Peptides

<p>Tumour antigens recognised by cytotoxic T cells (CTLs) are a keen area of research to develop antigen-specific cancer therapies. However, hurdles are weak immunogenicity and high rates of degradation in vivo. In the search for a melanoma vaccine, the human tumour antigen Melan-A/MART-1 (27-35) has been used as a model to design peptides with improved characteristics for use in anti-tumour vaccines. The MART-1 fragment provided here has an alanine substituted at position one from MART-1 (27-35) this is a natural variant of MART-1 found in the population. Melan-A specific CTL assays showed this MART-1 fragment A27L to be a superagonist with higher affinity than the parent peptide. Also, the MART-1 fragment is a more stable complex with HLA-A*0201 than the parent peptide as determined by degradation experiments using a functional cytolytic assay. The superagonist activity of the MART-1 fragment and the stability of the peptide may be a considerable step towards an anti-melanoma vaccine.</p>

<p>Cilengitide is a cyclic arginine-glycine-aspartic acid (RGD) motif containing peptide that selectively inhibits the integrin alphav subunit. Integrins are cell adhesion molecules which mediate cell-cell and cell-matrix interactions and creating a scaffold for tissue organisation. Integrins also act to regulate cell attachment, proliferation, differentiation, apoptosis and motility.Integrin alphav can form heterodimers with integrin subunits subunits β1, β3, β5, β6, or β8. Cilengitide is a highly specific antagonist of alphavβ3 and alphavβ5 integrins. It also and shows anti-angiogenic effects and inhibits growth and promotes apoptosis of tumour cells that express integrins, such as glioblastoma.Cilengitide has gone on to phase II trials for cancers such as glioblastoma, melanoma, prostate, breast, lung and head and neck cancers.</p>

<p>As an antimicrobial peptide (AMP), IDR-1 acts indirectly on pathogenic bacterial infections. IDR-1 is proposed to function by upregulating monocyte cytokines (interleukins) while also reducing a pro-inflammatory cytokine. IDR-1 has been tested for its ability to aid against the rise of multi-drug resistant bacteria. In mouse models, IDR-1 is protective against Gram-positive and Gram-negative pathogens. Supply of IDR-1 can also attenuate methicillin-resistant staphylococcus aureus (MRSA)-induced pneumonia. The IDR-1 sequence is being studied as a template to hopefully generate more potent synthetic versions.</p>

<p>Connexin43 mimetic peptide which can reduce swelling, astrogliosis, neuroinflammation and neuronal cell death following spinal cord injury ex vivo and in vivo. Reduces mechanical pain hypersensitivity by specifically targeting the NLRP3 inflammasome in the spinal cord. Possesses analgesic effects in mouse neuropathic pain models.</p>

<p>Affinity chromatography and protein purification are more successful with highly selective ligands such as short peptides. Phage libraries have been utilised to identify novel peptides for target proteins. IgG1 monoclonal antibody is traditionally purified using protein A but is not ideal due to cost and methodology. EPIHRSTLTALL was found via phage library screening as the most selective ligand possible IgG1, and also highly stable. It binds to the constant region of IgG1 known as humanized anti-Tac (HAT). HAT is a humanized monoclonal antibody against the low-affinity p55 subunit of the interleukin IL-2 receptor.</p>

<p>Amino acids 1-24 of human adrenocorticotropic hormone (ACTH), induces glucocorticoid production by adrenal cells with the same potency as full length ACTH. ACTH, also known as corticotropin, is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor- ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency.</p>

<p>Galanin is a neuropeptide synthesised and released by the brainstem locus coeruleus (LC). Galanin is expressed in most LC neurons in rodents and humans. Galanin has been shown to inhibit LC activity by hyperpolarising LC neurons, suppressing their spontaneous firing rate, and enhancing alpha2-adrenergic receptor-mediated negative feedback. Galanin is also a potent trophic and neuroprotective factor throughout the nervous system.Galanin is widely distributed in the central nervous, peripheral, and endocrine systems. Galanin's overarching function is as an inhibitory, hyper-polarizing neuromodulator for classical neurotransmitters like acetylcholine and serotonin. Galanin interacts with 3 receptor subtypes, GalR1-3, which are G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of K+. Each receptor has been associated with neurological diseases such as GalR3 and epilepsy.N-terminal fragments are naturally occurring in vivo but their relevance is not clear. Some N-terminal fragments reduce metabolic and functional disorders in experimental heart damage. Using N-terminal fragments such as galanin (3-13) can clarify the function of full-length galanin during myocardial ischemia and reperfusion injury. This may highlight new agonists/antagonists for the galanin GalR receptors that can be putative therapeutic targets.A C-terminal biotin tag for easy detection and purification has been added to the galanin (3-13) fragment. Cymit Quimica Laboratories Ltd is a custom peptide provider. If you desire an alternate tag, please contact us to request a custom synthesis.</p>

<p>CHKtide is a synthetic peptide substrate for checkpoint-kinase-1 and 2 (CHK1/CHK2) as well as salt-inducible kinase (SIKs) for use in kinase assays. CHKtide has been derived from CDC25C which is phosphorylated by CHK1/CHK2 in one of the DNA repair pathways. SIKs are serine/threonine kinases that are part of a complex network that regulate sodium homeostasis and blood pressure.The serine residue at position 5 of this peptide has been phosphorylated.</p>

<p>Neurokinin A (NKA) is a member of the classical tachykinins family of peptides which also includes substance P and neurokinin B. These peptides are primarily found in the nervous system where they act as neurotransmitters and neuromodulators. They also play key roles in neuronal inflammation, and high levels of NKA have been linked to poor prognosis of some tumours.The tachykinin peptides are characterised by a common C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X represents either an aromatic (Phe, Tyr) or a branched aliphatic (Val, Ile) amino acid.This C-terminal region is thought to be responsible for activating the receptor. The divergent N-terminal region is thought to play a role in determining the receptor subtype selectivity. NKA binds preferentially to the NK2 receptor.</p>

