
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,451 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38234 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Pz-Pro-Leu-OH
CAS:<p>Pz-Pro-Leu-OH is a proteolytic enzyme that cleaves proteins by hydrolysis at the peptide bond. It has been shown to be active against Clostridium and has been used in colorimetric methods for the measurement of this bacterium. Pz-Pro-Leu-OH is produced by subtilisin, which is expressed in Escherichia coli. The amount of this enzyme can be monitored and optimized by cloning. Thermolysin, another protease, also cleaves proteins at the peptide bond and has been used to measure the activity of Pz-Pro-Leu-OH.</p>Formula:C25H30N4O5Purity:Min. 95%Molecular weight:466.53 g/molMet-Enkephalin-Arg-Phe
CAS:<p>Met-enkephalin is a 5-hydroxytryptamine (serotonin) agonist. It has been shown to have anesthetic properties and to be active in cardiac, pulmonary, and renal functions. Met-enkephalin has also been found to have a delta-opioid receptor activity. This molecule has been shown to inhibit noradrenaline release from the locus coeruleus, as well as immunohistochemically demonstrating its presence at the atrium of the heart. Met-enkephalin also exhibits hydroxylase activity and has been shown to inhibit dopamine release from the substantia nigra pars compacta and sinoatrial node in rats. This drug can be used for treatment of pain, hypertension, angina pectoris, myocardial infarction, unstable angina, cardiogenic shock, congestive heart failure due to left ventricular dysfunction or ischemia of the coronary artery, acute pulmonary edema</p>Formula:C42H56N10O9SPurity:Min. 95%Molecular weight:877.02 g/molFmoc-Trp-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Trp-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Ala-Pro-OH
CAS:<p>Fmoc-Ala-Pro-OH is a peroxide that can be used as a radical initiator for the synthesis of polymers, such as polypropylene. It has been shown to catalyze the oxidation of hydrogen peroxide by a phenoxy group to form radicals. The rate of formation of these radicals is highly dependent on the number and location of proline residues in the molecule. Fmoc-Ala-Pro-OH is chemically stable and does not react with oxygen or light.</p>Formula:C23H24N2O5Purity:Min. 95%Molecular weight:408.45 g/molH-Glu-Tyr-OH
CAS:<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>Formula:C14H18N2O6Purity:Min. 95%Molecular weight:310.3 g/molH-D-Lys-NH2·2 HCl
CAS:<p>Please enquire for more information about H-D-Lys-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H15N3O·2HClPurity:Min. 95%Molecular weight:218.12 g/molFmoc-N-methyl-L-leucine
CAS:<p>Please enquire for more information about Fmoc-N-methyl-L-leucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H25NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:367.44 g/molH-Lys-Gln-Ala-Gly-Asp-Val-OH
CAS:<p>H-Lys-Gln-Ala-Gly-Asp-Val-OH is a synthetic peptide that is used as a research tool. It is synthesized by recombinant e. coli cells and has been shown to have strong affinity for the specific ligand, fluorescence and microbial assays. This synthetic peptide is hydrophilic and can be detected using confocal microscopy. It also exhibits biodegradability in an e. coli environment, which may be due to its lysine residue.</p>Formula:C25H44N8O10Purity:Min. 95%Molecular weight:616.66 g/molFmoc-Cit-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cit-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H43FN4O11Purity:Min. 95%Molecular weight:654.68 g/molN-Me-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-Me-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H29N3O2Purity:Min. 95%Molecular weight:319.44 g/molL-Lysine L-malate
CAS:<p>L-Lysine L-malate is a chemical compound that is used in wastewater treatment. It inhibits the activity of enzymes such as carbon disulphide oxidase, copper complexes, and cationic surfactants. L-Lysine L-malate can be synthesized from sodium citrate and malonic acid by reacting with hydrogen peroxide to form a bicyclic heterocycle. This compound has been shown to have biological effects on metabolic disorders in animal studies, which may be due to its ability to inhibit the synthesis of fatty acids and proteins. The adsorption mechanism for this product is unknown.</p>Formula:C6H14N2O2·C4H6O5Purity:Min. 95%Color and Shape:White PowderMolecular weight:280.28 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O7SPurity:Min. 95%Molecular weight:592.67 g/molHIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22)
CAS:<p>The HIV-1 envelope protein, gp120, is a transmembrane glycoprotein that plays a key role in the viral entry process. The gp120 protein contains the binding site for the CD4 receptor and can be cleaved by proteases to remove the membrane-spanning domain. The resulting soluble gp120 (sgp120) is an important co-receptor for HIV infection of target cells such as prostate cancer cells. The sgp120 binds to heparin sulfate proteoglycans on the surface of target cells and triggers cellular activation pathways including angiogenic factors, which induce cell proliferation and migration. This process is important for tumour growth and metastasis, inflammatory bowel disease, and other inflammatory diseases. The sgp120 has also been shown to activate pro-apoptotic proteins such as Bcl-2 family members and Bax. These proteins play a crucial role in apoptosis pathway by regulating mitochondrial membrane integrity, cytochrome c release from mitochond</p>Formula:C73H126N26O18Purity:Min. 95%Molecular weight:1,655.95 g/molFibronectin Fragment (1954-1959) trifluoroacetate salt
CAS:<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H63N11O7Purity:Min. 95%Molecular weight:713.91 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H293N53O48S2Purity:Min. 95%Molecular weight:4,007.69 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N10O7Purity:Min. 95%Molecular weight:646.74 g/mol3'-Hydroxy-4'-methoxyacetophenone
CAS:<p>3'-Hydroxy-4'-methoxyacetophenone is a chemical compound with the molecular formula CHO and it belongs to the group of bisbenzylisoquinoline alkaloids. It is a white crystalline powder that has a dry weight of 155.2g/mol and melting point of 154-158°C. 3'-Hydroxy-4'-methoxyacetophenone is used as an intermediate in the synthesis of other chemicals, such as methyl transferase inhibitors like metronidazole or oxidative stress agents like benzoquinones. 3'-Hydroxy-4'-methoxyacetophenone can be found in bowel disease patients, where it may be produced by bacteria in the gut. This chemical also has UV absorption properties and can be used as a sample preparation agent for hydroalcoholic samples.</p>Formula:C9H10O3Purity:Min. 95%Color and Shape:PowderMolecular weight:166.17 g/molFmoc-β-Ala-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-beta-Ala-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>Formula:C33H41N7O11Purity:Min. 95%Molecular weight:711.72 g/molBoc-Thr(Ala-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Ala-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O8Purity:Min. 95%Color and Shape:PowderMolecular weight:512.55 g/molAc-Ile-Glu-Thr-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Ile-Glu-Thr-Asp-aldehyde (pseudo acid) is a neurotrophic factor that plays an important role in the development and function of the nervous system. It stimulates the production of other neurotrophic factors such as NGF, BDNF, and GDNF. This protein has been shown to be involved in a number of autoimmune diseases, including multiple sclerosis and rheumatoid arthritis. Ac-Ile-Glu-Thr-Asp-aldehyde (pseudo acid) is also known to reduce neuronal death by binding to toll receptors on neurons and activating mitogen activated protein kinases. Acetylcholine esterase activity can also be inhibited by this protein. Acetylcholine esterase is responsible for breaking down acetylcholine, which is a neurotransmitter that transmits nerve impulses across the synapses between neurons. The inhibition of this enzyme leads to an increase in acetylcholine levels and increased transmission of</p>Formula:C21H34N4O10Purity:Min. 95%Molecular weight:502.52 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/molH-Ala-Gly-Tyr-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Ala-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molH-Ser(tBu)-AMC·HCl
