p>Please enquire for more information about [4-(1-Cyano-1-methylethyl)phenyl]boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12BNO2Purity:Min. 95%Molecular weight:189.02 g/mol(1-Methyl-1H-pyrazol-4-yl)boronic acid
CAS:<p>(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.</p>Formula:C4H7BN2O2Purity:Min. 95%Molecular weight:125.92 g/mol(Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H225N43O50SPurity:Min. 95%Molecular weight:3,498.75 g/molBAM-22P (8-22) trifluoroacetate salt
CAS:<p>BAM-22P (8-22) trifluoroacetate salt is a compound that has been shown to be an effective drug for the treatment of pain. It has been shown to have an effect on bone cancer, which can be activated by serotonin. This compound may be beneficial in treating nerve injury and fibrosarcoma cells. BAM-22P (8-22) trifluoroacetate salt is an allosteric modulator of the serotonin receptor and may be used as a treatment for pain in wild-type mice. The molecule is also a serotonin reuptake inhibitor, which prevents the reuptake of serotonin into the presynaptic neuron. This leads to increased levels of serotonin in the synapse and increased pain relief.</p>Formula:C91H127N25O23SPurity:Min. 95%Molecular weight:1,971.2 g/molMelanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H72N10O15Purity:Min. 95%Molecular weight:1,005.12 g/molN-Des(2-diethylamino) metoclopramide acetic acid
CAS:<p>N-Des(2-diethylamino) metoclopramide acetic acid is a benzyl ester of metoclopramide, a prodrug that is metabolized to the active form in the body. It has been shown to be effective against healthy human subjects and hplc analyses of biological samples have shown it to be a metabolite of metoclopramide. N-Des(2-diethylamino) metoclopramide acetic acid is used as a catalyst for catalytic hydrogenation reactions, such as the conversion of methyl esters into ethyl or butyl esters. It can also be used for catalytic hydrogenation reactions with diazomethane, such as those required for the synthesis of quinolones.</p>Formula:C10H11ClN2O4Purity:Min. 95%Molecular weight:258.66 g/mol4-Methoxyphenyl boronic acid
CAS:<p>4-Methoxyphenyl boronic acid is a molecule with a hydroxyl group and a boronic acid. It is synthesized by reacting biphenyl with trifluoroacetic acid in the presence of sodium carbonate and palladium-catalyzed coupling. 4-Methoxyphenyl boronic acid has shown to bind to the receptor for fatty acids, which may be due to its structural similarity to p-hydroxybenzoic acid. The protonated form of this molecule has been shown to react with an electrophilic carbon atom and an electron-deficient alkyl or vinyl halide, resulting in ring formation. This reaction is known as the Suzuki coupling reaction.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:PowderMolecular weight:151.96 g/mol2-Amino-5-(trifluoromethoxy)benzoic acid
CAS:<p>Please enquire for more information about 2-Amino-5-(trifluoromethoxy)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H6F3NO3Purity:Min. 95%Molecular weight:221.13 g/molC-Type Natriuretic Peptide (1-53) (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C251H417N81O71S3Purity:Min. 95%Molecular weight:5,801.7 g/mol2-[(3,5,6-Trichloro-2-pyridinyl)oxy]acetic acid
CAS:<p>Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.</p>Formula:C7H4Cl3NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:256.47 g/molBradykinin (1-5) trifluoroacetate salt
CAS:<p>Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH is a peptide that has been shown to have anti-cancer properties. The effect of Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH on prostate cancer cells was studied in vitro by measuring the extent of cell growth. The results showed a dose dependent decrease in tumor growth rate, suggesting that this peptide may be useful as an adjuvant therapy for prostate cancer. Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe has also been shown to inhibit diabetic nephropathy and reduce proteinuria in diabetic patients. This peptide may also be used to diagnose prostate cancer because it binds to the thrombin receptor, which is present on cancer cells but not</p>Formula:C27H40N8O6Purity:Min. 95%Molecular weight:572.66 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H83N17O13Purity:Min. 95%Color and Shape:PowderMolecular weight:1,274.43 g/moltrans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate
CAS:<p>Trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate (CDTA) is a chelating agent that has been shown to be effective in the treatment of some cancers. CDTA has been shown to inhibit the growth of tumor cells by binding to lysine residues on histones and DNA and inhibiting their acetylation. CDTA also prevents the genotoxicity induced by irradiation. CDTA can be used as an adjuvant in cancer therapy due to its ability to inhibit histone deacetylase activity. Trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate is synthesized from two amino acids: lysine and glutamic acid. This molecule is a polymeric compound composed of cyclic molecules linked together through amide bonds. These polymers are linear chains of</p>Formula:C14H22N2O8·H2OColor and Shape:White PowderMolecular weight:364.35 g/molTyr-α-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-alpha-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C172H276N52O51S2Purity:Min. 95%Molecular weight:3,952.48 g/mol(His(3-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13·C2HF3O2Purity:Min. 95%Molecular weight:1,310.34 g/molNeuropeptide W-23 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-23 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C119H183N35O29SPurity:Min. 95%Molecular weight:2,600.01 g/mol(2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid
CAS:<p>Please enquire for more information about (2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H8FNO2Purity:Min. 95%Molecular weight:133.12 g/molmeso-Tartaric acid monohydrate
CAS:<p>Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon</p>Formula:C4H6O6·H2OPurity:Min. 95%Color and Shape:White PowderMolecular weight:168.1 g/molAmyloid b-Protein (6-20) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H119N23O23Purity:Min. 95%Molecular weight:1,843.01 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/molBiphalin trifluoroacetate salt (
CAS:<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>Formula:C46H56N10O10Purity:Min. 95%Molecular weight:909 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/mol(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.</p>Formula:C121H190N34O35Purity:Min. 95%Molecular weight:2,681.01 g/molBombesin (8-14) acetate salt
CAS:<p>Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt is a bifunctional peptide that has been shown to inhibit the growth of prostate cancer cells. Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt also has antiinflammatory properties and is used in treating inflammatory diseases. It inhibits collagen synthesis and fibrinogen activation, which may be important in the treatment of autoimmune diseases such as rheumatoid arthritis. Bombesin (8 14) acetate salt H Trp Ala Val Gly His Leu Met NH2 Acetate Salt has been shown to have no effect on healthy tissues when administered systemically.</p>Formula:C38H57N11O7SPurity:Min. 95%Molecular weight:812 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/molH-Arg-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-Arg-OH acetate salt is a polycarboxylic acid that is found in human immunoglobulins. It has been used as a synthetic substrate for the study of radiation enhancement. H-Arg-Arg-Arg-OH acetate salt is also an allergen and can cause allergic reactions, such as itching and swelling. This compound can be used to study the neutral pH, chemical reactions, protein synthesis, and the hydroxyl group.</p>Formula:C18H38N12O4Purity:Min. 95%Molecular weight:486.57 g/molAbz-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H58N12O16Purity:Min. 95%Molecular weight:986.98 g/molNeuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H310N58O61S2Purity:Min. 95%Molecular weight:4,627.14 g/molLHRH (4-10) acetate salt
CAS:<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H53N11O9Purity:Min. 95%Molecular weight:747.84 g/molH-Met-Arg-OH acetate salt
CAS:<p>H-Met-Arg-OH acetate salt is a metabolite of the amino acid L-methionine. It is also a dipeptide, which consists of two amino acids that are linked by an amide bond. The linkage between the amino acids in this compound is clockwise instead of the usual left to right orientation. This means that H-Met-Arg-OH acetate salt is not an essential amino acid and can be synthesized by the body. Salmonella typhimurium uses H-Met-Arg-OH acetate salt as a precursor for its synthesis of L-arginine and L-methionine, which are essential to bacterial growth and survival. Residues have been found in foods such as milk and eggs, and it has been shown that cotransduction can lead to resistance against antibiotics such as streptomycin and tetracycline.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/molPHM-27 (human) trifluoroacetate salt
CAS:<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>Formula:C135H214N34O40SPurity:Min. 95%Molecular weight:2,985.41 g/molDiisopropyl azodicarboxylate - 40% toluene solution
CAS:<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>Formula:C8H14N2O4Purity:Min. 95%Color and Shape:Yellow To Yellow Orange LiquidMolecular weight:202.21 g/mol4,4',4''-Nitrilotribenzoic acid