<p>The identification of T cell epitopes is vital for a range of immunological functions including viral vaccine design. Current influenza vaccines are designed to induce protective humoral immunity by exposure to inactivated influenza leading to an induction of potent CD4+ T cell memory.  However, little is known about how these primed CD4+ T cells effect the response to other viruses that share a common T cell epitope.Sendai Virus nucleoprotein (324-332) has been identified as a T cell epitope and used in T cell assays to stimulate a response. Further use of Sendai virus nucleoprotein (324-332) epitope in vitro could help uncover the effect of immune response to heterologous viruses with common epitopes. It may also help understand the impact of using primed CD4+ T cell as vaccines. This could have consequences for future vaccine design to improve specificity and potency of the immune cells.</p>

<p>Residues 1-10 of the gastrointestinal hormone motilin, secreted from endocrine cells in the small intestines, mainly from the jejunum and duodenum, in response to the fasting, drinking water or the mechanical stimulus of eating.</p>

<p>ID4 is a highly versatile epitope tag. The peptide sequence is highly specific to rhodopsin and related photoreceptor proteins, meaning when used with monoclonal antibodies off-target signals are virtually non-existent. ID4 is also devoid of charged residues therefore reducing nonspecific ionic interactions. Monoclonal antibodies also bind to ID4 with high affinity therefore there is less need for inserting multiple copies of ID4.</p>

<p>Histone 4 (H4) is one of the four core histones (H2A, H2B, H3 and H4) which are essential for compacting eukaryotic DNA into the nucleosome. Due to the high lysine and arginine content, histones have a net positive charge and therefore electrostatically interact with negatively charged DNA. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Like other core histones, H4 has a globular domain and a flexible N-terminal domain, the histone tail, which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Gene transcriptional activation or inactivation is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes. Both processes function to alter the positioning of the nucleosome, allowing the DNA within to be either accessible to the transcription machinery or inaccessible. H4 lysine rich tail plays a role in the higher order chromatin folding.The lysine at position 16 has been acetylated, which neutralizes the positive charge on the amino acid, loosening the chromatin structure. This alteration to the accessibility of chromatin promotes the initiation of transcription.Acetyl-Histone H4 (1-23) K16Ac-GG-[Lys(5-FAM)] has a C-terminal GGK linker labelled with 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag. Additionally, this peptide has an uncharged C-terminal amide and is protected from N-terminal modifications by a covalently bonded acetyl group.</p>

<p>MOCAc-Pro-Cha-Gly-Nva-His-Ala-Dap(Dnp)-NH2 is a peptide that inhibits the activity of various proteases, including collagenase, MMPs and stromelysin. It has been shown to inhibit cancer cells in vitro and to reduce tumor growth in vivo. MOCAc-Pro-Cha-Gly-Nva-His-Ala-Dap(Dnp)-NH2 may be useful for the treatment of angiogenesis and metastasis, which are hallmarks of cancer.<br>MOCAc is an inhibitor of matrix metalloproteinases (MMPs), which are enzymes that break down the extracellular matrix and basement membrane during tissue remodeling. MOCAc inhibits both type I (collagenases) and type II (gelatinases) collagenase activity, as well as other proteolytic activities such as stromelysin or elast</p>

<p>Fmoc-Cys(Trt)-Wang Resin (100-200 mesh) 1% DVB is a research tool that is used as an activator, ligand or receptor for cell biology, antibody production or ion channels. It has been used in the study of protein interactions and pharmacology. Fmoc-Cys(Trt)-Wang Resin (100-200 mesh) 1% DVB is a high purity resin that can be used to synthesize peptides and compounds for life science purposes. It is also an inhibitor that can be used to block enzymatic reactions.</p>

<p>M-CSF is a protein that is involved in the regulation of the immune system. It is an activator of macrophages, and it also binds to receptors on cells of the immune system. It can be used as a research tool for studying how cells communicate with each other, and how certain proteins interact with each other. M-CSF is also an antibody that can bind to ion channels and other proteins. This antibody can be used for pharmacological studies to find inhibitors for specific proteins or peptides. M-CSF has been shown to have effects on many different types of cells, including lymphocytes, monocytes, neutrophils, eosinophils, basophils, and mast cells.</p>

<p>H-Phe-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used in peptide synthesis. It has been shown to react with amines and thiols, as well as alcohols, yielding a resin that can be used for the protection of amino acids during peptide synthesis. This product is supplied as a dry powder containing 1% DVB, 100 to 200 mesh.</p>

Fmoc-Thr(tBu)-Rink-Amide MBHA Resin is a resin that can be used for the synthesis of peptides. It is an inhibitor of Protein interactions, Activator, Ligand, and Receptor. This resin can be used in research to study ion channels and antibodies. Fmoc-Thr(tBu)-Rink-Amide MBHA Resin is also a high purity product with CAS No.