CAS:<p>Please enquire for more information about H-Ser(tBu)-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H22N2O4·HClPurity:Min. 95%Molecular weight:354.83 g/molBoc-Thr(Bzl)-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Thr(Bzl)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Methylthio-N6-threonylcarbamoyladenosine
CAS:<p>A modified form of adenosine found in bacterial and eukaryotic tRNAs</p>Formula:C16H22N6O8SPurity:Min. 95%Color and Shape:PowderMolecular weight:458.45 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H65N7O15Purity:Min. 95%Molecular weight:908 g/molZ-Val-Lys-Met-AMC acetate salt
CAS:<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>Formula:C34H45N5O7SPurity:Min. 95%Molecular weight:667.82 g/molBoc-Lys(2-chloro-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys-Phe-OH·HCl
CAS:<p>Please enquire for more information about H-Lys-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N3O3·HClPurity:Min. 95%Molecular weight:329.82 g/molN-Heptyl-Hyp-OH
CAS:<p>The synthesis of N-heptyl-hyp-OH is a chiral resolution process for the preparation of the enantiomers of heptanol. The enantioselective synthesis of this compound is achieved by converting the racemic mixture to an optically active form by means of a chiral auxiliary, followed by protection and hydrolysis. This method produces an optically pure product in high yield.</p>Formula:C12H23NO3Purity:Min. 95%Molecular weight:229.32 g/molBoc-L-Nitroarginine
CAS:<p>Boc-L-Nitroarginine is a nitric oxide synthase inhibitor that belongs to the class of drugs called nitric oxide inhibitors. It is a potent inhibitor of nitric oxide synthase, preventing the production of nitric oxide from arginine. The drug has been shown to have therapeutic effects in the treatment of cancer, diabetes mellitus, and other diseases. Boc-L-Nitroarginine inhibits tumor angiogenesis by blocking endothelial cell proliferation and migration. It also inhibits insulin secretion, leading to an improved glycemic control in diabetic patients. Boc-L-Nitroarginine can be used as a hydrogenation reducing agent for the synthesis of imatinib and palladium catalysts for hydrogenation reactions.</p>Formula:C11H21N5O6Purity:Min. 95%Color and Shape:PowderMolecular weight:319.31 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molZ-Phe-Arg-pNA·HCl
CAS:<p>Please enquire for more information about Z-Phe-Arg-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H33N7O6·HClPurity:Min. 95%Molecular weight:612.08 g/mol(Glu2)-TRH Pyr-Glu-Pro-NH2
CAS:<p>(Glu2)-TRH Pyr-Glu-Pro-NH2 is a colony-stimulating factor that has been shown to play a role in fertility and energy metabolism. It is also involved in the regulation of physiological functions, such as spermatozoa motility and enzyme inhibitors. (Glu2)-TRH Pyr-Glu-Pro-NH2 binds to its receptor on the surface of cells and stimulates cell growth. The biological function of this drug is not yet known.</p>Formula:C15H22N4O6Purity:Min. 95%Molecular weight:354.36 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H54N10O9Purity:Min. 95%Molecular weight:782.89 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H32N6O7Purity:Min. 95%Molecular weight:444.48 g/molH-Tyr-Lys-OH
CAS:<p>H-Tyr-Lys-OH is a small drug molecule that has been shown to inhibit protein synthesis. It binds to the active site of the transcription-polymerase chain and competitively inhibits the binding of RNA polymerase. H-Tyr-Lys-OH has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis. H-Tyr-Lys-OH's conformational properties are similar to those found in proteins such as glutamic acid and lysine.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molPyr-Trp-Gly-NH2
CAS:<p>Please enquire for more information about Pyr-Trp-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H21N5O4Purity:Min. 95%Molecular weight:371.39 g/mol(Tyr38,Phe42·46)-Osteocalcin (38-49) (human)
CAS:<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H101N19O17Purity:Min. 95%Molecular weight:1,516.7 g/molACTH (22-39)
CAS:<p>ACTH (22-39) H-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu is a modified form of ACTH (22-39) that is used for the treatment of diabetes mellitus. It is a synthetic peptide and has been shown to reduce body mass index, adipose tissue, and plasma glucose levels in diabetic patients. This drug also increases plasma cortisol concentrations and inhibits insulin production in pancreatic β cells.</p>Formula:C90H125N19O32Purity:Min. 95%Molecular weight:1,985.06 g/molH-Arg(Pmc)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Arg(Pmc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Tyr-Thr-NH2 hydrochloride salt
CAS:<p>Please enquire for more information about H-Tyr-Thr-NH2 hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19N3O4Purity:Min. 95%Molecular weight:281.31 g/molH-Asn(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Asn(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Leu-Glu-Thr-Asp-AFC
CAS:<p>Please enquire for more information about Ac-Leu-Glu-Thr-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H38F3N5O12Purity:Min. 95%Molecular weight:729.66 g/molH-Ala-Ala-Pro-Val-chloromethylketone
CAS:<p>H-Ala-Ala-Pro-Val-chloromethylketone is a hydrogen peroxide prodrug that is activated by the enzyme chloromethyl ketone. This drug has been shown to be active against schistosoma and pancreatic cancer cells, as well as in activating peroxide. HAPV may also have an effect on immunity and leukocytes, which could be due to its ability to sensitize these cells to damage caused by other agents, or through the hydrolytic enzymes it generates.</p>Formula:C17H29ClN4O4Purity:Min. 95%Molecular weight:388.89 g/molH-Met-Ser-OH
CAS:<p>H-Met-Ser-OH is a dihedral molecule that has an amino acid composition of H, Met, Ser, and OH. It is acidic and has efficiencies in polarizability and acceptor. The dipole moment of the molecule is hydrogen bonding interactions with sequences. The vibrational frequencies are computationally predicted by computational methods. The sulfate fractionation was used to determine the percent of H-Met-Ser-OH in human liver tissue.</p>Formula:C8H16N2O4SPurity:Min. 95%Molecular weight:236.29 g/mol2-Methyl-5-chloromethylpyridineHydrochloride
CAS:<p>Please enquire for more information about 2-Methyl-5-chloromethylpyridineHydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H9Cl2NPurity:Min. 95%Molecular weight:178.06 g/molFmoc-Cys(Acm)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(Acm)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Amyloid P Component (33-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56N10O7SPurity:Min. 95%Molecular weight:784.97 g/molH-Val-Leu-Ser-Glu-Gly-OH
