Inhibitors
Inhibitors are molecules that bind to enzymes, receptors, or other proteins to reduce or block their biological activity. These compounds are widely used in research to study biological pathways, understand disease mechanisms, and develop therapeutic drugs. Inhibitors play a crucial role in the treatment of various diseases, including cancer, cardiovascular diseases, and infections. At CymitQuimica, we provide a diverse range of high-quality inhibitors to support your research in biochemistry, cell biology, and pharmaceutical development.
Subcategories of "Inhibitors"
- Angiogenesis(2,781 products)
- Apoptosis(6,260 products)
- Cell Cycle/Checkpoint(4,789 products)
- Chromatin/Epigenetics(2,437 products)
- Cytoskeletal Signaling(1,525 products)
- DNA Damage/DNA Repair(2,967 products)
- Endocrinology/Hormones(3,706 products)
- Enzyme(3,667 products)
- GPCR/G-Protein(9,000 products)
- Immunology and Inflammation(3,869 products)
- Influenza Virus(301 products)
- JAK/STAT signaling(414 products)
- MAPK Signaling(1,249 products)
- Membrane Transporter/Ion Channel(3,029 products)
- Metabolism(10,207 products)
- Microbiology/Virology(7,583 products)
- Neuroscience(10,380 products)
- Other Inhibitors(36,059 products)
- Oxidation-Reduction(43 products)
- PI3K/Akt/mTOR Signaling(1,445 products)
- Proteases/Proteasome(1,725 products)
- Stem Cell and Derivatives(825 products)
- Tyrosine Kinase/Adaptors(2,037 products)
- Ubiquitination(1,716 products)
Show 16 more subcategories
Found 66687 products of "Inhibitors"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
7-O-(Cbz-N-amido-PEG4)-paclitaxel
7-O-(Cbz-N-amido-PEG4)-paclitaxel is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C66H78N2O21Purity:98%Color and Shape:SolidMolecular weight:1235.33Pimodivir HCl
CAS:Pimodivir (VX-787) prevents flu virus replication, inhibiting PB2, with an EC50 of 1.6 nM against various strains.Formula:C20H19F2N5O2ClHH2OPurity:98%Color and Shape:SolidMolecular weight:444.86Astraganoside
CAS:Astraganoside is a natural productFormula:C23H28O11Purity:98%Color and Shape:SolidMolecular weight:480.46t-Boc-Aminooxy-PEG5-azide
CAS:t-Boc-Aminooxy-PEG5-azide is a polyethylene glycol (PEG) derivative that serves as a linker for the synthesis of proteolysis-targeting chimeras (PROTACs)[1].Formula:C17H34N4O8Purity:98%Color and Shape:SolidMolecular weight:422.4720-Deoxocarnosol
CAS:20-Deoxocarnosol: antioxidant, decays DPPH radical; nonspecific antiprotozoal via cytotoxicity.Formula:C20H28O3Purity:98%Color and Shape:SolidMolecular weight:316.441Glutinol acetate
CAS:Glutinol acetate shows significant cytotoxic activity against four human cancer cell lines (HL-60, SK-OV-3, A549, and HT-29), with GI(50) in the range of 11.1-Formula:C32H52O2Purity:98%Color and Shape:SolidMolecular weight:468.75pp60 c-src (521-533) (phosphorylated)
CAS:Peptide binds pp60c-src/v-src SH2, inhibiting kinase, phosphorylated at Tyr527.Formula:C62H95N16O28PPurity:98%Color and Shape:Lyophilized PowderMolecular weight:1543.5Bevurogant
CAS:<p>Bevurogant is an antagonist of RORγt receptor and can be used in studies about the treatment of chronic inflammatory diseases.</p>Formula:C26H28N8O3SPurity:99.32%Color and Shape:SolidMolecular weight:532.62Mal-amido-(CH2COOH)2