<p>Unsubstituted Resins for Solid Phase Synthesis; 0.3-0.65 meq/g</p>

<p>Angiotensin II is a peptide hormone that is secreted by the kidneys. It stimulates the release of aldosterone and causes vasoconstriction, leading to an increase in blood pressure. Angiotensin II is also involved in other physiological functions such as the regulation of fluid balance, electrolyte levels, and blood coagulation. The drug is used to treat congestive heart failure and high blood pressure. Sar1-Angiotensin II has been shown to inhibit transcriptional regulation by binding to the angiotensin receptor type 1 (AT1). This binding disrupts conformational changes in the receptor, preventing signal transduction from occurring and decreasing the activity of enzymes such as protein kinase A, which are needed for activation of transcription factors.</p>

<p>Presenilin 1 (349-361) is a peptide that is a substrate for glycogen synthase. It is cleaved from the precursor protein presenilin 1 and has a molecular weight of 4.5 kDa. Presenilin 1 (349-361) is an enzyme substrate that can be used in biochemical assays to research glycogen metabolism.</p>

<p>H-Trp(Boc)-2-ClTrt-Resin (200-400 mesh) is a resin that contains amines and thiols. It can be used as a building block of peptides and proteins. H-Trp(Boc)-2-ClTrt-Resin (200-400 mesh) can also be used in the synthesis of alcohols, which are important chemicals for industry.</p>

<p>Lys18[(AEEA)2-5-FITC]-Hepcidin (Human) is a FITC-Labeled Hepcidin for cell detection by flow cytometry and by fluorescent or confocal microscopy. Human Hepcidiin is a peptide hormone that is produced by the liver and is heavily involved in iron homeostasis through binding to and preventing ferroportin from exporting iron. Hepcidin has also demonstrated its capabilites as an anti-microbial peptide, preventing the amount of iron available to invading pathogens. This product consists of the following disulfide Bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14- Cys22<br>One-Letter Formula: DTHFPICIFCCGCCHRSK(AEEA-AEEA-5-FITC)-CGMCCKT</p>

<p>Z-Phe-Tyr-aldehyde is a natural compound that inhibits the activity of cathepsin, an enzyme associated with cancer and bowel disease. The compound also inhibits the expression of covid-19, which is a protein that regulates cell death. Z-Phe-Tyr-aldehyde has been shown to cause caspase-independent cell death in human leukemia cells. This compound also blocks the TLR4 receptor, which is thought to play a role in infectious diseases such as SARS and Covid-2. It has been found to inhibit protein synthesis in bacteria, which may be due to its ability to inhibit ribosomal function.</p>

<p>24-Epibrassinolide is a synthetic molecule that has an optical rotation of +19.4° at 20°C. It is also known as H-Leu-Glu-OH and is a product of the reaction between epibatidine and L-glutamic acid. This molecule has been synthesized to study the role of 24-epibrassinolide in photosynthesis, chlorophyll synthesis, and membrane stability. The phosphate group is attached to the amino group on the n-terminal amino acid. 24-Epibrassinolide has an amino acid composition consisting of leucine, glutamate, glutamine, glycine, proline, serine, cysteine, tyrosine, asparagine, histidine and lysine.<br>24-Epibrassinolide was first isolated from chloroplasts using refluxing water with ammonium chloride as a solvent. This molecule can be found in nature as well.</p>

<p>Z-Tyr-Ala-OH is an inactivating agent that irreversibly inactivates the zymogens of porcine pancreatic proteinase. It has been shown to be a liquid chromatography and high-performance liquid chromatography substrate for the separation of peptides. Z-Tyr-Ala-OH is also catalytic, which means it can react with other substances without being changed. This chemical has been shown to irreversibly inactivate both acidic and basic proteolytic enzymes, such as pepsin and trypsin respectively. Additionally, this substance also reacts with calcium ions to form a thioether bond with cysteine residues on proteins, including those found in bacterial cell walls.</p>

<p>Please enquire for more information about Ag85B (41-61) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-VNSVIEK-OHH-EQLSSVSSFER-OHH-TLDYHDSNVK-OHH-ITFEATGNLVAPR-OHPeptide purity: &gt;98%AAA: Concentration - Duplicate<br>kit contains 100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquots</p>

<p>Catalogue peptide; min. 95% purity; TFA salt</p>

<p>Endogenous calcitonin gene-related peptide receptor (CGRP) agonist which is secreted in both peripheral and central neurons. It is a potent vasodilator and can function in the transmission of nociception as well as acting as an appetite suppressant and contributing to gastric acid secretion.  It also has a function in temperature homeostasis, increases heart rate, and can play a role in the release of the pituitary hormone.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SULT1B1 antibody, catalog no. 70R-2607</p>

<p>Cyclo(-Met-Pro) is a synthetic antioxidant that inhibits the proliferation of cancer cells. Cyclo(-Met-Pro) binds to the reactive oxygen species (ROS), such as hydroxyl, alkoxy, and peroxyl radicals, in the cell and prevents them from damaging DNA. Cyclo(-Met-Pro) also inhibits the generation of ROS by reacting with metal ions, such as iron and copper. This compound has been shown to have an effect on human cells by inhibiting the proliferation of cancer cells. Cyclo(-Met-Pro) is synthesized by reacting methylamine with cyclopentadiene in sodium hydroxide solution or hydroxide solution. The synthesis can be monitored using spectrometry analyses.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Matriptase antibody, catalog no. 70R-12147</p>

<p>H-Ala-Phe(para-Fluoro)-Arg-Cha-homoArg-Tyr-NH2 is a peptide with a parathyroid hormone (PTH) receptor agonist activity. It activates the thrombin receptor, which is responsible for the activation of several other receptors, including Protease Activated Receptor 4 (PAR4) and PAR1. This peptide has been shown to induce hypertension in rats, an effect that may be related to its ability to activate PAR4. H-Ala-Phe(para-Fluoro)-Arg-Cha-homoArg-Tyr-NH2 also activates the protease activated receptor (PAR) peptides, which have been implicated in inflammation and coagulation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDIT4L antibody, catalog no. 70R-2699</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRPM4 antibody, catalog no. 70R-5157</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC38A1 antibody, catalog no. 70R-1754</p>

<p>Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is a peptide macrocycle that has been shown to have potent anti-cancer activity. It binds to the receptor for epidermal growth factor (EGF), which is overexpressed in many cancers, and inhibits its function. Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is also able to inhibit the production of nitric oxide by inhibiting the synthesis of arginase. This peptide has also been shown to induce apoptosis in cancer cells by altering the mitochondrial membrane potential and activating caspases 3 and 9.</p>