CAS:<p>H-Val-Leu-Ser-Glu-Gly-OH is a polypeptide that is hydrophobic and has carboxypeptidase activity. It hydrolyzes anions, such as the penicillin G, which has been shown to have a high affinity for this enzyme. H-Val-Leu-Ser-Glu-Gly-OH has also been shown to interact with other proteins through hydrophobic interactions. When used in high concentrations, it can be used to filter out substances that are hydrophobic. It can also be used to hydrolyze anions and divalent ions, such as copper and zinc.</p>Formula:C21H37N5O9Purity:Min. 95%Molecular weight:503.55 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/mol(Ala6,D-Trp8,L-alaninol15)-Galanin (1-15)
CAS:<p>Please enquire for more information about (Ala6,D-Trp8,L-alaninol15)-Galanin (1-15) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H114N20O18Purity:Min. 95%Molecular weight:1,655.9 g/molH-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu-OH
CAS:<p>The target of H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu is the phosphotyrosine residue in tyrosine kinase. This compound has been shown to inhibit the proliferation of cells that express this type of receptor and induce apoptosis. The x-ray structures of ligand binding to the receptor show a hydrogen bond network with the hydroxyl group at position 2, which is believed to be important for binding activity. The molecular modeling studies confirm that this interaction is energetically favorable, with a ΔΔG = -6.5 kcal/mol. H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-(OH) has also been found to have antiosteoporotic properties when administered orally in rats.</p>Formula:C66H97N12O24PPurity:Min. 95%Molecular weight:1,473.52 g/molTIPP
CAS:<p>TIPP is a peptide that belongs to the group of chemokines. It has been shown to have receptor binding activity and to stimulate the release of pro-inflammatory cytokines in cancer cells. TIPP interacts with membranes by forming hydrogen bonds with carbonyl groups and hydroxyl groups, which are located in the membrane. This results in a low energy barrier for intramolecular hydrogen transfer, making it a suitable candidate for drug design. TIPP also interacts with receptors, such as δ receptors, which may contribute to its anti-cancer properties.</p>Formula:C37H38N4O6Purity:Min. 95%Molecular weight:634.72 g/molAc-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H162N20O26Purity:Min. 95%Molecular weight:2,000.42 g/molDABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formula:C61H76N12O14SPurity:Min. 95%Molecular weight:1,233.39 g/molPAR-4 (1-6) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H45N7O8Purity:Min. 95%Molecular weight:667.75 g/molH-Ala-Ala-Ala-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N5O5·HClPurity:Min. 95%Molecular weight:387.82 g/molSar-Pro-OH
CAS:<p>Please enquire for more information about Sar-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O3Purity:Min. 95%Molecular weight:186.21 g/molH-Asp(Gly-OH)-OH
CAS:<p>Polymyxin B is a polycationic antibiotic that has been used in the treatment of infectious diseases and as an ophthalmic ointment. It is effective against bacteria, fungi, and parasites. Polymyxin B exhibits antimicrobial activity by binding to microbial membranes and causing lysis. The redox potential of this antibiotic is low, which can make it difficult for it to penetrate into cells. Oral cephalosporins are acidic drugs that are poorly absorbed from the gastrointestinal tract; they are only active in the distal small intestine and colon. Streptococcus faecalis is a bacterium that causes infections in the upper respiratory tract and urinary tract. Polymyxin B may be used as an oral agent to treat these infections because it does not require acidity for activity. This drug also exhibits anti-inflammatory effects through its ability to inhibit gamma-aminobutyric acid (GABA) synthesis in bowel cells, which leads to decreased inflammation.</p>Formula:C6H10N2O5Purity:Min. 95%Molecular weight:190.15 g/molGalanin (1-16) (mouse, porcine, rat)
CAS:<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H116N20O21Purity:Min. 95%Molecular weight:1,669.88 g/molBrain Injury Derived Neurotrophic Peptide
CAS:<p>Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala-Arg-Gly-Ala-Ile-Phe-Gln-Ala-NH2 is a growth factor that has been shown to have antiinflammatory and immunosuppressive effects in autoimmune diseases. It also has the ability to bind to peptides, proteins, and particle surfaces. This peptide has been shown to be effective against cancer cells by inhibiting tumor growth and increasing the effectiveness of radiation therapy. Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala Arg Gly Ala Ile Phe Gln Ala NH2 is also an immunosuppressant that can reduce inflammation caused by infectious diseases such as HIV/AIDS.</p>Formula:C62H102N18O18Purity:Min. 95%Molecular weight:1,387.58 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molCholecystokinin Octapeptide (1-4) (sulfated)
CAS:<p>Please enquire for more information about Cholecystokinin Octapeptide (1-4) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H28N4O11S2Purity:Min. 95%Molecular weight:564.59 g/molBoc-Thr(Bzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Thr(Bzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Fluoro-4-methoxybenzoic acid
CAS:<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>Formula:C8H7FO3Purity:Min. 95%Color and Shape:PowderMolecular weight:170.14 g/molConantokin G (free acid)
CAS:<p>Please enquire for more information about Conantokin G (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H137N25O45Purity:Min. 95%Molecular weight:2,265.17 g/mol2-Methyl-3-(3,4-methylenediOxyphenyl)prOpanal
CAS:Controlled Product<p>2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde (2MMPP) is a minor constituent of piperonal. It has been shown to be a potent inhibitor of intracellular calcium levels in humans and rat prostate cancer cells. The mechanism of action is thought to be through an interaction with fatty acid receptors and alterations in cytosolic calcium levels. 2MMPP has been found to act as an odorant binding agent that binds to the olfactory receptor OR5AN1 and alters its function. 2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde has also been shown to have high electrochemical impedance spectroscopy values, which may indicate its ability to remove organic contaminants from wastewater treatment systems.</p>Formula:C11H12O3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:192.21 g/molAc-Gly-Ala-Lys-AMC trifluoroacetate salt
<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H31N5O6Purity:Min. 95%Molecular weight:473.52 g/molH-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Homoarg (Z)2-OH
CAS:<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H38N4O8Purity:Min. 95%Molecular weight:678.73 g/molTIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H189N33O35S3Purity:Min. 95%Molecular weight:2,882.3 g/molACTH (18-39) (human)
CAS:<p>ACTH is a polypeptide hormone that regulates the release of cortisol from the adrenal cortex. ACTH (18-39) is a fragment of ACTH which binds to the glucocorticoid receptor with high affinity. The carboxy terminal sequence of ACTH (18-39) is identical to that of human ACTH and can be used as an immunogen to produce monoclonal antibodies against ACTH. The monoclonal antibodies can then be used in prognostic studies for patients with congestive heart failure, diabetic neuropathy, or k562 cells. ACTH (18-39) has an optimum pH level of 7.0 and can bind to cellular receptors at physiological concentrations. It also has a molecular weight of 4,000 Daltons and is soluble in trifluoroacetic acid and hydrogen fluoride, but not in water or methanol.</p>Formula:C112H165N27O36Purity:Min. 95%Molecular weight:2,465.67 g/molH-Gly-Arg-pNA·2 HCl