CAS:Mal-amido-(CH2COOH)2, also known as compound 7a, is an intermediate compound that contains maleimidoethyl for use in hydrophilic ADC linker synthesis[1].Formula:C11H12N2O7Purity:98%Color and Shape:SolidMolecular weight:284.22N-(m-PEG4)-N'-(PEG2-NHS ester)-Cy5
CAS:N-(m-PEG4)-N'-(PEG2-NHS ester)-Cy5 is a polyethylene glycol (PEG) based PROTAC linker utilized for the synthesis of PROTACs[1].Formula:C45H60ClN3O10Purity:98%Color and Shape:SolidMolecular weight:838.43Senkyunolide S
CAS:Senkyunolide S is a natural product for research related to life sciences. The catalog number is TN5820 and the CAS number is 172723-28-3.Formula:C12H16O5Purity:98%Color and Shape:SolidMolecular weight:240.251,2,3,19-Tetrahydroxy-12-ursen-28-oic acid
CAS:1,2,3,19-Tetrahydroxy-12-ursen-28-oic acid is a natural product for research related to life sciences.Formula:C30H48O6Purity:98%Color and Shape:SolidMolecular weight:504.7CPI098
CAS:CPI098 inhibits CREBBP/EP300 bromodomains, key in T cell regulation and cancer immune evasion.Formula:C10H12N2OPurity:98%Color and Shape:SolidMolecular weight:176.22Lanceolarin
CAS:Lanceolarin is a natural product for research related to life sciences. The catalog number is TN4407 and the CAS number is 15914-68-8.Formula:C27H30O14Purity:98%Color and Shape:SolidMolecular weight:578.52Chlorpyrifos-methyl
CAS:Chlorpyrifos-methyl inhibits acetylcholinesterase by acting on the nervous system of insects.Formula:C7H7Cl3NO3PSPurity:98%Molecular weight:322.52Thermopsoside
CAS:Chrysoeriol-7-O-glucoside can strongly inhibit the classical pathway of the complement system.Chrysoeriol-7-O-d-glucoside and luteolin-7-O-d-glucoside canFormula:C22H22O11Purity:98%Color and Shape:SolidMolecular weight:462.4Nanaomycin A
CAS:Nanaomycin A, a quinone antibiotic, reactivates cancer suppressor genes and inhibits DNMT3B (IC50=500nM).Formula:C16H14O6Purity:98%Color and Shape:SolidMolecular weight:302.28cis-trismethoxy Resveratrol
CAS:<p>cis-trismethoxy Resveratrol ((Z)-3,5,4'-Trimethoxystilbene) inhibits tubulin polymerization (IC50 = 4 μM) and has anti-mitotic effects.</p>Formula:C17H18O3Purity:99.88%Color and Shape:SolidMolecular weight:270.32Raloxifene 6,4'-Bis-β-D-glucuronide
CAS:Raloxifene 6,4'-Bis-β-D-glucuronide is a Raloxifene metabolite. Raloxifene is a selective antagonist of estrogen receptor for the prevention of osteoporosis.Formula:C40H43NO16SPurity:98%Color and Shape:SolidMolecular weight:825.83AmmTX3 TFA
AmmTX3 TFA, a peptide toxin derived from Androctonus mauretanicus scorpion venom, functions as a selective blocker of the K_v4 channel.Formula:C158H262N50O48S6·xC2HF3O2Purity:98%Color and Shape:SolidMolecular weight:3822.47 (free acid)DBCO-C2-PEG4-NH-Boc
DBCO-C2-PEG4-NH-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C37H49N3O10Purity:98%Color and Shape:SolidMolecular weight:695.8AI 3-09536
CAS:AI 3-09536 is an agent of biochemical.Formula:C14H24O4Purity:98%Color and Shape:SolidMolecular weight:256.34N-Desmethyl Sildenafil