CAS:<p>4,4',4''-Nitrilotribenzoic acid is a low molecular weight activated compound with a hexane molecule and luminescence properties. This compound has been used in the detection of human pathogens, for example, Salmonella enterica serovar Typhimurium. The uptake of 4,4',4''-nitrilotribenzoic acid by these bacteria has been shown to be due to its peroxidase-like activity. 4,4',4''-Nitrilotribenzoic acid has also been used for the activation of polybenzimidazole and for polymerization reactions in polybenzimidazole films. The time required for polymerization depends on the concentration of 4,4',4''-nitrilotribenzoic acid used.</p>Formula:C21H15NO6Purity:Min. 95%Molecular weight:377.35 g/molH-Val-Lys-OH monoacetate salt
CAS:<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H23N3O3•C2H4O2Purity:Min. 95%Molecular weight:305.37 g/mol2-Bromo-3-methylbenzoic acid
CAS:<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>Formula:C8H7BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:215.04 g/molBradykinin (2-7) acetate salt
CAS:<p>Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40N6O8Purity:Min. 95%Molecular weight:600.66 g/molH-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/mol(Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molKemptide trifluoroacetate salt
CAS:<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>Formula:C32H61N13O9·xC2HF3O2Purity:Min. 95%Molecular weight:771.91 g/mol(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H308N58O53Purity:Min. 95%Molecular weight:4,324.9 g/molPyrrole-2-carboxylic acid
CAS:<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>Formula:C5H5NO2Purity:Min. 95%Molecular weight:111.1 g/mol(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H30N4O4S2Purity:Min. 95%Molecular weight:550.69 g/molH-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H49N7O11Purity:Min. 95%Molecular weight:659.73 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/mol3-Benzoyl acrylic acid
CAS:<p>3-Benzoyl acrylic acid is an organic compound that is the product of a chemical reaction between benzaldehyde and acetic anhydride. It contains a carboxylic acid group, an hydroxyl group, a nitro group, and a particle. 3-Benzoyl acrylic acid has been shown to inhibit the growth factor epidermal growth factor (EGF). This inhibition occurs by binding to the receptor for EGF on the cell membrane and blocking its activation. 3-Benzoyl acrylic acid also inhibits fatty acid synthesis and mitochondrial membrane potential, which may be due to its ability to form ester hydrochloride.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:PowderMolecular weight:176.17 g/molDimethyl benzyl carbinol acetate
CAS:<p>Dimethyl benzyl carbinol acetate is a polymer that forms a film on the skin and prevents water loss. It has been shown to have enzyme-inhibiting properties, which may be due to its ability to prevent geranyl production. Dimethyl benzyl carbinol acetate has also been used as a sealant in microcapsules, which are then broken down by enzymes in order to release the contents of the capsule. Dimethyl benzyl carbinol acetate can also be used as an antimicrobial agent, where it inhibits bacterial cell growth by interfering with fatty acid synthesis.</p>Purity:Min. 95%(4-Chloro-3-fluorophenyl)acetic acid ethyl ester
CAS:<p>Please enquire for more information about (4-Chloro-3-fluorophenyl)acetic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H10ClFO2Purity:Min. 95%Molecular weight:216.64 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/molD-α-Hydroxyisovaleric acid
CAS:<p>D-alpha-Hydroxyisovaleric acid is a compound that is used to synthesize stereoisomers. It is also a component of supramolecular chemistry and has been used in the construction of supramolecular polymers. D-alpha-Hydroxyisovaleric acid can be found in some plants, such as valinomycin, isovaleric acid, and metarhizium. This stereoisomer can be synthetized from the hydroxy group and an amino acid or peptide. D-alpha-Hydroxyisovaleric acid has the ability to degrade nonribosomal peptides into smaller molecules through its hydrolytic properties. It also inhibits Verticillium dahliae, which causes wilt disease in plants, by inhibiting the synthesis of hydroxycarboxylates. D-alpha-Hydroxyisovaleric acid is biodegradable and can be used for industrial purposes as well as pharmaceuticals.</p>Formula:C5H10O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:118.13 g/molH-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
CAS:L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.Formula:C21H42N6O5Purity:Min. 95%Molecular weight:458.6 g/molNeuronostatin-13 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-13 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H112N20O17Purity:Min. 95%Molecular weight:1,445.71 g/molAc-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H43N10O12PPurity:Min. 95%Molecular weight:742.67 g/molBeclomethasone 21-acetate 17-propionate