CAS:<p>Please enquire for more information about H-Gly-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N7O4·2HClPurity:Min. 95%Molecular weight:424.28 g/molpTH (18-48) (human)
CAS:<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H251N47O43SPurity:Min. 95%Molecular weight:3,505.02 g/mol(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt
CAS:<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>Formula:C109H163N25O32SPurity:Min. 95%Molecular weight:2,367.68 g/mol(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H69N9O11SPurity:Min. 95%Molecular weight:920.13 g/mol(Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H107N25O19S2Purity:Min. 95%Molecular weight:1,594.82 g/molZ-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone
<p>Please enquire for more information about Z-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H46FN5O11Purity:Min. 95%Molecular weight:695.73 g/molH-Gln-Gly-OH
CAS:<p>H-Gln-Gly-OH is a proteolytic enzyme that cleaves peptide bonds in proteins. It is an enzyme that is involved in inflammatory diseases, as it has been shown to inhibit the production of messenger RNA (mRNA) and protein synthesis. H-Gln-Gly-OH also has anti-inflammatory properties. It has been shown to inhibit the production of amines from the amino acid arginine, which may be linked to its anti-inflammatory effects. This enzyme does not have a specific role in human metabolism and is found in human liver and other tissues. The structural analysis of this enzyme reveals that it contains a carbonyl group and an amide group with acidic properties. H-Gln-Gly-OH has been implicated in autoimmune diseases and infectious diseases, as it has been found in Streptococcus pyogenes, Mycoplasma pneumoniae, Borrelia burgdorferi, Coxiella burnetii</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/molAnti-Inflammatory Peptide 3
CAS:<p>Anti-Inflammatory Peptide 3 (AIP3) is a peptide that contains an ester linkages and a carboxylic ester, which are both hydrophobic. The amino acid sequence of AIP3 is H-Met-Gln-Met-Asn-Lys-Val-Leu-Asp-Ser. AIP3 has been shown to have antiinflammatory properties and can be used as a diagnostic tool for inflammation. This peptide also has prodrug properties and can be conjugated with drugs to form drug linkers.</p>Formula:C43H76N12O15S2Purity:Min. 95%Molecular weight:1,065.27 g/molBoc-D-Glu-OEt·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO6·C12H23NPurity:Min. 95%Molecular weight:456.62 g/molH-Ala-His-OH
CAS:<p>H-Ala-His-OH is a dietary supplement that contains histidine and alanine. Histidine is an amino acid involved in protein synthesis, which is a process that produces proteins from amino acids. H-Ala-His-OH has shown to inhibit chemical reactions involving histidine, such as the conversion of histidine to urocanic acid by bacterial enzymes. The uptake of H-Ala-His-OH has been shown to be increased by creatine supplementation, which may be due to the ability of creatine to increase cellular energy levels. Magnetic resonance spectroscopy (MRS) analysis has shown that H-Ala-His-OH increases glutamine levels in the brain. This may be due to its ability to cross the blood brain barrier and affect glutamate transport through the blood brain barrier.</p>Formula:C9H14N4O3Purity:Min. 95%Molecular weight:226.23 g/mol(Nle 8·18,Tyr34)-pTH (3-34) amide (bovine)
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (3-34) amide (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H279N53O48Purity:Min. 95%Molecular weight:3,917.44 g/mol1-Methylbiguanide sulfate
CAS:<p>Please enquire for more information about 1-Methylbiguanide sulfate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C4H8N8H2SO4Purity:Min. 95%Molecular weight:266.24 g/mol(Met(O)35)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O61SPurity:Min. 95%Molecular weight:4,530.04 g/molZ-D-Orn (Z)-OH
CAS:<p>Please enquire for more information about Z-D-Orn (Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H24N2O6Purity:Min. 95%Molecular weight:400.43 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/mol([D2]Gly4)-Cholecystokinin Octapeptide (sulfated) ammonium salt
<p>Please enquire for more information about ([D2]Gly4)-Cholecystokinin Octapeptide (sulfated) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H60D2N10O16S3Purity:Min. 95%Molecular weight:1,145.28 g/molH-D-Phg-Leu-OH
CAS:<p>H-D-Phg-Leu-OH is a protein that has been shown to have protease activity. It is encoded by the gene for human mitochondrial protein. H-D-Phg-Leu-OH is involved in the adsorption mechanism of proteins in cells, which may be due to its ability to form disulfide bonds with other molecules. H-D-Phg-Leu-OH also has the ability to bind specifically to antibodies and monoclonal antibodies that are directed against it. The biological function of this protein is not known, but it has been found that it is differentially expressed between women and men. Studies using a polymerase chain reaction showed that H-D-Phg-Leu-OH was upregulated in cancer cells and its expression increased with increasing body mass index (BMI).</p>Formula:C14H20N2O3Purity:Min. 95%Molecular weight:264.32 g/molStresscopin-Related Peptide (human)
CAS:<p>Please enquire for more information about Stresscopin-Related Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H358N68O57Purity:Min. 95%Molecular weight:4,687.46 g/molAc-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2
CAS:<p>Please enquire for more information about Ac-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N7O6Purity:Min. 95%Molecular weight:842.04 g/molFmoc-N-methylglycine
CAS:<p>Fmoc-N-methylglycine is a modified form of the amino acid glycine, which has been modified to include a reactive group that can be used to link other molecules. This molecule has gram-negative bacterial activity and exhibits potent antibacterial activity against many gram-positive bacteria. Fmoc-N-methylglycine is also an antimicrobial peptide with binding constants in the nanomolar range. It is also an agent that binds to serotonin, which may explain its effects on mood and sleep. Fmoc-N-methylglycine can be synthesized using stepwise solid phase synthesis methods or by conjugation with other molecules.</p>Formula:C18H17NO4Purity:Min. 95%Molecular weight:311.33 g/molAc-Tyr-Val-Ala-Asp-AMC
CAS:<p>Ac-Tyr-Val-Ala-Asp-AMC is a compound that has been shown to induce apoptotic cell death in MDA-MB-231 breast cancer cells. It inhibits the activity of proteases, which are enzymes that degrade proteins. Ac-Tyr-Val-Ala-Asp-AMC has also been shown to inhibit serine proteases and granule neurons, which are proteins in the brain that regulate the production of atp levels. Ac-Tyr-Val-Ala-Asp-AMC has also been shown to inhibit muscle cell proliferation. Acetylcholine (ACh) is a neurotransmitter responsible for signaling between nerve cells in the central nervous system and other parts of the body. Acetylcholine is synthesized by choline acetyltransferase (ChAT), an enzyme that breaks down acetylcholine into choline and acetate. Inhibition of ChAT leads to a decrease in</p>Formula:C33H39N5O10Purity:Min. 95%Molecular weight:665.69 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C65H93N15O26Purity:Min. 95%Molecular weight:1,500.52 g/molAnti-Kentsin trifluoroacetate salt