<p>Human Hepcidin peptide hormone product also know as LEAP-1 (liver-expressed antimicrobial peptide), where the disulfides are formed by random oxidation. Hepcidin is a peptide hormone that is synthesized in the liver and is an important regulator of iron homeostasis. Through binding to ferroportin Hepcidin prevents the exportation of iron thus reducing the amount of circulating iron. Furthermore through inflammatory cytokine induction Hepcidin leads to the internalization and degradation of ferroportin thus further reducing the amount of iron in circulation. This in turn make conditions unfavourable to invading pathogens. This demonstrates Hepcidin's ability as an anti-microbial peptide. This antimicrobial behaviour can be used in research into the elimination of pathogens but also in combatting diseases where iron dysregulation is prevalant.</p>

<p>CYN 154806 is a novel anti-inflammatory drug that inhibits the vasoactive intestinal peptide receptor and has a neuroprotective effect. It also prevents the activation of microglia, which are cells of the central nervous system responsible for immune defense. CYN 154806 is membrane permeable and can inhibit the transcription-polymerase chain reaction (PCR) in mouse hippocampal tissue and human macrophages. CYN 154806 has been shown to have a low bioavailability and a short half-life, making it difficult to measure its pharmacokinetic properties in vivo. However, CYN 154806 does not appear to be toxic at high doses.</p>

<p>Modified HIV TAT Sequence 49-57 for Click Chemistry. Product available as a trifluoroacetate salt</p>

<p>Diethylcyanomethylphosphonate is a hydrochloric acid salt of diethylcyanomethylphosphonic acid. It is used in the asymmetric synthesis of many organic molecules, including pharmaceuticals, and has been shown to have antiviral properties. Diethylcyanomethylphosphonate binds to the receptor on the surface of cells and inhibits their growth. This may be due to its ability to block the binding of sodium ions to cell receptors. The drug also prevents hydroxyl group metabolism and has been shown to be active against infectious diseases such as HIV and malaria.</p>

<p>Ara h 1 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 1 is a member of the 7/8 S globulin (vicilin) family of seed storage proteins belonging to the cupin superfamily and is the most abundant allergen present in the peanut kernel. Ara h 1 plays an important role in the allergy sensitising procedure and can be recognised by 90% of patients with a peanut allergy.This peptide represents a tryptic peptide of Ara h 1.</p>

<p>Fmoc-Leu-Wang Resin is a research tool that can be used to synthesize peptides. It is used as an activator and ligand in the production of antibodies, ion channels, and cell biology. The resin has a high purity and can be used for a variety of purposes such as pharmacology, protein interactions, and peptide synthesis. Fmoc-Leu-Wang Resin has been shown to inhibit the binding of many different proteins to their receptors.</p>

<p>Overlaping peptide library of ovalbumin, 15 amino acids per peptide with offset 11. Purity crude. All peptides are pooled in a single tube.</p>

<p>Des-Pro2-Bradykinin is a peptide that acts as a potent inhibitor of the enzyme kininase. It has been shown to inhibit the production of Angiotensin I Converting Enzyme Inhibitors (ACEs) and peptides in vitro, but not in vivo. Des-Pro2-Bradykinin may be useful for studying the role of kinins in cardiovascular disease and other conditions.</p>

<p>Fmoc-Cys(tBu)-Wang Resin (100-200 mesh) is a research tool for use in the synthesis of peptides and proteins. It is an activated resin that can be used to synthesize peptides with a C-terminal cysteine. The resin is suitable for the coupling of amines, alcohols, thiols, phosphates and other compounds. Fmoc-Cys(tBu)-Wang Resin (100-200 mesh) has been shown to be an effective inhibitor of ion channels and may have potential as a therapeutic drug for the treatment of epilepsy.</p>

<p>The peptide Des-n-octanoyl-[Ser3]-ghrelin (DOG) is a synthetic analogue of ghrelin, the only known natural ligand for the growth hormone secretagogue receptor. DOG binds to the ghrelin receptor and activates it, thereby stimulating growth hormone release from the anterior pituitary gland. In a rat model, DOG counteracts weight gain caused by high-fat diet. It also increases insulin sensitivity in diabetic rats and acts as an appetite suppressant in non-diabetic rats. As such, this peptide has potential as a therapeutic agent for obesity and diabetes.</p>

<p>A spider venom-derived peptide whose sequence is derived from the Tarantula, Thrixopelma pruriens which can be applied as a Na+ Channel (Especially Nav1.7) / Ca2+ Ion Channel Blocker (Gating Modifier). This product has disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25 and is available as a trifluoroacetate salt. For a smaller quantity in acetate form, see PTX-4450-S.</p>

<p>Vasopressin is a hormone that is synthesized by the hypothalamus and secreted by the pituitary gland. Vasopressin is used in research to activate cells and study receptor-ligand interactions. It can be used to study ion channels, cell biology, and pharmacology. Vasopressin can be used as an inhibitor of peptides or proteins.</p>

<p>Neurotensin is a neuropeptide that is involved in the regulation of a variety of physiological functions, including neurotransmission, cardiovascular function, and appetite. It is composed of 13 amino acids and is primarily produced in the gastrointestinal tract and the central nervous system.<br>Neurotensin acts as a neurotransmitter and neuromodulator in the brain, where it is synthesized by neurons in several regions, including the hypothalamus, amygdala, and nucleus accumbens. In addition to its role in neurotransmission, neurotensin has been shown to be involved in the regulation of food intake and energy metabolism. It is thought to promote satiety and reduce food intake by interacting with the hypothalamus and other brain regions involved in appetite regulation.<br>Neurotensin has also been studied for its potential therapeutic applications as it has been shown to be associated with the pathophysiology of conditions such as Parkinson's disease, pain, schizophrenia, cancer and inflammatory bowel disease.<br>This product is available as a 0.5mg vial.</p>