CAS:<p>N-Desmethyl Sildenafil (UK-103,320) (Desmethylsildenafil) is a prominent metabolite of Sildenafil, a potent inhibitor of phosphodiesterase type 5 (PDE5).</p>Formula:C21H28N6O4SPurity:99.35%Color and Shape:SolidMolecular weight:460.55L-Tryptophan
CAS:L-Tryptophan (Tryptophane), an essential amino acid, is necessary for normal growth in infants and for nitrogen balance in adults.Formula:C11H12N2O2Purity:99.76% - 99.91%Color and Shape:White Solid CrystallineMolecular weight:204.235-Methoxyresorcinol
CAS:<p>5-Methoxyresorcinol (Flamenol) is a chemical intermediate.</p>Formula:C7H8O3Purity:95.16%Color and Shape:SolidMolecular weight:140.14Polypodine B 20,22-acetonide
CAS:<p>Polypodine B 20,22-acetonide is a natural product for research related to life sciences. The catalog number is TN5305 and the CAS number is 159858-85-2.</p>Formula:C30H48O8Purity:98%Color and Shape:SolidMolecular weight:536.706Hyperxanthone
CAS:Hyperxanthone is a natural product for research related to life sciences. The catalog number is TN5910 and the CAS number is 99481-41-1.Formula:C18H14O5Purity:98%Color and Shape:SolidMolecular weight:310.305ent-16α,17-Dihydroxyatisan-3-one
CAS:ent-16alpha,17-Dihydroxyatisan-3-one and ent-16alpha,17-dihydroxykauran-3-one have apoptosis induction activities on L5178 human MDR1 gene-transfected mouseFormula:C20H32O3Purity:98%Color and Shape:SolidMolecular weight:320.4731-Hydroxy-2-prenylnaphthalene
CAS:1-Hydroxy-2-prenylnaphthalene is a natural product for research related to life sciences. The catalog number is TN2536 and the CAS number is 16274-34-3.Formula:C15H16OPurity:98%Color and Shape:SolidMolecular weight:212.29Ald-Ph-PEG4-NH-Boc
CAS:Ald-Ph-PEG4-NH-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C21H32N2O8Purity:98%Color and Shape:SolidMolecular weight:440.49Chromeceptin
CAS:Chromeceptin is an inhibitor of the IGF signaling pathway, decreases the numbers of tumorsphere, and inhibits the AKT/mTOR pathway.Formula:C19H16F3N3OPurity:99.85%Color and Shape:SoildMolecular weight:359.35IM-250
CAS:IM-250 possesses antiviral activity with IC values of 25 nM - 100 nM.Formula:C20H19F2N3O2S2Purity:99.59%Color and Shape:SoildMolecular weight:435.51Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Purity:98%Color and Shape:SolidMolecular weight:3692.15Cefquinome
CAS:Cefquinome is a cephem antibiotic that inhibits Enterobacteriaceae (family [1]).Formula:C23H24N6O5S2Purity:98%Color and Shape:SolidMolecular weight:528.6BDS-I
CAS:BDS-I, a marine toxin derived from Anemonia sulcata, functions as a selective inhibitor of the potassium channel, specifically targeting Kv3.4.Formula:C210H297N57O56S6Purity:98%Color and Shape:SolidMolecular weight:4708.341,5,6-Trihydroxy-3-methoxyxanthone
CAS:1,5,6-Trihydroxy-3-methoxyxanthone exhibits scavenging activity at 10 uM, it can reduce the viability of HL-60 cells significantly with IC50 values of 28.9 uM.Formula:C14H10O6Purity:98%Color and Shape:SolidMolecular weight:274.23Parstatin(mouse)
CAS:Peptide inhibits endothelial migration/proliferation (IC50 ~20μM), induces cell cycle arrest, triggers apoptosis, and has cardioprotective effects.Formula:C189H326N58O57S3Purity:98%Color and Shape:SolidMolecular weight:4419.19Oblongine