CAS:<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H45N11O6Purity:Min. 95%Molecular weight:559.66 g/molApelin-12 (human, bovine, mouse, rat)
CAS:<p>Apelin-12 is a peptide hormone that belongs to the group of apelin family. It is an endogenous agonist for the apelin receptor and has been shown to affect metabolic and cardiovascular regulation. Apelin-12 has been found to increase systolic blood pressure, which may be due to its ability to inhibit the synthesis of nitric oxide in the heart. It also exhibits anti-inflammatory properties, which have been shown in vivo using a model of colitis induced by dextran sulfate sodium (DSS). The biological properties of this hormone are not yet fully understood. However, it is known that it has effects on cardiac contractility and myocardial infarct size in vivo. Further investigation into this protein's role in inflammatory diseases and metabolic disorders may lead to new treatments for these conditions.</p>Formula:C64H103N21O14SPurity:Min. 95%Molecular weight:1,422.7 g/molFA-Lys-Ala-OH
CAS:<p>FA-Lys-Ala-OH is a mutant enzyme that has an expressed constitutive mutation. It is a mutational variant of the wild type enzyme with an additive kinetic effect. The kinetic constants for this mutant were determined and correlated to determine the determinants of the mutations. This mutant has uncharged substitutions in its carboxypeptidase B active site, which changes its pH optimum from acidic to neutral values.</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molH-Tyr-Tyr-Tyr-OMe
CAS:<p>H-Tyr-Tyr-Tyr-OMe is a chiral, fluorinated, enantiomeric molecule that is synthesized by the reaction of an aryloxybenzene with tetrahydropyran and chlorine. This product has been used in asymmetric synthesis as a building block for pyrazole derivatives. It has also been used to produce alcohols and dialkylamino compounds.</p>Formula:C28H31N3O7Purity:Min. 95%Molecular weight:521.56 g/molTRAP-5 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H51N9O6Purity:Min. 95%Molecular weight:633.78 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N5O5·HClPurity:Min. 95%Molecular weight:534.05 g/mol(His(1-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(1-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13Purity:Min. 95%Molecular weight:1,196.32 g/mol(Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken)
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H72N16O12Purity:Min. 95%Molecular weight:1,221.33 g/molBoc-D-Ala-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-D-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Leu-Leu-Leu-Phe-OMe·HCl
CAS:<p>Please enquire for more information about H-Leu-Leu-Leu-Phe-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H46N4O5·HClPurity:Min. 95%Molecular weight:555.15 g/molZ-Gln(Mtt)-OH
CAS:<p>Please enquire for more information about Z-Gln(Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H32N2O5Purity:Min. 95%Molecular weight:536.62 g/molAc-Trp-NHMe
CAS:<p>Ac-Trp-NHMe is a hydrogen bond acceptor, which is a functional group that can form hydrogen bonds with other molecules. It is found in proteins and has been extensively studied by protein data bank. The amide group of Ac-Trp-NHMe forms a hydrogen bond with the carbonyl group of the amino acid tryptophan. The molecule has been used as a model system for studying the fluorescence properties of tryptophan, and to understand vibrational spectra. Ac-Trp-NHMe has also been shown to be an important chemical in plants, where it is involved in the formation of the dry weight of plants and water molecules.</p>Formula:C14H17N3O2Purity:Min. 95%Molecular weight:259.3 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/molMCH (salmon) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C89H139N27O24S4Purity:Min. 95%Molecular weight:2,099.49 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/molPerisulfakinin
CAS:<p>Perisulfakinin (PSK) is a cyclic peptide that has been isolated from the venom of the fly Phera insolita. PSK has a high affinity for protease activity and can be used as an inhibitor of proteases in control experiments. PSK is also an activator of cation channels and may be used as a neurotransmitter or neuromodulator in insects. The PSK peptide is present in dipteran species and can be seen by electron microscopy in their abdominal ganglia. PSK also activates Ca2+ influx into cells, which can lead to cell death. The PSK peptide is converted to cleavage products by enzymes, with bioassays being one way to measure these products.</p>Formula:C64H86N18O22S2Purity:Min. 95%Molecular weight:1,523.61 g/molH-Ile-Glu-OH
CAS:<p>Please enquire for more information about H-Ile-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:260.29 g/molHSV-1 Glycoprotein (gB) (497-507)
CAS:<p>Please enquire for more information about HSV-1 Glycoprotein (gB) (497-507) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H91N15O18Purity:Min. 95%Molecular weight:1,298.44 g/molZ-L-Valine N-hydroxysuccinimide ester
CAS:<p>Z-L-Valine N-hydroxysuccinimide ester is a synthetic δ opioid ligand that has been shown to have potent inhibitory activity against casein. The compound has also been shown to have high affinity for opioid receptors and δ opioid receptors, which may be due to its ability to form supramolecular complexes with these proteins. Z-L-Valine N-hydroxysuccinimide ester binds to the receptor binding site of the protein, preventing it from interacting with other molecules. It is not selective for one receptor over another and can bind to both the δ and μ opioid receptors. This synthetic substance may be used as a lead compound in drug development.</p>Formula:C17H20N2O6Purity:Min. 95%Molecular weight:348.35 g/mol3-Methoxybenzyl chloride
CAS:<p>3-Methoxybenzyl chloride is a polymer conjugate that has the chemical formula C6H5CH2ClO. It reacts with hydroxy groups to form ester bonds. The compound was synthesized by reacting 3-methoxybenzyl chloride with hydrochloric acid in vitro, and the resulting product was found to have antimicrobial properties. In vivo studies have shown that this compound binds to receptors in rat striatal tissue. 3-Methoxybenzyl chloride also showed fluorescence properties when exposed to ultraviolet light and can be used for molecular modeling. Titration calorimetry has been used to study the thermal stability of this polymer conjugate.</p>Formula:C8H9ClOPurity:Min. 95%Molecular weight:156.61 g/molN-Benzoyl-L-leucine-β-naphthylamide
CAS:<p>N-Benzoyl-L-leucine-beta-naphthylamide is a chromogenic substrate for transpeptidase. It is hydrolyzed to L-phenylalanine and 2-naphthylamine, which react with the chromogen to produce a color change. The reaction occurs in both spermatozoa and epithelial cells, but can be inhibited by aminopeptidase and peptidase. This substrate is used as a marker for spermatozoa in semen analysis.</p>Formula:C23H24N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:360.45 g/molVasonatrin Peptide (VNP) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vasonatrin Peptide (VNP) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H198N36O36S3Purity:Min. 95%Molecular weight:2,853.31 g/molH-Gly-Arg-Gly-Asp-OH
