Amino Acids (AA)

<p>Please enquire for more information about Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(2R,3S)-Phenylisoserine is a chiral enantiomer that can be used in organic synthesis. It is a reactive compound and has the ability to form amide bonds with other compounds. 3-(2R,3S)-Phenylisoserine is also able to react with nitro groups and form an oxime. It is not soluble in water but it is soluble in organic solvents like acetone or methanol. 3-(2R,3S)-Phenylisoserine can be synthesized by the enzymatic methods of benzyloxymethyl hydrazine and hydrochloric acid.</p>

<p>Caspase-3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) is a peptide inhibitor of caspases. It blocks the activation of these proteases and their subsequent cleavage of substrates in the apoptotic pathway. This drug has potent inhibitory activity against caspases 3, 7, 8, 9, and 10. Caspase-3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) specifically interacts with the active site and inhibits the enzyme by binding to an aspartic acid residue at position D197 in human caspase 3. Caspase 3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) is localized to mitochondria and binds to acetyldeviceine (acDEV), a substrate for caspases</p>

<p>MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone is a peptidyl substrate for the enzyme carboxypeptidase A. This substrate has a high specificity for carboxypeptidase A and does not bind to other enzymes such as carboxypeptidase B, D, or L. The hydrophobic nature of this substrate has been shown in both hamsters and macaques. MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone also shows cardiovascular effects in both animal models. It is possible that this effect is due to the proteolytic activity of the enzyme. More research needs to be done to identify the sequence of this peptide and how it may affect humans.</p>

<p>Z-L-Valine N-hydroxysuccinimide ester is a synthetic δ opioid ligand that has been shown to have potent inhibitory activity against casein. The compound has also been shown to have high affinity for opioid receptors and δ opioid receptors, which may be due to its ability to form supramolecular complexes with these proteins. Z-L-Valine N-hydroxysuccinimide ester binds to the receptor binding site of the protein, preventing it from interacting with other molecules. It is not selective for one receptor over another and can bind to both the δ and μ opioid receptors. This synthetic substance may be used as a lead compound in drug development.</p>

<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>

<p>Polymyxin B is a cationic detergent that binds to bacterial membranes and destroys the cell wall. Polymyxin B has been shown to be a potent antagonist of spermatozoa and microglia, which are cells that maintain the homeostasis of the central nervous system. It also has been shown to be an inhibitor of chemotaxis in polymorphonuclear leucocytes (PMN), which are white blood cells that participate in inflammatory processes. Polymyxin B has been shown to have chemotactic activity for PMN and inhibit protein synthesis in mitochondria. This compound also inhibits chelerythrine, a cyclase inhibitor that is used as an antineoplastic agent.</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp-Gly-Gly-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 2-oxo-4-phenylbutyrate is a compound that belongs to the class of ester compounds. This molecule is found in cells grown in recombinant cultures and has been identified by its FTIR spectroscopy. Ethyl 2-oxo-4-phenylbutyrate inhibits the growth of candida glabrata by inhibiting an enzyme, which is involved in the conversion of glucose to acetoin. The mechanism for this inhibition is believed to be due to cinchonidine, which reacts with chloride ions. The chemical stability of ethyl 2-oxo-4-phenylbutyrate has been shown by its ability to withstand acidic pH and high concentrations of chloride ions without decomposing. Ethyl 2-oxo-4-phenylbutyrate also inhibits the synthesis of proteins and enzymes, although it does not inhibit DNA replication or transcription.</p>

<p>Please enquire for more information about H-Asp-Asp-Asp-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-allyl ester·p-tosylate is an amide with immobilized amino groups. It is an optically active compound that can be cumulated and used for biomolecular chemistry. H-Leu-allyl ester·p-tosylate has been shown to inhibit the growth of fungi by inhibiting the synthesis of tenuazonic acid, a mycotoxin that is found in contaminated grains.</p>