CAS:<p>Oblongine chloride lowers blood pressure in a dose-dependent manner without affecting α2-adrenergic receptors.</p>Formula:C19H24NO3Purity:98%Color and Shape:SolidMolecular weight:314.404ACTH (34-39)
CAS:ACTH (34-39) is an adrenocorticotropic hormone fragment.Formula:C37H50N6O9Purity:98%Color and Shape:SolidMolecular weight:722.83Neoschaftoside
CAS:Neoschaftoside has antioxidant activity.Formula:C26H28O14Purity:98%Color and Shape:SolidMolecular weight:564.4913-Deacetyltaxachitriene A
CAS:13-Deacetyltaxachitriene A is a natural product for research related to life sciences. The catalog number is TN2609 and the CAS number is 239800-99-8.Formula:C30H42O12Purity:98%Color and Shape:SolidMolecular weight:594.654Licoisoflavone A
CAS:Licoisoflavone A (Phaseoluteone) is an MRP inhibitor and inhibits lipid peroxidation with an IC50 of 7.2 μM.Formula:C20H18O6Purity:99.71%Color and Shape:SolidMolecular weight:354.35Cyclo(Tyr-Phe)
CAS:<p>Cyclo-(Phe-Tyr) shows anticoagulant activities.</p>Formula:C18H18N2O3Purity:98%Color and Shape:SolidMolecular weight:310.353D-Sedoheptulose 7-phosphate
CAS:<p>D-Sedoheptulose 7-phosphate, a precursor to group III heptaic acid and group IV hygromycin B, converts to NDP-heptose via similar pathways.</p>Formula:C7H15O10PPurity:98%Color and Shape:SolidMolecular weight:290.16Betamethasone acibutate
CAS:Betamethasone acibutate, a glucocorticoid, is derived from Betamethasone.Formula:C28H37FO7Purity:98%Color and Shape:SolidMolecular weight:504.59α-Isowighteone
CAS:alpha-Isowighteone is a natural product for research related to life sciences. The catalog number is TN3386 and the CAS number is 65388-03-6.Formula:C20H18O5Purity:98%Color and Shape:SolidMolecular weight:338.35BAD (103-127) (human) acetate
BAD (103-127) (human) acetate is a 25-mer Bad polypeptide from the BAD BH3 domain that antagonizes the effects of Bcl-xl.Formula:C139H216N42O41SPurity:96.97%Color and Shape:SolidMolecular weight:3163.52Pyrene-PEG5-propargyl
CAS:Pyrene-PEG5-propargyl is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C30H33NO6Purity:98%Color and Shape:SolidMolecular weight:503.59cIAP1 Ligand-Linker Conjugates 6 hydrochloride
cIAP1 Ligand-Linker Conjugates 6 hydrochloride is a compound that combines an IAP ligand for the E3 ubiquitin ligase and a PROTAC linker.Formula:C39H52ClN3O9Purity:98%Color and Shape:SolidMolecular weight:742.3Thrombin (MW 37kDa)
CAS:Thrombin (MW 37kDa) is a trypsin-like allosteric serine protease.Purity:98%Color and Shape:SolidMolecular weight:37kDaT7 Tag Peptide
CAS:T7 Tag Peptide is a tagged protein that can be recognised by T7 tag tag antibodies and can be used in different immunoassays as well as affinity purification.Formula:C41H71N13O16S3Purity:99.78%Color and Shape:SolidMolecular weight:1098.28Broussonin C
CAS:Broussonin C and broussin are antifungal compounds. Broussonin C exerts simple reversible slow-binding inhibition against diphenolase.Formula:C20H24O3Purity:98%Color and Shape:SolidMolecular weight:312.4Peraksine
CAS:Peraksine is a natural product of Rauvolfia, Apocynaceae.Formula:C19H22N2O2Purity:98%Color and Shape:SolidMolecular weight:310.397Xinjiachalcone A