<p>OxymaPure® is a hydrogen bond-based molecular probe that binds to the hydroxamic acid group of bacterial cell walls. It has been shown to have an antibacterial activity against Staphylococcus aureus and Escherichia coli. OxymaPure® is soluble in water, making it suitable for oral administration. The safety profile of OxymaPure® includes studies in rats, indicating that it does not cause any toxic effects at doses up to 2000 mg/kg body weight. OxymaPure® can be synthesized on a solid phase by using carbodiimides as reactive agents and linkers as additive materials. This process is relatively rapid and produces high yields of the desired product.</p>

<p>CA-074 Me is a small molecule that binds to the receptor site of the ion channel. This binding triggers a conformational change in the ion channel, which leads to an influx of ions and an increase in membrane potential. CA-074 Me has also been shown to bind to peptide receptors and activate them, leading to similar effects on cell membranes as with ion channels. CA-074 Me is used for research purposes as it can be used as a tool for studying protein interactions and ligand-receptor binding. It is also often used as an antibody capture reagent. CA-074 Me is a research chemical that was synthesized by Hetero Drugs Limited (India) and has CAS No. 147859-80-1.END&gt;</p>

<p>Fmoc-Trp(Boc)-OH is a building block for the synthesis of peptides and other bioactive molecules. It is used in the synthesis of daptomycin, an antibiotic that is used to treat bacterial infections caused by methicillin-resistant Staphylococcus aureus (MRSA). Fmoc-Trp(Boc)-OH is also used as a synthon in the production of natural products such as kynurenine, which has been shown to have anti-cancer properties.</p>

Abz-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Gln (EDDNP) is a novel and potent inhibitor of the polymerase chain reaction (PCR). It has been shown to inhibit the activity of DNA polymerases, which are key enzymes in DNA replication. EDDNP binds to the active site of the enzyme and blocks access to the DNA template. In addition, this compound inhibits mitochondrial membrane potential, as well as transcriptional regulation and detoxification enzymes. This compound has also been shown to be effective in vivo in mouse models.

Boc-D-Met-OH is an amino acid building block that is used in the synthesis of peptides. It has been shown to have photophysical properties and specificities, as well as a helical structure. Boc-D-Met-OH has also been shown to react with anions, making it useful for peptide synthesis.

<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH is a basic protein that is a member of the growth factor β1 family. It has been shown to increase collagen production and inhibit the transcription of pro-apoptotic proteins in the carcinoma cell lines. H-Gly-Arg-Ala-Asp-Ser-Pro-OH is also known as RGD peptides, which are derived from collagen. It has been found to induce genotoxic effects, such as chromosomal aberrations and sister chromatid exchanges, in cells.</p>

<p>Fmoc-Lys(Boc)-OH is a monoclonal antibody that reacts with lysine residues. It is synthesized by reacting a solid phase support with an aliphatic hydrocarbon. The reactive functional group on the hydrocarbon terminates in an amine and forms an amide linkage to the amino terminus of the peptide. The hydroxyl terminus of the peptide is then reacted with a trifluoroacetic acid (TFA) ester of lysine in the presence of base. This reaction produces a TFA salt of Fmoc-Lys(Boc)-OH, which can be purified by high salt precipitation or reversed to produce Fmoc-Lys(Boc)-OH by treatment with base. Fmoc-Lys(Boc)-OH has been used as a reagent for chemical conjugation to fluorophores and other molecules such as biotin, avidin, strept</p>

<p>Aminomethylated Polystyrene Resin • HCl is a resin that is used in peptide synthesis. It is insoluble in water and soluble in organic solvents, such as dichloromethane, chloroform, and dimethylformamide. Aminomethylated Polystyrene Resin • HCl is an unsubstituted resin for solid phase synthesis.</p>

<p>Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.<br>The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.<br>The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.</p>

<p>Boc-ß-Ala-OH is an amino acid that inhibits the activity of gamma-aminobutyric acid (GABA) receptors. It has been shown to bind to the GABA receptor and block its activation by GABA. Boc-ß-Ala-OH is used as a building block for peptide synthesis, where it can be coupled with other amino acids to form a desired peptide sequence. This amino acid also possesses intramolecular hydrogen bonding interactions, which have been found to contribute to its inhibitory properties. Boc-ß-Ala-OH has a phase transition temperature of 104°C and is soluble in water below this point.</p>

Ac-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt is a peptide that has been shown to have anti-cancer, enzyme inhibitory, and anti-inflammatory activities. The peptide is derived from the proteolytic cleavage of human collagenase. It inhibits both matrix metalloproteinases (MMPs) and stromelysin in vitro. Acetyl Proleu Gly Gly Leu Gly OEt has also been shown to inhibit cancer cells in culture by inhibiting RNA synthesis and protein synthesis.

<p>Cyclo(Arg-Ala-Asp-D-Phe-Val) is an active, cyclic peptide that has been shown to have localized effects on the metaphase, meiosis, and gamete cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) is a cilengitide, which are small molecules that bind to calcium ions and increase intracellular levels of calcium. This leads to the activation of biochemical pathways in cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) has been shown to have a diacylglycerol antagonist effect in porcine oocytes and was used in clinical trials for the treatment of infertility. Cyclo(Arg-Ala-Asp-D-Phe Val) also has apoptotic activity in cancer cells.</p>

<p>Fmoc-His(Trt)-OH is a synthetic antimicrobial peptide that belongs to the class of acetylcholine. The peptide was found to inhibit the growth of a number of bacterial genera, including Pseudomonas, Acinetobacter and Burkholderia. The sequence of Fmoc-His(Trt)-OH is acetylated at the N-terminus and amidated at the C-terminus. This peptide has been found to have a broad spectrum of activity against drug resistant bacteria. It has also been shown to be active against mammalian cells in addition to bacterial cells, suggesting it may have therapeutic potential for humans as well as animals.</p>