CAS:Controlled Product<p>Please enquire for more information about Beclomethasone 21-acetate 17-propionate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H35ClO7Purity:Min. 95%Molecular weight:507.02 g/molOsteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H42N10O7Purity:Min. 95%Molecular weight:618.69 g/molBiotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C148H223N43O42S3Purity:Min. 95%Molecular weight:3,372.82 g/molGalanin (2-11) amide trifluoroacetate salt
CAS:<p>Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu is a galanin analog and a ligand for the galanin receptor 1. It has affinity for the receptors in the brain, which are involved in cognition, and is used to study Alzheimer's disease. Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser -Ala -Gly -Tyr -Leu -Leu is a member of the family of neuropeptides and neuromodulators that regulate nerve injury and alzheimer's disease.</p>Formula:C54H81N13O14Purity:Min. 95%Molecular weight:1,136.3 g/mol2-Chlorooxazole-4-carboxylicacid
CAS:<p>2-Chlorooxazole-4-carboxylic acid is a synthetic compound belonging to the group of long-chain aliphatic carboxylic acids. It is an ester that can be synthesized by the reaction of toluene with 2,4-dichlorooxazole. The stereochemical configuration of this molecule is unknown. The synthesis of this compound has been reported in marine invertebrates and plants, including Mycalolide from the marine sponge Mycale sp.</p>Formula:C4H2ClNO3Purity:Min. 95%Molecular weight:147.52 g/molDibenzoyl-(-)-p-methoxy-L-tartaric acid
CAS:<p>Dibenzoyl-(-)-p-methoxy-L-tartaric acid is a chiral compound that has been extracted from plants and synthesized. It has a bitter taste and can be used as an enantiomer to treat schistosomiasis, a disease caused by parasitic flatworms. Dibenzoyl-(-)-p-methoxy-L-tartaric acid can be used as an enantiomer to treat schistosomiasis, which is caused by parasitic flatworms. The chemical is an anionic β-cyclodextrin derivative that binds to the parasites in the host's body and prevents them from releasing eggs into the water supply. This chemical also has pharmacological properties, such as antiinflammatory activities.</p>Formula:C20H18O10Purity:Min. 95%Color and Shape:White PowderMolecular weight:418.35 g/molTRAP-14 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H119N21O22Purity:Min. 95%Molecular weight:1,738.94 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35N3O4Purity:Min. 95%Molecular weight:357.49 g/moltert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate
CAS:<p>Please enquire for more information about tert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23NO3Purity:Min. 95%Molecular weight:229.32 g/molpTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H317N63O53Purity:Min. 95%Molecular weight:4,416.02 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/mol4-Fluorophenoxyacetic acid
CAS:<p>4-Fluorophenoxyacetic acid is a chemical compound that is used as an insecticide. It has been shown to be effective against the planthopper and ipomoea, two agricultural pests. 4-Fluorophenoxyacetic acid binds to the active site of a specific protein in the insect's cells, inhibiting its function and causing cell death. 4-Fluorophenoxyacetic acid also inhibits the growth of human breast cancer cells in culture. The molecular weight of this compound is 180.2 g/mol and has a melting point of 185°C with a boiling point of 232°C at atmospheric pressure. 4-Fluorophenoxyacetic acid can be synthesized by reacting phenol with acetic anhydride in the presence of palladium complexes and nitrogen atoms. The reaction mechanism for this synthesis is nucleophilic addition to form a covalent bond between the nitrogen atom and sulfur atom on one side of the</p>Formula:C8H7FO3Purity:Min. 95%Color and Shape:PowderMolecular weight:170.14 g/molAntifreeze Polypeptide 6 (winter flounder) trifluoroacetate salt
CAS:<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>Formula:C133H225N43O51•xC2HF3O2Purity:Min. 95%Molecular weight:3,242.47 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H222N38O49Purity:Min. 95%Molecular weight:3,161.43 g/mol(Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H76N18O9S2Purity:Min. 95%Molecular weight:1,209.45 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C188H282N52O59S2Purity:Min. 95%Molecular weight:4,278.7 g/molMAGE-1 Antigen (161-169) (human) acetate salt
CAS:<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>Formula:C41H57N11O17Purity:Min. 95%Molecular weight:975.96 g/molCortistatin-17 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H139N27O24S3Purity:Min. 95%Molecular weight:2,151.5 g/mol(D-Trp6)-LHRH (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H81N17O14Purity:Min. 95%Molecular weight:1,312.43 g/molEthyl-2-ethoxy-1-[[(2'-cyanobiphenyl-4-yl) methyl] benzimidazole-7-carboxylate