CAS:Xinjiachalcone A, from Glycyrrhiza inflata, kills H. pylori effectively (MIC: 12.5-50 μM, 17 strains).Formula:C21H22O4Purity:98%Color and Shape:SolidMolecular weight:338.4Apelin-17(human, bovine)
CAS:Endogenous apelin receptor agonist. Potently inhibits forskolin-stimulated cAMP accumulation (pIC50 = 9.94).Formula:C96H156N34O20SPurity:98%Color and Shape:SolidMolecular weight:2138.56Isosalvianolic acid C
CAS:Isosalvianolic acid C exhibits more potent activity than probucol except for salvianolic acid F .Formula:C26H20O10Purity:98%Color and Shape:SolidMolecular weight:492.43(S)-ABT 102
CAS:N-[(1S)-1H-inden-1-yl]-N'-indazol-4-ylurea is a strong TRPV1 blocker with a 123 nM IC50 against capsaicin.Formula:C21H24N4OPurity:99.65% - 99.77%Color and Shape:SoildMolecular weight:348.44Triethyl phosphate
CAS:Triethyl phosphate is a chemical compound. It can be called "phosphoric acid, triethyl ester".Formula:C6H15O4PPurity:98%Color and Shape:Clear LiquidMolecular weight:182.16Ethyl dicapthon
CAS:Ethyl dicapthon is used as an insecticide.Formula:C10H13ClNO5PSPurity:98%Color and Shape:SolidMolecular weight:325.71Broussonetine A
CAS:Broussonetines A-H are glycosidase inhibitors.Formula:C24H45NO10Purity:98%Color and Shape:SolidMolecular weight:507.61Ceruletide Ammonium Salt
Ceruletide Ammonium Salt is a decapeptide, originating from the skin of tropical frogs, which is a potent cholecystokinin receptor agonist and a safe andFormula:C58H77N14O21S2Purity:98.47% - 98.54%Color and Shape:SoildMolecular weight:1370.44(2-Pyridyldithio)-PEG4-alcohol
CAS:(2-Pyridyldithio)-PEG4-alcohol, a PEG-based PROTAC linker, is used for the synthesis of PROTACs[1].Formula:C13H21NO4S2Color and Shape:SolidMolecular weight:319.44Boc-C1-PEG3-C4-OH
CAS:Boc-C1-PEG3-C4-OH is a PROTAC linker connecting an E3 ligase ligand and a protein target for selective degradation.Formula:C16H32O6Purity:98%Color and Shape:SolidMolecular weight:320.42TNF-α (10-36), human (TFA) (144796-70-3 free base)
TNF-α (10-36), human (TFA) is a peptide of human TNF-α.Formula:C133H212N43O40Purity:98%Color and Shape:SolidMolecular weight:3110.36Viniferol D
CAS:Viniferol D is a natural product from Vitis vinifera.Formula:C42H32O9Purity:98%Color and Shape:SolidMolecular weight:680.709Gly-Phe β-naphthylamide acetate
Gly-Phe β-naphthylamide acetate is the substrate of Cathepsin C and can be used for research on the function of cathepsin C, intralysosomal hydrolysis andFormula:C23H25N3O4Purity:99.56%Color and Shape:SolidMolecular weight:407.46VHL Ligand-Linker Conjugates 17
VHL Ligand-Linker Conjugates 17 are chemical compounds that consist of a VHL ligand specialized for the E3 ubiquitin ligase, as well as a PROTAC linker.Formula:C37H42N4O7Purity:98%Color and Shape:SolidMolecular weight:654.75Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formula:C188H276N51F3O61Purity:98%Color and Shape:SolidMolecular weight:4283.5Nemorensine
CAS:Nemorensine is a natural product for research related to life sciences. The catalog number is TN4631 and the CAS number is 50906-96-2.Formula:C18H27NO5Purity:98%Color and Shape:SolidMolecular weight:337.41C-Met inhibitor D9