<p>N-Benzoyl-L-leucine-beta-naphthylamide is a chromogenic substrate for transpeptidase. It is hydrolyzed to L-phenylalanine and 2-naphthylamine, which react with the chromogen to produce a color change. The reaction occurs in both spermatozoa and epithelial cells, but can be inhibited by aminopeptidase and peptidase. This substrate is used as a marker for spermatozoa in semen analysis.</p>

<p>Please enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>S-(1,2-Dicarboxyethyl)glutathione is a glutathione analogue that has been shown to prevent acetaminophen-induced hepatotoxicity in mice. It inhibits the reaction between acetaminophen and hepatic microsomal cytochrome P450 enzymes, which prevents the formation of toxic metabolites. S-(1,2-Dicarboxyethyl)glutathione also inhibits the production of serotonin by inhibiting the enzyme tryptophan hydroxylase. This drug has an anticoagulant effect by preventing the conversion of prothrombin to thrombin. S-(1,2-Dicarboxyethyl)glutathione also affects growth factors and collagen synthesis by affecting both epidermal growth factor (EGF) and fibroblast growth factor (FGF). The optimum pH for this drug is at 7.0.</p>

<p>Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH is a molecule that can be used to generate an antigen against tumor necrosis factor alpha (TNFα). It has been shown to be able to bind TNFα and prevent it from binding to its receptors. This leads to a decrease in the production of cytokines, as well as a decrease in the activation of cytosolic guanylate cyclase. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH has also been shown to inhibit the proliferation of cancer cells by inhibiting extracellular Ca2+ influx and cytosolic Ca2+ ion concentrations.</p>

<p>H-Asp-Trp-OH is a peptide that has been shown to have antioxidative activity and neuroprotective effects. It has also been shown to be a reactive compound that can interact with other molecules, such as thiobarbituric acid. H-Asp-Trp-OH has been shown to increase the number of neurons in the brain and may be helpful in reducing neuronal damage by apoptotic cell death. This peptide also has potential use in treating neurodegenerative diseases, such as Alzheimer's disease.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-D-Pro-Pro-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(Cys(Acm)33·42)-EGF (33-42) amide (mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Gln-Ala-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-N-Me-D-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Myristoyl-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu-OH is a potent inhibitor of protein kinases. It has been shown to have an inhibitory concentration 50% (IC50) of 0.5 μM and inhibits the activity of ATPase in cells. This compound is a synthetic, multidrug protein kinase inhibitor that inhibits the activity of various kinases including adriamycin, atpase, and myristic acid. Myristoyl Arg Lys Arg Thr Leu Arg Arg Leu OH has been shown to be potent and effective against cell resistance to chemotherapy.</p>

<p>(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt H-Ala-Tyr-Pro-Gly-Lys-Phe-OH trifluoroacetate salt is a potent inhibitor of protein kinase C, and has been shown to inhibit the growth of prostate cancer cells. It also inhibits phosphorylation of epidermal growth factor receptors, which leads to lower levels of epidermal growth factor in the cell. This drug also has antiplatelet effects and may be used as an antiplatelet agent for patients with vascular disease or diabetes.</p>

<p>Please enquire for more information about HCV-1 e2 Protein (554-569) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Ala-Asp-OH is a pharmacological treatment for bacterial infection. The drug has been shown to be effective in treating the symptoms of bacterial infections, such as fever and headache, in animal models. H-Gly-Ala-Asp-OH binds to the GABA receptor and inhibits the production of GABA, which is an inhibitory neurotransmitter that regulates neuronal activity. This binding prevents the formation of an inhibitor complex with the enzyme decarboxylase that is required for GABA synthesis and thus inhibits protein synthesis and cell division.</p>

<p>Please enquire for more information about (Val34)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mozavaptan is a pharmacological agent that acts as a vasopressin V2 receptor antagonist. It is derived through synthetic chemical processes designed to target specific neurohormonal pathways in the body. Mozavaptan exerts its effects by inhibiting the action of vasopressin, a hormone that promotes water reabsorption in the kidneys. By blocking the vasopressin receptors, it enhances water excretion and corrects imbalances in electrolyte levels, particularly addressing conditions like hyponatremia.</p>