CAS:<p>Candesartan is a selective angiotensin II receptor antagonist that inhibits the binding of angiotensin II to its receptors, which in turn decreases the activity of angiotensin-converting enzyme. Candesartan cilexetil is an ester prodrug that has been shown to be effective in the treatment of high blood pressure. In the crystalline form, candesartan cilexetil is a white powder with a melting point of 130–135 °C and a solubility in water of >1 g/L. The molecular weight of candesartan cilexetil is 393.8 g/mol and it has a molecular formula C17H21NO2S. The chemical structure consists of two benzimidazole rings coupled together through an ethyl-2-ethoxy linker and attached to a carboxylate group on one end and an amide group on the other</p>Formula:C26H23N3O3Purity:Min. 95%Molecular weight:425.48 g/molNeurokinin A trifluoroacetate salt
CAS:<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>Formula:C50H80N14O14SPurity:Min. 95%Molecular weight:1,133.32 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H203N41O38Purity:Min. 95%Molecular weight:3,080.37 g/molCART (55-102) (human) trifluoroacetate salt
CAS:<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>Formula:C225H365N65O65S7Purity:Min. 95%Molecular weight:5,245.17 g/molPhenyl pyruvic acid
CAS:<p>Phenyl pyruvic acid is a sodium salt of phenylpyruvic acid that can be synthesized from phenylalanine, an amino acid. It has been shown to have antioxidant and anti-inflammatory properties. Phenyl pyruvic acid was found to inhibit oxidative injury caused by sodium nitroprusside in the rat brain, liver, and heart. Phenyl pyruvic acid also increased the activity of 3t3-l1 preadipocytes and improved energy metabolism in these cells. The synthesis of phenylpyruvate is catalyzed by a decarboxylase enzyme and it can be converted into insulin or phenylalanine.</p>Formula:C9H8O3Purity:Min. 95%Color and Shape:PowderMolecular weight:164.16 g/molBiotinyl-MCH (salmon) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H153N29O26S5Purity:Min. 95%Molecular weight:2,325.78 g/molEndomorphin-2 trifluoroacetate salt
CAS:<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/moltert-Butyl carbamate
CAS:<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>Formula:C5H11NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:117.15 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C406H670N122O126S3Purity:Min. 95%Molecular weight:9,372.61 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>Formula:C23H34N6O9Purity:Min. 95%Molecular weight:538.55 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/mol3-Amino-4-methyl-thiophen-2-carboxylic acid methyl ester
CAS:<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>Purity:Min. 95%Molecular weight:171.22 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/mol(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H77N17O11Purity:Min. 95%Molecular weight:1,200.35 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/mol(Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/mol2-Bromoethanesulfonic acid sodium
CAS:<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>Formula:C2H4BrNaO3SPurity:Min. 95%Molecular weight:211.01 g/molSplenopentin acetate salt
CAS:<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>Formula:C31H51N9O9Purity:Min. 95%Molecular weight:693.79 g/molZ-Ala-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N10O6Purity:Min. 95%Molecular weight:690.79 g/mol2,5-Anhydro-3,4-dideoxy-erythro-hexaric acid - 98%
CAS:The synthesis of 2,5-anhydro-3,4-dideoxy-erythro-hexaric acid (2,5AHDHE) is described in detail. The reaction starts with the condensation of 3,4-dideoxy-erythro-hexose with aldehyde and furfural to give the hemiacetal. The ring opening of this hemiacetal leads to the formation of 2,5AHDHE and furfural. The protonation of 2,5AHDHE leads to proton release and bond cleavage. Furfural is reduced to 5-hydroxymethylfurfural (HMF). HMF is then oxidized to hydroxyl group by H2O2. The hydroxyl group reacts with a second molecule of 2,5AHDHE to form a new molecule of 2,5AHDHE and H2O2. This process can be repeated untilFormula:C6H8O5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:160.12 g/molAc-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt
CAS:<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>Formula:C21H31ClN4O11Purity:Min. 95%Molecular weight:550.94 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Nociceptin (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H100N22O15Purity:Min. 95%Molecular weight:1,381.59 g/mol4-Difluoromethoxyphenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-Difluoromethoxyphenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H17BF2O3Purity:Min. 95%Molecular weight:270.08 g/molGalanin-Like Peptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C292H451N83O84SPurity:Min. 95%Molecular weight:6,500.28 g/molDodecylbenzenesulfonic acid, 70% in isopropanol