<p>HBTU is a reagent that is used in the synthesis of peptides. It has been shown to have inhibitory properties and stable complexes with ester linkages. HBTU has been shown to have a negative effect on congestive heart disease, which may be due to its ability to bind to receptors and mimic the effects of peptide hormones. This compound is also used as a model system for mitochondrial membrane potential. HBTU binds covalently to the peptide hormone receptor, which slows down the rate of degradation and increases its resistance to proteases. HBTU can also be used as an immunosuppressant drug in animal models of autoimmune diseases by inhibiting T-cell proliferation and cytokine production.</p>

<p>2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn-NH2 is a synthetic peptide that binds to the 5HT3 receptor. It has been shown to have an effect on locomotor activity and growth factor secretion in wild type mice and cell culture, as well as binding to acetylcholine receptors in C57/BL6 mice. 2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn was synthesized by the reaction of furoic acid with L -alanine, L -glycine, L -arginine and L -ornithine. The product is a white powder.</p>

<p>Please enquire for more information about Fmoc-D-Tyr(tBu)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TBTU Reagent is a combination of two reagents that are used for peptide synthesis and purification. TBTU is an amide coupling reagent that reacts with the carboxyl group of an ester to form a reactive intermediate, which then reacts with the amino group of an amide. This reaction forms an amide bond between the carboxyl group of the ester and the amino group of the amide. TBTU Reagent has been used in vitro assays to measure pharmacological activities such as anti-inflammatory effects and antimicrobial effects. TBTU Reagent has also been used to prepare mouse monoclonal antibodies against toll-like receptor 4 (TLR4).</p>

<p>Ac-Arg-Gly-Lys(Ac)-MCA is a peptide that is used as a histone deacetylase substrate. It is an enzyme substrate in the histone deacetylase reaction and it has been shown to inhibit the growth of many bacterial strains. Ac-Arg-Gly-Lys(Ac)-MCA has been shown to inhibit the growth of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa.</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH is a monoclonal antibody (mAb) that binds to the cell surface receptor, TGFβRI. It has been shown to exhibit biological activities including inhibition of tumor growth and induction of apoptosis in cancer cells. This mAb can be used as a tumor treatment and can also inhibit the proliferation of cells in tissue culture. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys has been shown to inhibit the production of collagen, which may be due to its ability to block integrin activation by binding to the cell surface receptor, αVβ3. HGRGSSPC has also been found to have antiangiogenic properties, which may be due to its ability to bind with high affinity and specificity to αVβ3 on endothelial cells.</p>

<p>Tertiapin Q is a peptide inhibitor, a derivative of tertiapin, from honeybee venom (specifically Apis mellifera). This peptide acts by specifically blocking certain potassium channels, namely Kir1.1 and Kir3.1/3.4. The mode of action involves binding to the outer mouth of the potassium channel pore, effectively inhibiting ion flow through these channels. Tertiapin Q varies from native tertiapin by one amino acid, where a methionine residue is replaced with a glutamine residue. This means that unlike native TPN, TPN(Q) is not air oxidizable.Tertiapin    : H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Met-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q: H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Gln-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q is used in electrophysiological research to study the role and regulation of inward-rectifier potassium channels in various physiological and pathological processes. Its specificity and potency make it an invaluable tool in the exploration of renal physiology and cardiac cellular activity, as well as in neuroscience research for understanding neuronal excitability.</p>

<p>Fmoc-D-His(Trt)-OH is a chiral building block that is used in peptide synthesis. It can be used to synthesize an enantiomer or homologue of the original amino acid. Fmoc-D-His(Trt)-OH has been postulated to exist as two stereoisomers, 1R,2S and 2R,1S. The 1R,2S enantiomer is the naturally occurring form of this compound and is produced with a shift of +6 ppm in the proton NMR spectrum. The 2R,1S enantiomer has also been observed in the solid state but not in solution and it exhibits a shift of -6 ppm in the proton NMR spectrum.<br>Fmoc-D-His(Trt)-OH is soluble in solvents such as DMSO and DMF. It has also been shown to be a potent inhibitor of organophosphate and re</p>

<p>Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.</p>

Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

<p>FRETS-25-STD2 is a peptide that is used in pharmacology, cell biology, and research. It acts as an activator of ion channels and receptor proteins. FRETS-25-STD2 also has the ability to inhibit ligand binding to receptors. This product is made up of 25 amino acids and has a purity of 1 umol.</p>

<p>HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.</p>

<p>H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.</p>

<p>Fmoc-D-Ile-OH is a peptide that inhibits the activation of protein interactions. It is also used as a research tool to study the binding of ligands to receptors. Fmoc-D-Ile-OH has been shown to bind to ion channels, such as nicotinic acetylcholine receptor and voltage gated potassium channels. This inhibitor has also been shown to bind with high affinity to a receptor with unknown identity.</p>

<p>Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.</p>

<p>For-Met-Leu-pNA is a synthetic peptide that can be used as a research tool for studying protein interactions. It has been shown to inhibit ion channels and may be useful in the treatment of epilepsy, especially in cases of drug resistant seizures. For-Met-Leu-pNA is also an inhibitor and can be used as an anticonvulsant.</p>

<p>Insulin is a peptide hormone that regulates the uptake and storage of glucose by muscle and fat cells. Insulin is produced by beta cells in the pancreas, which release it into the bloodstream when blood sugar levels rise. Insulin lowers glucose levels by increasing the amount of glucose taken up from the blood into muscle and fat cells, suppressing hepatic gluconeogenesis, and promoting glycolysis. It also increases protein synthesis, decreases proteolysis, and stimulates growth. With a molecular weight of 5808 Da, insulin is composed of two polypeptide chains with an approximate molecular weight of 3120 Da each linked by disulfide bonds. Insulin has no lipid moiety or carbohydrate moiety.<br>Insulin binds to its receptor on the surface of a cell to trigger one or more signaling cascades leading to changes in metabolism. Binding to the receptor triggers a conformational change in the receptor that causes insulin to be released from its binding site on the receptor.</p>

Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.