<p>(R)-(+)-2-Methyl-CBS-oxazaborolidine is a dpp-iv inhibitor that is a β-unsaturated ketone. It has been shown to inhibit the enzyme histone lysine demethylase, which may be involved in the regulation of bone mass. This compound also has a pharmacokinetic profile that is characterized by high oral bioavailability, low plasma protein binding, and rapid metabolism by liver enzymes. The reaction mechanism for this compound is based on the formation of an enolate carbanion. (R)-(+)-2-Methyl-CBS-oxazaborolidine can be synthesized with high stereoselectivity and yields from reactions with simple starting materials. This synthetic route also has a number of advantages over other methods: it does not require any protecting groups, it does not use toxic solvents such as dichloromethane or chloroform, and it can be performed in anhydrous conditions</p>

<p>Sar-Gly-Gly-OH is a zwitterionic, hydrophobic, and alkylating agent that is used to synthesize hyaluronic acid derivatives. It has been shown to form stable hydrogen bonds with metal ions such as copper (Cu) and zinc (Zn). Sar-Gly-Gly-OH has been used in the synthesis of various hyaluronic acid derivatives. These derivatives are used for the treatment of allergic conjunctivitis, dry eye, and other related conditions. Sar-Gly-Gly-OH also has low molecular weight and functional groups that allow it to react with other chemicals. The reaction products are aromatic hydrocarbons that can be used in techniques such as nuclear magnetic resonance spectroscopy.</p>

<p>Z-Ala-Val-OH is a prodrug that is hydrolyzed to ala-z-valine in vivo. It has been shown to be resistant to enzymes such as esterases, amidases, and proteases. Z-Ala-Val-OH has been modified in an effort to increase its affinity for the active site of the enzyme. This modification involves attaching a hydrophobic group onto the amide nitrogen of the amino acid residue. The resulting product is an active ester that can be used as an antihypertensive drug or for the treatment of Alzheimer's disease.</p>

<p>N,N'-Methylenediacrylamide is a water-soluble compound that has been used as a fluorescent probe for hydrogen bonding. It has been shown to have different phase transition temperatures in different solvents and can be used as an experimental model for studying the effects of temperature on the behavior of water molecules. N,N'-Methylenediacrylamide reacts with hydrochloric acid to form the fatty acid N,N'-methylenebis(3-chloroacrylic acid) under acidic conditions. This reaction is reversible, and the reverse process can be catalyzed by sodium citrate or human serum. When exposed to radiation or surface methodology, it emits light at a wavelength of 350 nm.</p>

<p>Please enquire for more information about (Gln53)-Connexin 37 (51-58) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH is a peptide that has been shown to have anti-cancer properties. The effect of Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH on prostate cancer cells was studied in vitro by measuring the extent of cell growth. The results showed a dose dependent decrease in tumor growth rate, suggesting that this peptide may be useful as an adjuvant therapy for prostate cancer. Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe has also been shown to inhibit diabetic nephropathy and reduce proteinuria in diabetic patients. This peptide may also be used to diagnose prostate cancer because it binds to the thrombin receptor, which is present on cancer cells but not</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Leu6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu13-psi(CH2NH)Leu14)-Bombesin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Trp-Ala-OH is an imidazolide that is used as a potassium supplement. It has the potential to be used in the treatment of epilepsy, but more research is needed to determine its safety and efficacy.</p>

<p>Dermorphin is a neuropeptide that has been shown to reduce cortisol levels in badgers and has been shown to have biological activity in vitro. Dermorphin also has a number of pharmacokinetic properties, including water solubility, lipid solubility, and oral bioavailability. The drug binds to δ receptors and inhibits the enzyme activities of rat liver microsomes. Dermorphin is used as an analgesic for bowel disease, such as inflammatory bowel disease or hypogaea. Dermorphin has antinociceptive properties (pain-relieving).</p>