CAS:<p>Dodecylbenzenesulfonic acid is a sulfonic acid that is used in the production of polyaniline. It is also used as an organic reagent that can be applied in organic synthesis, including polymerization and electrochemical studies. Dodecylbenzenesulfonic acid has been shown to react with sodium salts to form dodecyl benzene, which can be observed by synchronous fluorescence spectroscopy. This chemical has a phase transition temperature of -9°C and a boiling point of 176°C. Dodecylbenzenesulfonic acid is soluble in water vapor, but insoluble in ethanol or acetone.</p>Formula:C18H30O3SPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:326.5 g/molAndrostanolone acetate
CAS:Controlled Product<p>Androstanolone acetate is a synthetic androgen that has been shown to stimulate the production of testosterone in the testes. Androstanolone acetate has been shown to be effective in treating symptoms of male hypogonadism, as well as erectile dysfunction. The drug also has an antigenic effect, which stimulates the production of antibodies against it. Androstanolone acetate binds to cell specific antigens and stimulates cell proliferation. It has been used in cancer prevention studies, where it was found that it could suppress estrogen-induced endometrial cancer in animals. In addition, Androstanolone acetate is capable of stimulating light emission when incubated with cells and can be detected using chromatographic methods.</p>Formula:C21H32O3Purity:Min. 95%Color and Shape:PowderMolecular weight:332.48 g/molBiotinyl-Neuromedin S (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H279N55O46SPurity:Min. 95%Molecular weight:4,017.58 g/molMethyl 3-chlorophenylacetate
CAS:<p>Methyl 3-chlorophenylacetate is a chemical intermediate that has been used in the synthesis of pharmaceuticals and organic compounds. It has also been used as a reagent for research, especially in the study of organic chemistry. Methyl 3-chlorophenylacetate is a versatile building block and can be used as a reaction component to synthesize other chemicals. This compound is also an excellent scaffold for medicinal chemistry.</p>Formula:C9H9ClO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:184.62 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H69ClN12O9S2Purity:Min. 95%Molecular weight:1,177.83 g/molpTH (2-38) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H314N58O53S2Purity:Min. 95%Molecular weight:4,371.06 g/molH-Lys-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H38N6O5Purity:Min. 95%Molecular weight:478.59 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/molBis-ACV trifluoroacetate salt
CAS:<p>Bis-ACV trifluoroacetate salt is a regulatory compound that belongs to the class of bis-acids. It is a cytosolic calcium ionophore that binds to the cytosolic calcium ion channel and regulates its activity. Bis-ACV trifluoroacetate salt also has nucleophilic attack on phosphate groups, which are essential for biosynthesis. The enzyme activity of this compound has been studied in various strains of bacteria such as E. coli and S. cerevisiae, and it was found to be involved in the synthesis of oligosaccharides and polysaccharides. This compound can be solubilized by the addition of sodium bicarbonate or urea, which facilitates its use in synthetic reactions. The synthase gene for this compound has been identified from various strains of bacteria such as E. coli and S. cerevisiae, but not from mammalian cells or plants.</p>Formula:C28H48N6O12S2Purity:Min. 95%Molecular weight:724.85 g/mol4-Pyridinylboronic acid
CAS:<p>4-Pyridinylboronic acid is a boron compound that contains two nitrogen atoms. It is an important reagent in organic synthesis and crystallography. 4-Pyridinylboronic acid has been shown to have biological properties, such as hydrogen bonding interactions. It is also used in the suzuki coupling reaction and the photochemical properties of the reaction solution are dependent on its coordination geometry. 4-pyridinylboronic acid has a high pH value, so it must be prepared in anhydrous sodium carbonate before use. The hydrogen bond between 4-pyridinylboronic acid and an azide is shown below: Nnowiki>/nowiki>Hnowiki>/nowiki>nowiki>/nowiki>Nnowiki>/nowiki>nowiki>/nowiki>H</p>Formula:C5H6BNO2Color and Shape:PowderMolecular weight:122.92 g/mol(R)-(-)-3-Amino-3-phenylpropionic acid
CAS:<p>(R)-(-)-3-Amino-3-phenylpropionic acid is a hydrogenated, stereoselective β-amino acid that is involved in the biosynthesis of animal health. The enzyme acylase catalyzes this reaction by binding with chiral pyridoxal phosphate to form an acylation product. The stereospecificity of the reaction is determined by whether the enzyme has a preference for L or D amino acids. Acylases are found in organisms such as mammals and bacteria.</p>Formula:C9H11NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:165.19 g/molMca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molC-Type Natriuretic Peptide (1-53) (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C251H417N81O71S3Purity:Min. 95%Molecular weight:5,801.7 g/mol(D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H73N11O9S2Purity:Min. 95%Molecular weight:1,192.45 g/molVitamin A acetate - min 2800000 IU/g