CAS:C-Met inhibitor D9 is a c-Met kinase inhibitor.Formula:C17H15N3O2Purity:97.45%Color and Shape:SolidMolecular weight:293.32GR 94800
CAS:Potent and selective tachykinin NK2 receptor antagonistFormula:C49H61N9O8Purity:98%Color and Shape:SolidMolecular weight:904.082Theogallin
CAS:Theogallin is an active ingredient in decaffeinated green tea extract, has cognition enhancing effect and antidepressive.Formula:C14H16O10Purity:98%Color and Shape:SolidMolecular weight:344.27Gizzerosine HCl
CAS:<p>Gizzerosine HCl induces histopathologic lesions in broiler chicks that increase intracellular cAMP levels in isolated chickens of origin.</p>Formula:C11H22Cl2N4O2Purity:99.53%Color and Shape:SoildMolecular weight:313.2216-O-Acetyldarutigenol
CAS:16-O-Acetyldarutigenol is a natural product of Siegesbeckia, Asteraceae.Formula:C22H36O4Purity:98%Color and Shape:SolidMolecular weight:364.521H-Pyrrole-2-carboxylic acid, 4,5-dibromo-1-methyl-
CAS:1H-Pyrrole-2-carboxylic acid, 4,5-dibromo-1-methyl- (1-methyl-4,5-dibromopyrrole-2-carboxylic acid) is a marine derived natural products found in AgelasFormula:C6H5Br2NO2Purity:99.89%Color and Shape:SolidMolecular weight:282.92Methyl epi-dihydrophaseate
CAS:Methyl epi-dihydrophaseate is a natural product for research related to life sciences. The catalog number is TN6388 and the CAS number is 57761-30-5.Formula:C16H24O5Purity:98%Color and Shape:SolidMolecular weight:296.363JT001 sodium
CAS:JT001 (NLRP3-IN-19) sodium is a potent, specific, and orally active NLRP3 inhibitor that impedes the assembly of the NLRP3 inflammasome, thus curbing cytokineFormula:C19H22N4NaO4SPurity:98%Color and Shape:SolidMolecular weight:425.46Thalidomide-PEG2-C2-NH2 hydrochloride
CAS:Thalidomide-based cereblon ligand with 2-unit PEG linker for PROTAC, in hydrochloride form.Formula:C19H25ClN4O6Purity:98%Color and Shape:SolidMolecular weight:440.88ACTH (22-39) acetate
ACTH (22-39) acetate is a fragment of adrenocorticotropic hormone (ACTH) containing two proline residues at positions 3 and 15 from the N-terminus.Formula:C92H129N19O34Purity:98.14%Color and Shape:SolidMolecular weight:2045.12Monnieriside G
CAS:Monnieriside G is a chromone glycoside isolated from Cnidium monnieri.Formula:C21H26O10Purity:99.87%Color and Shape:SolidMolecular weight:438.43SNIPER(TACC3)-2 hydrochloride
<p>SNIPER(TACC3)-2 hydrochloride is a compound that induces degradation of the TACC3 protein through the ubiquitin-proteasome pathway by exploiting an IAP ligand,</p>Purity:98%Color and Shape:Odour SolidMC-VC-PABC-DNA31
CAS:MC-VC-PABC-DNA31: ADC drug-linker with DNA31 for potent cancer treatment via RNA polymerase inhibition.Formula:C77H96N10O21Purity:98%Color and Shape:SolidMolecular weight:1497.664Galanin-Like Peptide (rat)
CAS:Galanin-Like Peptide (rat), a neuropeptide comprising 60 amino acids, plays a crucial role in regulating feeding, body weight, and energy metabolism [1].Formula:C288H461N87O83SPurity:98%Color and Shape:SolidMolecular weight:6502.34Gersizangitide acetate
<p>Gersizangitide acetate is an inhibitor of angiogenesis.</p>Formula:C113H171N29O30Purity:98%Color and Shape:SolidMolecular weight:2415.74Saponarin