<p>Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.</p>

<p>Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and vaginal secretions. Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and</p>

<p>Fmoc-Thr(tBu)-OH is an amino acid that is used for the synthesis of amides and esters. It is prepared by the solid-phase synthesis of 2,6-dichloroacetic acid and Fmoc-protected thiomorpholine. The product can be purified by a combination of saponification and trifluoroacetic acid hydrolysis. This amino acid has acidic properties, which may be due to its ability to form ester or amide bonds with other compounds in the presence of a base.</p>

<p>This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>

<p>Fmoc-D-Pro-OH is a building block for peptide synthesis. It is a protected form of proline with an amido group, which can be used to synthesize polypeptides. Fmoc-D-Pro-OH can be coupled with other amino acids using the aldol condensation or methodologies like the strategy of organocatalysts. This building block is also useful in the synthesis of macrocycles and cyclohexanones, which are aliphatic and cyclic compounds. The recoverable nature of Fmoc-D-Pro-OH allows it to be reused in multiple reactions, so it is an economical choice for Building Blocks.</p>

<p>Boc-Tyr(Br-Z)-OH is a research tool used in the study of protein interactions and receptor pharmacology. It is an ion channel activator that binds to the Ligand-gated Ion channel receptor. Boc-Tyr(Br-Z)-OH has been shown to increase the rate of potassium ion permeability through the channel, which is associated with pain perception. This ligand also decreases calcium ion permeability, which may be beneficial for some conditions such as epilepsy or cardiac arrhythmia.</p>

<p>MBHA resin is a solid phase synthesis material that is used as a building block in the synthesis of peptides. The resin is a very stable, insoluble polymer with a high capacity for binding amino acids. MBHA resin provides a clean surface for peptide synthesis and an efficient coupling reaction. It can be used to make any type of peptide, including natural and unnatural amino acids and modified amino acids.</p>

<p>Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide is an enzyme inhibitor that is used to treat cancer. It is a potent and selective inhibitor of neutral endopeptidase, which is an enzyme involved in the process of inflammation. Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl Amide can be used to inhibit the interaction between gram negative bacteria and human cells, and has been shown to have antimicrobial properties against Pseudomonas aeruginosa. This compound may also be able to modulate metalloendopeptidases, which are resistant to endopeptidases.</p>

<p>Poly-L-Lysine Hydrobromide is a neurotrophic factor that is used to stimulate nerve growth in the peripheral nervous system. It has been shown to increase the production of nerve growth factor, which is important for neuronal development and regeneration. Poly-L-Lysine Hydrobromide also has biological properties against human erythrocytes, enabling it to bind to the erythrocyte membrane and subsequently cause hemolysis. This process is mediated by Toll-like receptors. The active form of this drug has been shown to have antiviral activity against HIV and other viruses in transfection experiments using cells from mice, as well as an ability to inhibit replication of herpes simplex virus type 1 (HSV-1) in a model system consisting of rat neurons grown on a polymer substrate. Poly-L-Lysine Hydrobromide can be cleaved into smaller pieces by enzymes such as DNase I or terminal transferases, forming polymers</p>

<p>Linaclotide is a peptide drug that has been shown to be effective in treating chronic constipation. It belongs to the class of pharmacological agents and is used as a treatment for bowel disease, specifically chronic idiopathic constipation. Linaclotide increases the frequency of bowel movements by acting on the ileum and colon. This drug has been shown to be safe for use in pregnant women and children, with no adverse effects observed at doses up to 100 mcg/kg/day. The most common side effect is diarrhea, which can be managed with dietary changes or other medications. Linaclotide has not been found to interact with other drugs, but patients should always consult their doctor before taking any new medication while on linaclotide.</p>

H-Gly-Pro-Arg-Pro-OH is a sealant that has been shown to be effective in the treatment of bowel disease. It is a calcium binding compound that can be administered topically or systemically. H-Gly-Pro-Arg-Pro-OH has clinical relevance in vivo with human beings and exhibits ATP levels that are similar to those found in normal tissue. The surface glycoprotein of this compound has been shown to have an affinity for epidermal growth factor, which may play a role in inflammatory bowel disease. HGPAROH is activated by fibrinogen, which leads to its bound form being recognized by monoclonal antibody as well as the human serum proteins (e.g., albumin).

<p>Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is a purified solid resin that has been chemically modified with amine groups. This product can be used as an inhibitor, activator, or ligand in research applications. Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is also useful as a reagent for Protein interactions and Receptor binding studies. It is available in high purity and can be used as a research tool in Cell Biology and Pharmacology experiments.</p>

<p>MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.</p>

<p>Fmoc-D-Lys(Boc)-OH is a building block for the synthesis of peptides. It can be used to synthesize chains that are up to 17 amino acids long. Fmoc-D-Lys(Boc)-OH is a protected amino acid with an active group on the alpha carbon and has been used in the synthesis of ganirelix acetate, a peptide that is used in the treatment of prostate cancer. The Boc group is an organic compound that protects the lysine side chain from reacting with other compounds. The Fmoc group is also an organic compound, which helps to protect the side chain from reactions with other compounds. These groups are removed at different stages of synthesis, depending on what type of reaction needs to take place next.</p>

<p>TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.</p>

<p>Enterotoxin STp is an Escherichia coli Enterotoxin, with the following disulfide bonds: Cys5 and Cys10; Cys6 and Cys14; Cys9 and Cys17 and available as the trifluoroacetate salt.<br>One-Letter-Code: H-NTFYCCELCCNPACAGCY-OH</p>

Neuropeptide S is a neuropeptide and a novel modulator of arousal and anxiety. This neuropeptide is found in the mammalian brain and is also involved in the suppression of food intake, reward-like effects, mediation of fear expression and memory and learning processes. This product can be used in pharmacological research and is available as a 0.5 mg vial.