CAS:<p>Vitamin A acetate is a retinoid that can be used to supplement dietary intake of vitamin A. It is a synthetic retinoid and is chemically similar to retinol, the natural form of vitamin A. Vitamin A acetate has been shown to have antioxidant properties in vitro and in vivo, which are likely due to its ability to regenerate endogenous antioxidants. This agent also has pro-apoptotic effects on cells that are exposed to oxidative injury or exhibit redox potentials below -400 mV. In addition, it significantly reduces oxidative injury caused by pharmacological agents such as doxorubicin or bleomycin.</p>Formula:C22H32O2Purity:Min 2800000 Iu/GColor and Shape:PowderMolecular weight:328.49 g/molAQEE-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C157H252N48O56Purity:Min. 95%Molecular weight:3,707.97 g/molNeuromedin U-25 (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C144H217N43O37Purity:Min. 95%Molecular weight:3,142.53 g/molH-Glu-Gly-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N8O7Purity:Min. 95%Molecular weight:480.48 g/molTRAP-7 trifluoroacetate salt
CAS:<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>Formula:C39H63N11O10Purity:Min. 95%Molecular weight:845.99 g/mol2-Phenyl-5-benzimidazolesulfonic acid
CAS:<p>2-Phenyl-5-benzimidazolesulfonic acid is a chemical compound that has been shown to have stability in vitro. It was used as a skin cancer treatment in the past, but is now mainly used as an analytical reagent. It has been shown to be effective against coumarin derivatives and enzyme activities. 2-Phenyl-5-benzimidazolesulfonic acid can be used as a chelating agent for metals and also binds to zirconium oxide, which is one of the materials used in radiation shielding. The compound can also be used for wastewater treatment and polymerase chain reaction (PCR) analysis. This compound can be synthesized using sodium salts, solid phase microextraction (SPME), and sodium citrate in order to form the benzene ring. The synthesis can then be completed by adding two phenyl groups onto the benzene ring with various reactions such as transfer reactions or radiation. Finally,</p>Formula:C13H10N2O3SPurity:Min. 95%Molecular weight:274.3 g/molApelin-36 (1-16) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Apelin-36 (1-16) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H117N27O20Purity:Min. 95%Molecular weight:1,704.89 g/molIloprost
CAS:<p>Iloprost is a cyclase inhibitor that is used to treat pulmonary hypertension. It relaxes the smooth muscle cells in the lungs, which causes an increase in blood flow and oxygen levels to the heart and other organs. Iloprost also decreases the production of PGE2 and lowers blood pressure. Iloprost has been shown to be effective in treating chronic viral hepatitis and pulmonary diseases such as primary pulmonary hypertension. This drug can cause hypotension, so it should not be taken by patients with low blood pressure or those who are taking other drugs that can cause hypotension.</p>Formula:C22H32O4Purity:Min. 95%Color and Shape:Solidified MassMolecular weight:360.49 g/mol(Lys18)-Pseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H203N37O32Purity:Min. 95%Molecular weight:2,700.15 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>Formula:C75H110N24O16S2Purity:Min. 95%Molecular weight:1,667.96 g/molAmyloid β-Protein (1-16) trifluoroacetate salt
CAS:<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Formula:C84H119N27O28Purity:Min. 95%Molecular weight:1,955.01 g/molBNP-45 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about BNP-45 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C209H354N70O63S2Purity:Min. 95%Molecular weight:4,919.61 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/mol4-tert-Butylphenylboronic acid
CAS:<p>4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.</p>Formula:C10H15BO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:178.04 g/mol(Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H69N9O8Purity:Min. 95%Molecular weight:852.07 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H70N12O20Purity:Min. 95%Molecular weight:1,195.19 g/molH-Ala-Ala-Ala-OMe acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N3O4Purity:Min. 95%Molecular weight:245.28 g/molPseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/molMet-RANTES (human) trifluoroacetate salt
<p>Please enquire for more information about Met-RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C355H543N97O101S6Purity:Min. 95%Molecular weight:7,978.1 g/mol(D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H72N14O12Purity:Min. 95%Molecular weight:1,085.22 g/molBenzyl acetate