CAS:<p>H-Gly-Arg-Gly-Asp-OH is a cyclic peptide with the amino acid sequence of Gly-Arg-Gly-Asp. It has been shown to promote bone formation and inhibit bone resorption in vitro by stimulating the release of growth factors. This peptide can be used as a diagnostic agent for monitoring cell culture, which may be due to its ability to bind monoclonal antibodies. H-Gly-Arg-Gly-Asp-OH also has the ability to form conjugates with polymerase chain reaction (PCR) probes or other biomolecules. These conjugates can be used for detecting specific DNA sequences, such as those found in mammalian cells.</p>Formula:C14H25N7O7Purity:Min. 95%Molecular weight:403.39 g/molPhenylac-Leu-Asp-Phe-D-Pro-NH2
CAS:<p>Phenylac-Leu-Asp-Phe-D-Pro-NH2 is a molecule that inhibits the inflammatory response by binding to the active site of proteinase 3. It has been shown to be effective in treating bowel disease, such as Crohn's disease, and also shows potential for use in other inflammatory diseases, including autoimmune diseases and blood disorders. Phenylac-Leu-Asp-Phe-D-Pro-NH2 is an inhibitor of proprotein convertase 3 (PC3) and has been shown to inhibit the activity of PC3 in vitro. This inhibition leads to reduced production of inflammatory cytokines and decreased inflammation in animal models. Clinical studies have demonstrated that phenylacetic acid ester derivatives are safe for use in humans.</p>Formula:C32H41N5O7Purity:Min. 95%Molecular weight:607.7 g/mol(Phe4)-Dermorphin (1-4) amide
CAS:<p>Dermorphin is a peptide that is derived from the proenkephalin gene. It is an opioid analgesic and has been shown to be effective in the treatment of hernias. Dermorphin has also been shown to inhibit platelet aggregation and blood coagulation, making it an antithrombotic therapy. The structure of dermorphin has been determined using a hydroxy group as the reactive site for synthesis and molecular modelling techniques. Dermorphin has also been shown to have an active oxygen species selectivity index (a measure of antioxidant activity) higher than those of other drugs in its class, which makes it suitable for use as a sealant in abdominal surgery.</p>Formula:C30H35N5O5Purity:Min. 95%Molecular weight:545.63 g/molAmyloid Bri Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H273N49O52S2Purity:Min. 95%Molecular weight:3,935.45 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molSuc-Ala-Ala-Pro-Val-AMC
CAS:<p>Suc-Ala-Ala-Pro-Val-AMC is a protease inhibitor that inhibits serine proteases by binding to the reactive site. It has been shown to inhibit prorenin, a renin enzyme that is involved in the regulation of blood pressure and kidney function. Suc-Ala-Ala-Pro-Val-AMC has also been shown to inhibit thrombin, which is involved in blood coagulation, and neutrophil elastase, which is responsible for the degradation of elastin fibers. Suc-Ala-Ala-Pro-Val-AMC has been shown to be effective against babesiosis, an infection caused by the protozoan parasite Babesia microti. This drug is expected to have a neutral pH and high detection sensitivity when used in clinical settings.</p>Formula:C30H39N5O9Purity:Min. 95%Molecular weight:613.66 g/mol4-Methyl-5-formylthiazole
CAS:<p>4-Methyl-5-formylthiazole is a synthetic molecule with in vitro antifungal activity. It has been shown to inhibit the growth of Candida albicans and Aspergillus niger, two species of fungi that are responsible for the majority of opportunistic infections in immunocompromised patients. 4-Methyl-5-formylthiazole is a nucleophilic molecule that undergoes electrophilic substitution reactions, which makes it an efficient method for generating antifungal agents. The synthesis of this compound can be achieved through the condensation of methyl formate and thiourea, followed by treatment with chloride ion to produce the desired product. 4-Methyl-5-formylthiazole is also fluorescent and has electron deficient properties, which makes it useful for diagnosis and molecular modelling.</p>Formula:C5H5NOSPurity:Min. 95%Molecular weight:127.17 g/molMozavaptan
CAS:Controlled Product<p>Mozavaptan is a pharmacological agent that acts as a vasopressin V2 receptor antagonist. It is derived through synthetic chemical processes designed to target specific neurohormonal pathways in the body. Mozavaptan exerts its effects by inhibiting the action of vasopressin, a hormone that promotes water reabsorption in the kidneys. By blocking the vasopressin receptors, it enhances water excretion and corrects imbalances in electrolyte levels, particularly addressing conditions like hyponatremia.</p>Formula:C27H29N3O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:427.54 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H209N41O38Purity:Min. 95%Molecular weight:3,014.36 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/mol(Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H74N10O14SPurity:Min. 95%Molecular weight:1,035.22 g/mol3-Bromo-2-methylaniline
CAS:<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>Formula:C7H8BrNPurity:Min. 95%Color and Shape:Clear Colourless To Yellow To Brown Or Red-BrownMolecular weight:186.05 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/molPmc-S-methylisothiourea
CAS:<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Formula:C16H24N2O3S2Purity:Min. 95%Color and Shape:PowderMolecular weight:356.51 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/molFmoc-Phe-Arg-OH
CAS:<p>Fmoc-Phe-Arg-OH is a peptide ligand that is able to bind to the receptor on osteoblasts, which are cells in bones. This binding triggers a cascade of events leading to the production of an extracellular matrix that provides structural support for the bone. The hydrogel used in this study consists of Fmoc-Phe-Arg-OH and a collagen backbone. It has been shown that Fmoc-Phe-Arg-OH can increase the proliferation rate of osteoblast cells in vitro when used with a collagen matrix. This may be due to its ability to induce cell differentiation and stimulate protein synthesis by binding to the receptor on osteoblasts.</p>Formula:C30H33N5O5Purity:Min. 95%Molecular weight:543.61 g/molPyr-Phe-Leu-pNA
CAS:<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>Formula:C26H31N5O6Purity:Min. 95%Molecular weight:509.55 g/molBoc-Leu-psi(CH2NH)Leu-OH
CAS:<p>Please enquire for more information about Boc-Leu-psi(CH2NH)Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H34N2O4Purity:Min. 95%Molecular weight:330.46 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/molH-Glu-Ala-OH
CAS:<p>H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br>br><br>br>br><br>This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (</p>Formula:C8H14N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:218.21 g/molC-Reactive Protein (CRP) (174-185)
CAS:<p>Please enquire for more information about C-Reactive Protein (CRP) (174-185) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H93N13O16Purity:Min. 95%Molecular weight:1,276.48 g/molSpexin trifluoroacetate salt
CAS:<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O19SPurity:Min. 95%Molecular weight:1,619.89 g/molZ-Glu-Leu-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Z-Glu-Leu-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N2O7·C12H23NPurity:Min. 95%Molecular weight:575.74 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H84N20O13Purity:Min. 95%Molecular weight:1,329.47 g/mol2-Iodo-5-methoxybenzoic acid
CAS:<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>Formula:C8H7IO3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.04 g/molH-Trp-Lys-OH formiate salt