<p>L-Cysteine hydrochloride anhydrous is an amino acid that is used in the treatment of bowel disease. It is also a precursor for glutathione, which has antioxidant properties and helps maintain iron homeostasis. L-Cysteine hydrochloride anhydrous has been shown to inhibit the oxidation of proteins by reacting with reactive oxygen species (ROS) such as nitric oxide, superoxide, and hydrogen peroxide. This amino acid also interacts with toll-like receptor 4 (TLR4), which may account for its natural anti-inflammatory properties. L-Cysteine hydrochloride anhydrous can be synthesized from cysteine and glutamic acid using a CDNA clone encoding the enzyme cystathionine β-synthase. The synthesis of this amino acid requires a number of biochemical reactions including hydrogen bonding interactions with inhibitor molecules such as dihydrofolate reductase, metalloproteases, and thiored</p>

<p>Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Trp-Lys-OH formiate salt is a tryptophan derivative that is stable in air and has been shown to have anti-inflammatory properties. It inhibits the synthesis of proinflammatory cytokines as well as cyclooxygenase, lipoxygenase, and nitric oxide synthase enzymes. This compound also inhibits the production of inflammatory mediators, such as leukotrienes, prostaglandins, and thromboxanes. H-Trp-Lys-OH formiate salt has been shown to be effective in lung diseases such as asthma and chronic obstructive pulmonary disease (COPD). It has also been shown to have an effect on autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus (SLE). H-Trp-Lys-OH formiate salt can be used for the treatment of infectious diseases such as HIV and malaria due to its ability to inhibit viral replication.</p>

<p>Fmoc-Tyr(Boc-Nmec)-OH is a hydrophobic amino acid that can be used in the synthesis of peptides. It is soluble in organic solvents and has been shown to have intramolecular cyclization reaction. Fmoc-Tyr(Boc-Nmec)-OH can be coupled with other amino acids using an amide bond, and has been shown to react with cationic groups such as tyrosine residues. This compound is often used in solid-phase peptide synthesis, where the product is cleaved from the resin by the action of aqueous acid or base before being purified. Fmoc-Tyr(Boc-Nmec)-OH can also be used for neutralizing alkaline conditions during peptide synthesis.</p>

<p>H-Gly-Gly-His-Ala-OH is a peptide of four amino acids. It has been shown experimentally that the side chain of His is always oriented in the same direction, regardless of the conformation. The proton shift constants and vicinal coupling constants for Gly, Gly and Ala are constant, while His has a variable proton shift constant. The experimental parameters for the molecule have been rationalized by using conformational shifts to explain their variability. For example, the proton shift constants have been found to be dependent on the rotation about an axis perpendicular to the peptide backbone. H-Ala-Gly-Gly-His-OH is a pentapeptide with five amino acids that differs from HGGHAOH by having Ala instead of His at position 1. The vicinal coupling constants are different and so are other experimental parameters.</p>

<p>Please enquire for more information about H-His-Pro-NH2·2 HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-p-phenyl-L-phenylalanine (FMPP) is a fluorescent probe that can be used to detect and diagnose damage in tissues. It is a small molecule that has been shown to bind to myocytes and cardiac tissues, specifically targeting skeletal and cardiac muscle. FMPP binds to the amino acid phenylalanine, which is found in high concentrations in cardiac tissue. This binding causes an increase in fluorescence, which can be detected by light microscopy or flow cytometry. FMPP has been used to detect damage in heart muscles of mice with dilated cardiomyopathy and also as a probe for myocardial infarctions in humans.</p>

<p>Please enquire for more information about Cyclo(-D-Ser-Pro-D-Val-Leu-D-Trp) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide W-23 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Tyr-Tyr-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methylthiopropionic acid is a bacterial metabolite that can serve as an alternative carbon source for the production of amino acids. 3-Methylthiopropionic acid is used to study the effect of matrix on enzyme activities, and has been shown to have protein-binding properties. The compound also serves as a precursor in the synthesis of tiglic acid, which is a lysine precursor. 3-Methylthiopropionic acid has been found to be effective in slowing the growth of cancer cells. It has been shown to inhibit fatty acid synthesis, and may also inhibit methionine synthetase activity and cell proliferation.</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-beta-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Phe-Glu-OH is a compound that has been shown to significantly increase the uptake of collagen in fibrosarcoma cells. H-Phe-Glu-OH binds to a receptor on the cell surface and activates it, which leads to an increase in collagen uptake. This drug also enhances the production of collagen molecules and can be used for diagnosing diseases such as cancer. H-Phe-Glu-OH does not affect normal cells, making it possible for this drug to be used as a diagnostic tool without harming healthy tissue.</p>