CAS:<p>Benzyl acetate is a colorless liquid that has a pleasant odor. It is used as a flavoring agent in food, beverages and tobacco products. Benzyl acetate is also used as an intermediate in the production of other chemicals. A low-dose group of rats was given benzyl acetate at doses of 0.5, 1, 5 and 10 mg/kg/day for 30 days. The animals were observed for changes in enzyme activities and thermal expansion reactions. Chronic exposure to benzyl acetate may cause carcinogenesis by inducing dimethyl fumarate (DMF) or methyl transferase activity.</p>Formula:C9H10O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:150.17 g/molPAR-2 (6-1) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/molH-Tyr-Tyr-Phe-OH acetate salt
CAS:<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>Formula:C27H29N3O6Purity:Min. 95%Molecular weight:491.54 g/molH-Arg-Leu-OH acetate salt
CAS:<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/molH-Gly-Pro-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Pro-Pro-OH trifluoroacetate salt is an amide with a high specificity and low energy. This compound is activated by sequences of collagen, which may be due to its ability to hydrate intracellular calcium concentrations. H-Gly-Pro-Pro-OH trifluoroacetate salt has been shown to have polymerase chain activation activity in the presence of lysine residues, and it can bind to regulatory sites on DNA. H-Gly-Pro-Pro-OH trifluoroacetate salt has also been shown to have hydroxyproline hydroxylase activity, which leads to a helical structure.</p>Formula:C12H19N3O4Purity:Min. 95%Molecular weight:269.3 g/molPAR-3 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O8Purity:Min. 95%Molecular weight:576.6 g/molH-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt
CAS:<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>Formula:C26H42N8O8Purity:Min. 95%Molecular weight:594.66 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H63N15O13Purity:Min. 95%Molecular weight:1,082.13 g/molAcetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C157H252N44O43SPurity:Min. 95%Molecular weight:3,476.02 g/moltert-Butyl acetate
CAS:<p>tert-Butyl acetate is an organic compound that is used in the synthesis of pharmaceuticals. It is a colorless liquid that can be evaporated to produce a white solid. It has a strong odor and is soluble in water, acetone, and most other organic solvents. Tert-butyl acetate can also be used as a solvent for coatings and adhesives, or as an additive to fuels.</p>Formula:C6H12O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:116.16 g/molGLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H252N44O48S•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,652.1 g/mol(D-Trp8)-Somatostatin-14 trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-Somatostatin-14 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H104N18O19S2Purity:Min. 95%Molecular weight:1,637.88 g/moltert-Butyl 2-amino-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 2-amino-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Endothelin-2 (human, canine) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C115H160N26O32S4Purity:Min. 95%Molecular weight:2,546.92 g/mol3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid
CAS:<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>Formula:C10H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:273.08 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/mol3-Fluoro-4-methoxybenzoic acid
CAS:<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>Formula:C8H7FO3Purity:Min. 95%Color and Shape:PowderMolecular weight:170.14 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Formula:C81H156N10O13SPurity:Min. 95%Molecular weight:1,510.23 g/mol(Tyr9)-β-MSH (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H140N24O30SPurity:Min. 95%Molecular weight:2,202.4 g/mol([ring-D5]Phe8)-Angiotensin II acetate salt
CAS:<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H66D5N13O12Purity:Min. 95%Molecular weight:1,051.21 g/mol4-Amino-3,5,6-trichloropyridine-2-carboxylic acid
CAS:<p>4-Amino-3,5,6-trichloropyridine-2-carboxylic acid (4ATC) is a herbicide that inhibits the activity of pyridoxal phosphate (PLP)-dependent enzymes. 4ATC has been shown to be more toxic to plants than temozolomide and is used in vitro to study the effects of herbicides on cells. It inhibits cell growth and induces apoptosis in human cancer cells. In addition, 4ATC has been shown to inhibit the enzyme activities of group P2 proteins and nucleic acid synthesis. 4ATC also inhibits protein synthesis by inhibiting RNA synthesis in eukaryotic cells. 4ATC is not active against bacteria or fungi.</p>Formula:C6H3Cl3N2O2Purity:Min. 95%Color and Shape:White To Tan SolidMolecular weight:241.46 g/mol(Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/mol