CAS:<p>H-Trp-Lys-OH formiate salt is a tryptophan derivative that is stable in air and has been shown to have anti-inflammatory properties. It inhibits the synthesis of proinflammatory cytokines as well as cyclooxygenase, lipoxygenase, and nitric oxide synthase enzymes. This compound also inhibits the production of inflammatory mediators, such as leukotrienes, prostaglandins, and thromboxanes. H-Trp-Lys-OH formiate salt has been shown to be effective in lung diseases such as asthma and chronic obstructive pulmonary disease (COPD). It has also been shown to have an effect on autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus (SLE). H-Trp-Lys-OH formiate salt can be used for the treatment of infectious diseases such as HIV and malaria due to its ability to inhibit viral replication.</p>Formula:C17H24N4O3Purity:Min. 95%Molecular weight:332.4 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol(R)-methyl pyrrolidine-3-carboxylate hydrochloride
CAS:<p>Please enquire for more information about (R)-methyl pyrrolidine-3-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%FGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molFmoc-Asp(OtBu)-Ser(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Asp(OtBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H34N2O8Purity:Min. 95%Molecular weight:538.59 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>The Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a biologically active form of arginine. It has been shown to inhibit the activity of both NS3 protease and NS4A protease from the hepatitis C virus (HCV). It also inhibits tumor cell growth in vitro, which may be due to its ability to upregulate epidermal growth factor receptor (EGFR) expression on tumor cells. The Arg-Arg-Arg-Arg-Arg-Arg-Arghydrogen trifluoroacetate salt is an inhibitor of estrogen receptor modulators that are used as therapeutic agents for breast cancer.</p>Formula:C42H86N28O8Purity:Min. 95%Molecular weight:1,111.32 g/molH-Arg-D-Asp-OH
CAS:<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N5O5Purity:Min. 95%Molecular weight:289.29 g/molBoc-Ser(Ile-Fmoc)-OH
CAS:<p>Boc-Ser(Ile-Fmoc)-OH is a peptide synthesis reagent that can be used for the efficient and convenient preparation of peptides. It is a synthetic, non-natural amino acid that has been synthesized by the chemists at Pfizer. Boc-Ser(Ile-Fmoc)-OH is an epimer of natural L-serine and has been shown to be more soluble than L-serine making it easier to work with. This reagent can also be used in the synthesis of biomolecules such as proteins and nucleic acids. The chemistry behind this compound has been published in the journal Biomolecular Chemistry.</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H86N14O13SPurity:Min. 95%Molecular weight:1,087.34 g/molL-Arginine
CAS:<p>Please enquire for more information about L-Arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H14N4O2Color and Shape:White PowderMolecular weight:174.2 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C215H355N63O54SPurity:Min. 95%Molecular weight:4,718.58 g/molBoc-Asp(OBzl)-chloromethylketone
CAS:<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>Formula:C17H22ClNO5Purity:Min. 95%Molecular weight:355.81 g/molBoc-Met-Met-OH
CAS:<p>Please enquire for more information about Boc-Met-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H28N2O5S2Purity:Min. 95%Molecular weight:380.53 g/molAc-Cys(farnesyl)-OH
CAS:<p>Ac-Cys(farnesyl)-OH is a synthetic chemical that has been shown to inhibit the growth of cells. It inhibits the enzyme form of farnesyl protein transferase, which is involved in the synthesis of basic proteins. Ac-Cys(farnesyl)-OH also binds to and inhibits epidermal growth factor receptor, which plays an important role in cell proliferation. In addition, this compound has been found to have anti-cancer properties. Ac-Cys(farnesyl)-OH has been shown to reduce the frequency of cellular transformation in vitro and in vivo. This effect may be due to its ability to inhibit protease activity.</p>Formula:C20H33NO3SPurity:Min. 95%Molecular weight:367.55 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H85FN16O13Purity:Min. 95%Molecular weight:1,365.51 g/molHSV-1-amide UL 26 Open Reading Frame (242-255)
CAS:<p>Please enquire for more information about HSV-1-amide UL 26 Open Reading Frame (242-255) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H117N21O20SPurity:Min. 95%Molecular weight:1,724.98 g/mol(Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/mol4-Methylbenzyl acetate
CAS:<p>4-Methylbenzyl acetate is a monocarboxylic acid that is an oxidation product of benzyl esters. It has been found to be a suitable catalyst for the oxidation of wastewater containing monocarboxylic acids, including acetic acid, propionic acid and butyric acid. The catalytic mechanism of 4-methylbenzyl acetate was found to be an acylation reaction in which the carboxyl group of 4-methylbenzyl acetate acts as an acylating agent with the hydrogen atom of the substrate. The reaction mechanism for this process is similar to that for other types of carboxylic acids, such as propionate and butyrate. 4-Methylbenzyl acetate also has functional groups that allow it to act as both a base and a nucleophile in addition to its ability to act as an acylating agent.</p>Formula:C10H12O2Purity:Min. 95%Molecular weight:164.2 g/mol(Glu9)-Exenatide (2-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Glu9)-Exenatide (2-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C179H277N47O59SPurity:Min. 95%Molecular weight:4,063.46 g/molZ-Gly-His-OH
CAS:<p>Please enquire for more information about Z-Gly-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molGuanylin (human)
CAS:<p>Please enquire for more information about Guanylin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H87N15O21S4Purity:Min. 95%Molecular weight:1,458.66 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H229N45O37Purity:Min. 95%Molecular weight:3,050.52 g/molN-Me-Abz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H116N26O18Purity:Min. 95%Molecular weight:1,609.83 g/molAc-Thr-Leu-Asn-Phe-OH
CAS:<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>Formula:C25H37N5O8Purity:Min. 95%Molecular weight:535.59 g/molNeuropeptide FF (5-8) acetate salt
CAS:<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H39N9O5Purity:Min. 95%Molecular weight:545.63 g/molFmoc-Ala-(Dmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Ala-(Dmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N2O7Purity:Min. 95%Molecular weight:518.56 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/molH-Ala-Gly-Ala-Ala-OH
CAS:<p>Please enquire for more information about H-Ala-Gly-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N4O5Purity:Min. 95%Molecular weight:288.3 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H301N55O56S3Purity:Min. 95%Molecular weight:4,408.01 g/molH-Pro-Leu-Gly-NHOH·HCl
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-NHOH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N4O4·HClPurity:Min. 95%Molecular weight:336.81 g/molH-2,6-Difluoro-Phe-OH·HCl
CAS:<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H9F2NO2·HClPurity:Min. 95%Molecular weight:237.63 g/molAc-Gln-NH2