<p>Please enquire for more information about (N-Me-D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Met-Met-OH is a synthetic compound, which is an optical isomer of DL-methionine. It has been shown to have the same biochemical and dietary concentrations as DL-methionine. H-D-Met-Met-OH has also been shown to have a linear response in bioassays, assays and other biochemical pathways. The thermodynamic properties of this compound are also similar to those of DL-methionine, although it is not as stable. This compound can be used as a substitute for DL-methionine because it has an identical chemical structure and can be converted into L -methionine by the enzyme methioninase.</p>

<p>4-Hydroxymethyl-5-methyl-2-phenylimidazole is an impurity of phenoxy. It has a high resistance to acids and bases, and can be used in devices that require high purity. 4-Hydroxymethyl-5-methyl-2-phenylimidazole has a particle diameter of about 1 micron. This impurity is metastable, or stable only under certain conditions such as temperature and pressure. The high viscosity of this compound makes it useful for devices that require a high degree of stability at elevated temperatures. Immediate decomposition occurs when exposed to air due to the presence of naphthalene, phosphine, and silicon.</p>

<p>Fmoc-Leu-Gly-OH is a dipeptide that is reversibly soluble in water and organic solvents. It has been found to be stable at millimeter and nanometer scales, which makes it suitable for use as a hydrogel or fiber. Fmoc-Leu-Gly-OH has also been shown to form membranes of variable thickness (from micrometers to nanometers) that are sensitive to pH changes. This means that the membrane can be used for sensing pH levels in a variety of environments. Dipeptides are amphiphiles, meaning they have both hydrophilic and lipophilic properties. This makes them useful for forming self-assembled structures, such as hydrogels and membranes, that are capable of transporting water molecules through the structure.</p>

<p>Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV-1 gag Protein p24 (194-210) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-D-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Lys(Z)-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-{[4-(4-Methyloxyphenyl)-piperazin-1-yl]-phenyl}-2,4-dihydro-[1,2,4]-triazol-3-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RFRP-3 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Formylphenyloxymethyl polystyrene resin (200-400 mesh) is a polymer that can be used in the synthesis of amide, aminoacylation, halides, piperidine, yields, imine, reductive amination and heterocycles. It has been shown to be especially useful for the synthesis of diazepinones. The resin is soluble in solvents such as dichloromethane and ethanol. 4-Formylphenyloxymethyl polystyrene resin can be prepared by reacting styrene with formaldehyde and phenol in a solvent such as tetrahydrofuran or pyridine at a temperature between 0°C and 50°C. This process is usually conducted under an inert atmosphere such as nitrogen or argon gas. The resin is then washed with diethylether followed by benzene to remove residual formaldehyde.</p>

<p>Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is a heterocyclic peptide that has inhibitory effects on the muscle cells. It inhibits the enzyme guanosine triphosphatase, which is responsible for releasing calcium ions from its intracellular storage site. Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is an analog of the human protein fibronectin, and it can be used as a synthetic molecule to study how integrin receptors interact with different sequences of amino acids.</p>

<p>R-N-Glycidylphthalimide is an enantioselective chiral reagent that is used to produce optically pure alcohols. It has been shown to have antibacterial activity in a number of carboxylic acid derivatives. R-N-Glycidylphthalimide was shown to be a good solvating agent, with the ability to form hydrogen bonds with water molecules and hydroxyl groups on proteins. R-N-Glycidylphthalimide is also useful for the synthesis of chiral amines, including ethylamine and amino acids, which are important in the pharmaceutical industry.</p>