CAS:Saponarin (Petrocomoside) shows in vitro and in vivo hepatoprotective and antioxidant activity against CCl4-induced liver damage.Formula:C27H30O15Purity:98.84%Color and Shape:SolidMolecular weight:594.52Nudifloside B
CAS:Nudifloside B is a natural product from Jasminum nudiflorum.Formula:C43H60O22Purity:98%Color and Shape:SolidMolecular weight:928.92Isopropyl palmitate
CAS:Isopropyl palmitate is the isopropyl alcohol and palmitic acid ester. It is a moisturizer, emollient, anti-static agent, and thickening agent.Formula:C19H38O2Purity:98%Color and Shape:Colorless Liquid LiquidMolecular weight:298.512',5,6',7-Tetraacetoxyflavanone
CAS:<p>2',5,6',7-Tetraacetoxyflavanone is a natural product for research related to life sciences. The catalog number is TN2724 and the CAS number is 80604-17-7.</p>Formula:C23H20O10Purity:98%Color and Shape:SolidMolecular weight:456.4Thiol-PEG4-Boc
CAS:Thiol-PEG4-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C15H30O6SPurity:98%Color and Shape:SolidMolecular weight:338.46DBCO-PEG9-NH-Boc
DBCO-PEG9-NH-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C44H65N3O13Purity:98%Color and Shape:SolidMolecular weight:844Isamfazone
CAS:Isamfazone used in studying pyridazones, seeking new anti-inflammatory drugs.Formula:C22H23N3O2Purity:98%Color and Shape:SolidMolecular weight:361.44Sissotrin
CAS:Sissotrin is a natural product extracted from Pterospartum tridentatum with antimicrobial and antioxidant activities.Formula:C22H22O10Purity:98%Color and Shape:SolidMolecular weight:446.4NDNA4
<p>NDNA4 (compound 17) is a selective Hsp90α inhibitor (IC50: 0.34 μM), characterized by its permanent charge and low membrane permeability.</p>Formula:C31H35F3N2O5SPurity:98%Color and Shape:SolidMolecular weight:604.68SB1-G-187
CAS:SB1-G-187 is a PROTAC (PROteolysis TArgeting Chimera) that functions as a multi-kinase degrader [1].Formula:C52H54F3N9O10Purity:98%Color and Shape:SolidMolecular weight:1022.03Acetyl tetrapeptide-2
CAS:Acetyl tetrapeptide-2 is a skin conditioner, by soothing and nourishing the skin through similar mechanisms as other peptides.Formula:C26H39N5O9Purity:98%Color and Shape:SolidMolecular weight:565.62Delbonine
CAS:Delbonine is a natural product for research related to life sciences. The catalog number is TN6076 and the CAS number is 95066-33-4.Formula:C27H43NO8Purity:98%Color and Shape:SolidMolecular weight:509.64p-Methylbenzyl acetate
CAS:p-Methylbenzyl acetate is an agent of biochemical.Formula:C10H12O2Purity:98%Color and Shape:Less Liquid Colorless LiquidMolecular weight:164.2042-(Azido-PEG2-amido)-1,3-propandiol
CAS:2-(Azido-PEG2-amido)-13-propandiol is a Polyethylene glycol (PEG)-based PROTAC linker used for the synthesis of PROTACs[1].Formula:C10H20N4O5Purity:98%Color and Shape:SolidMolecular weight:276.29Dynorphin A (1-10) TFA(79994-24-4,free)
Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.Formula:C59H92F3N19O14Purity:98%Color and Shape:SolidMolecular weight:1348.488-(7-Hydroxy-3,7-dimethyl-2,5-octadienyloxy)psoralen
CAS:8-(7-Hydroxy-3,7-dimethyl-2,5-octadienyloxy)psoralen is a natural product for research related to life sciences.Formula:C21H22O5Purity:98%Color and Shape:SolidMolecular weight:354.4