CAS:<p>Ac-Gln-NH2 is a multifunctional protein that has been covalently immobilized on the surface of a glass fiber. It can be used to immobilize enzymes and other proteins, as well as being able to function as an enzyme itself. Ac-Gln-NH2 has been shown to conjugate with various molecules, including antibodies, DNA, and proteins. The immobilizing process involves cross-linking the protein to the glass surface through a chemical method that uses reagents such as glutaraldehyde or epoxy resin. Immobilization of Ac-Gln-NH2 onto a glass surface allows for easier use in applications such as diagnostics and industrial processes.</p>Formula:C7H13N3O3Purity:Min. 95%Molecular weight:187.2 g/molH-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH
CAS:<p>H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH is a diacylglycerol that regulates the expression of genes and has been shown to modulate hematopoietic cells. This compound is a derivative of atypical proteins, which are proteins that have an atypical tertiary structure and do not possess a classical signal peptide or secretion signal. H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg -OH has been shown to be expressed in hematopoietic growth regulator domains, which may account for its pleiotropic effects on hematopoietic cells.</p>Formula:C39H70N18O11Purity:Min. 95%Molecular weight:967.09 g/molFmoc-Dap(Ac)-OH
CAS:<p>Fmoc-Dap(Ac)-OH is a fine chemical that is used as a building block in the synthesis of complex compounds. It reacts with various nucleophiles to form an amide bond, and has been shown to be useful for both research and industrial applications. Fmoc-Dap(Ac)-OH can also be used as a reagent to synthesize peptides, which are biologically active compounds that form the basis of many drugs. This versatile intermediate is also used as a scaffold in the construction of more complex molecules. Fmoc-Dap(Ac)-OH has CAS No. 181952-29-4 and is classified as a speciality chemical by the International Union of Pure and Applied Chemistry (IUPAC).</p>Formula:C20H20N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:368.38 g/molH-Val-His-Leu-Thr-Pro-OH
CAS:<p>Please enquire for more information about H-Val-His-Leu-Thr-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H43N7O7Purity:Min. 95%Molecular weight:565.66 g/molDynorphin A (1-9)
CAS:<p>Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-OH is a substrate binding inhibitor that blocks potassium channels. Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu Arg Arg Ile Arg OH binds to the d -alanine site of the potassium channel and inhibits glutamate release from presynaptic terminals. Dynorphin A (1 9) H Tyr Gly Gly Phe Leu Arg Arg Ile Arg OH has been shown to be a potent inhibitor of aminopeptidase activity in vitro, which may be due to its affinity for the substrate binding site on the enzyme. Its inhibition of aminopeptidase activity may lead to an increase in opioid peptides such as dynorphins and enkephalins. Dynorphin A (1 9) H Tyr Gly Gly Phe</p>Formula:C52H84N18O11Purity:Min. 95%Molecular weight:1,137.34 g/molZ-Val-D-Phe-OMe
CAS:<p>Please enquire for more information about Z-Val-D-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molZ-Leu-Leu-Tyr-a-keto aldehyde
CAS:<p>Please enquire for more information about Z-Leu-Leu-Tyr-a-keto aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H39N3O7Purity:Min. 95%Molecular weight:553.65 g/molZ-Gly-Trp-OH
CAS:<p>Z-Gly-Trp-OH is a peptide that is synthesized by combining the amino acids glycine, alanine, and tryptophan. It is used in a variety of applications, including as an antimicrobial agent, sweetener, and health care product. Z-Gly-Trp-OH has been shown to have potential health benefits such as improved insulin sensitivity and prevention of cardiovascular disease. The strategies for synthesizing this peptide are dependent on the availability of different amino acid building blocks. For example, zinc ions may be used to catalyze the condensation of glycine with tryptophan.</p>Formula:C21H21N3O5Purity:Min. 95%Molecular weight:395.41 g/molH-Met-His-OH
CAS:<p>H-Met-His-OH is a metabolite of methionine, which has been shown to have insulin sensitizing effects. H-Met-His-OH is produced from the reaction of methionine with hydrochloric acid and water molecule. This compound has been shown to modulate glucose metabolism by increasing insulin sensitivity in diabetic rats. It has also been shown to be able to increase estradiol levels in female mice, which may be due to its ability to inhibit protein synthesis. H-Met-His-OH also binds to histidine residues on the protein surface and may regulate protein kinetics via an unidentate mechanism.</p>Formula:C11H18N4O3SPurity:Min. 95%Molecular weight:286.35 g/molH-Arg(Pbf)-OtBu·HCl
CAS:<p>Please enquire for more information about H-Arg(Pbf)-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H38N4O5S·HClPurity:Min. 95%Color and Shape:PowderMolecular weight:519.1 g/molZ-Tyr-Tyr-OH
CAS:<p>Please enquire for more information about Z-Tyr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H26N2O7Purity:Min. 95%Molecular weight:478.49 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molPKI-tide
CAS:<p>PKI-tide is a potent, selective inhibitor of the calcium/calmodulin-dependent protein kinase. It inhibits the activity of this enzyme and prevents the activation of other protein kinases by this enzyme. PKI-tide binds to the ATP site of the calcium/calmodulin-dependent protein kinase and blocks the binding of ATP and calmodulin. This inhibition prevents the phosphorylation of target proteins, including myosin light chain in muscle cells.</p>Formula:C85H149N31O24Purity:Min. 95%Molecular weight:1,989.29 g/molH-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/mol(Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molZ-Gly-Ile-OH
CAS:<p>Please enquire for more information about Z-Gly-Ile-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molOsteogenic Growth Peptide (10-14) trifluoroacetate salt
CAS:<p>Osteogenic growth peptide is a cyclic peptide that has been shown to activate the production of collagen and other proteins in fibroblasts. It has also been found to promote hematopoietic cell proliferation, as well as stimulate growth in cultured cells. Osteogenic growth peptide is an analog of TGF-β1, but it differs by having a tyrosine residue at the 10th position instead of an arginine residue. This difference in amino acid sequence alters the activity of this peptide and produces a new compound with different biological effects.</p>Formula:C24H29N5O7Purity:Min. 95%Molecular weight:499.52 g/molAngiotensin I/II (4-8)
CAS:<p>Angiotensin I/II (4-8) H-Tyr-Ile-His-Pro-Phe-OH is a peptide that contains the sequence of angiotensin I and II. It has been shown to have proton transport properties, which may be related to its sequence. The amino acid sequence of this peptide is similar to other pentapeptides such as insulin and vasopressin. This peptide has been linked to a vector that can cross the blood brain barrier, allowing it to act on the central nervous system.</p>Formula:C35H45N7O7Purity:Min. 95%Molecular weight:675.77 g/molAmylin (mouse, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C167H272N52O53S2Purity:Min. 95%Molecular weight:3,920.4 g/molZ-Trp-Gly-OH
CAS:<p>Please enquire for more information about Z-Trp-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21N3O5Purity:Min. 95%Molecular weight:395.41 g/molFmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H40N4O7Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:628.71 g/mol(Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molFmoc-Trp(Boc)-Thr(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Trp(Boc)-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H41N3O8Purity:Min. 95%Molecular weight:667.75 g/mol