<p>Please enquire for more information about Z-Gly-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Sapecin is an antimicrobial peptide, which is derived from the hemolymph of the silk moth (Bombyx mori) with potent bactericidal action. The source of Sapecin is the immune system of the silk moth, where it acts as a natural defense mechanism against microbial infections. Its mode of action involves disrupting bacterial cell membranes, leading to cell lysis and death. The peptide achieves this by inserting itself into the lipid bilayer, creating pores that compromise the structural integrity of the membrane.</p>

<p>Please enquire for more information about (Tyr0)-C-Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Pyr 6,Pro 9)-Substance P (6-11) Pyr-Phe-Phe-Pro-Leu-Met-NH2 is a peptide that has been shown to have locomotor activity in rats, receptor activity, and physiological effects. This peptide binds to the κ opioid receptor and the neurokinin 1 receptor. It was found to have antimicrobial properties against gram positive bacteria and gram negative bacteria. In addition, it has been shown to be an inhibitor of fatty acid synthesis. This molecule also has been studied for its ability to treat metabolic disorders by inhibiting malonic acid production in animals.</p>

<p>Please enquire for more information about Z-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>

<p>Please enquire for more information about Guanylin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-(2-Methoxyethoxy)ethoxy)acetic acid (MEAA) is a cell stabilizer that can be used in the treatment of cancer, diabetes, and other diseases. MEAA has been shown to inhibit the growth of cells by binding to and stabilizing the cytoskeleton through inhibition of protein synthesis. It also prevents the activation of pro-inflammatory cytokines and reactive oxygen species. MEAA's magnetic resonance spectroscopy properties have been studied in detail and it has been shown to bind well with silver ions. MEAA has also been shown to have high cytotoxicity when combined with laser ablation therapy.</p>

<p>Disulfide bond is a protein that regulates muscle cell assembly and interactions. Disulfide bonds are formed by the oxidation of two cysteine molecules, which can be found in the extracellular matrix (ECM). The protein is an important regulator of metalloproteinases, which are enzymes that regulate ECM turnover. When disulfide bond lacks, it causes a deficiency in collagen production. Disulfide bond also has interactions with MMP-2, which plays a role in the regulation of arteriosclerosis and genetic disorders such as muscular dystrophy.</p>

<p>2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol is an impurity in hexane that is generated during the reaction of pyridine with acetonitrile. The impurity is removed by crystallizing it from methanol. 2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol has a high efficiency, and can be used to synthesize hexamethyldisiloxane. This product can be used as a metal catalyst for reactions involving alkali metals or metal halides. It can also be used as an alcohol solvent, but not hydrogenated.</p>

<p>Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Phe-Leu-Phe-SBzl is a protease inhibitor that blocks the activity of serine proteases and inhibits protein synthesis. It has been shown to be active against a number of proteases, such as trypsin, chymotrypsin, elastase, and cathepsin G. Suc-Phe-Leu-Phe-SBzl has been reported to inhibit the activity of serine proteases at low concentrations but not at high concentrations. This drug also has a potent effect on cellular organelles such as mitochondria and lysosomes. The enzyme inhibition property of Suc-Phe-Leu-Phe-SBzl is due to its ability to bind strongly to proteins with hydrophobic amino acid residues in their active site.</p>

<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-2-Cyanoethyl-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-36 is a human apelin protein. It is involved in the regulation of appetite and energy expenditure. Apelin-36 has been shown to be an independent predictor of body mass index and insulin resistance in women with polycystic ovary syndrome. Apelin-36 is also an indicator of the risk for cardiovascular disease, stroke, and type 2 diabetes mellitus. This molecule can be measured using a Western blot assay method on ovary homogenates. The level of apelin-36 can be used as a diagnostic tool for determining insulin resistance and overweight status.</p>

<p>Please enquire for more information about H-Ser-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-Phe-diazomethylketone is a cathepsin inhibitor that has been shown to inhibit the proteolytic activity of various enzymes, including serine proteases and thrombotic thrombocytopenic. This compound inhibits the growth of Leishmania parasites in cell culture and has been shown to have a high affinity for carboxy terminal and proximal tubules. Z-Phe-Phe-diazomethylketone has a neutral pH, with an optimum at 7.0, which may be due to its ability to bind to proteins or other components of cells without affecting their functions.</p>