<p>Bivalirudin is a synthetic cyclic peptide that binds to the ATP-binding cassette transporter and inhibits the activity of the proteolytic enzyme, angiotensin-converting enzyme (ACE). ACE inhibition prevents the conversion of angiotensin I to angiotensin II. Bivalirudin has been shown to be effective in reducing mortality in patients with acute coronary syndrome or undergoing percutaneous coronary intervention. It has also been shown to have pharmacokinetic properties that are similar to those of heparin. The drug has a low dose and is not associated with an increased risk of bleeding. Bivalirudin is an inhibitor and can cause drug interactions when combined with other drugs that are inhibitors or substrates for this type of transporter.</p>

<p>Fmoc-Cys(Trt)-OH is a chemical compound that has been shown to have potent antitumor activity in mice. It is synthesized by the stepwise addition of amino acids to the resin-bound Cys residue in the presence of trifluoroacetic acid and a coupling agent such as EDC. This reaction produces a functional protein with an amide bond. The acetylcholine receptor binding properties of Fmoc-Cys(Trt)-OH are due to its ability to form a disulfide bond with cysteine residues on the receptor.</p>

<p>LL-37 is a 37 amino acid peptide that is produced by neutrophils and other leukocytes. This peptide has been shown to have anti-inflammatory properties, which may be due to its ability to bind and activate the G protein coupled receptor (GPCR) formyl peptide receptor-like 1 (FPRL1), leading to inhibition of the production of inflammatory mediators such as IL-8. LL-37 also binds to ion channels, which may lead to membrane depolarization, thereby blocking calcium influx into the cell. LL-37 has been shown to inhibit the activation of T cells by inhibiting T cell receptor signaling and reducing cytokine production.<br>LL-37 also has a high affinity for antibody binding sites on B cells and macrophages and can bind with high specificity to IgE on mast cells, leading to inhibition of mast cell degranulation. The binding of LL-37 with these receptors leads to reduced inflammation in tissues, which may</p>

<p>[Trp3, Arg5]-Ghrelin (1-5) is a Growth-Hormone Secretagogue (GHS) receptor agonist which stimulates growth hormone release . The full lenth 28 amino acid peptide Ghrelin is a peptide hormone that regulates appetite, energy balance, meal initiation and nutrient sensing. Ghrelin is produced in the stomach, but is also found in the blood, brain, and other tissues.. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.</p>

<p>Boc-D-Pro-OH is a model compound for the synthesis of peptides. Boc-D-Pro-OH has been used in many surface-enhanced Raman spectroscopy studies to investigate the stereochemistry of glycosidic bonds. It has also been used in pharmacokinetic studies to investigate the drug's absorption, distribution, metabolism, and excretion (ADME) properties. The solute is soluble in water due to its hydrophilic nature. Boc-D-Pro-OH is an enantiomer of Boc-L-Pro-OH and a functional group that contains a trifluoromethyl group. This chemical can be used in Tools for Peptide Synthesis with other compounds to form peptides with specific amino acid sequences.</p>

<p>Boc-Cys(tBu)-OH is a peptide that is an activator of ion channels. It is used as a research tool to study protein interactions, antibody binding, and cell biology. The peptide has been shown to act as an inhibitor of ion channels by binding to the extracellular domain of the receptor and inhibiting ligand binding. It has also been shown to activate potassium channels in mammalian cells.</p>

1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid is a glycopeptide that has been shown to be taken up by the cells of humans. It is also effective when given at doses of 1 mg/kg. This drug can be pegylated, which increases its uptake in humans and prevents it from being degraded in the liver. The pharmacokinetic properties of 1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid have been studied in humans, where it was found that this drug can be detected in plasma as well as in urine after single or multiple doses. The human studies done with this drug have shown that it has a short half life and is quickly eliminated from the body. Positron emission tomography (PET) studies have indicated that this drug may bind to specific receptors on the surface of cells, which could potentially lead to new diagnostic applications for beta-galactosid

<p>Cilengitide is a new chemotherapeutic agent that was shown to be effective against renal cell cancer in vitro. Cilengitide inhibits the polymerase chain reaction, arresting the growth of cells. It has minimal toxicity and natural compounds, which make it a promising drug for the treatment of human cancers. Cilengitide binds to integrin receptors on malignant brain cells and inhibits their ability to migrate, inducing apoptosis. This drug also inhibits the production of chemoattractant protein and can be used as an adjuvant therapy for radiation and antibiotic-resistant strains of bacteria.</p>

<p>S-Acm-ß-Mercaptopropionic Acid is a selective activator of the human K+ channel KCNQ2/KCNQ3. It is a potent inhibitor of the hERG potassium channel. S-Acm-ß-Mercaptopropionic Acid is a ligand that binds to and activates KCNQ2 and KCNQ3 channels in heart muscle cells. It has shown to be an antibody for the study of ion channels, as well as other receptors and cell biology. This molecule has been used as a research tool for studying protein interactions and pharmacology.</p>

<p>Pepstatin A is a natural product that has been synthesized for use as an inhibitor of proteolytic enzymes. It inhibits the activity of a wide range of proteases and is used in vitro to study the biochemical properties of these enzymes. Pepstatin A inhibits the activity of many important proteases, including those involved in infectious diseases, such as HIV and hepatitis C virus. Pepstatin A binds to the active site on serine proteases, blocking access by their substrates and thereby inhibiting enzyme activity. The binding site is highly conserved among different types of serine protease, with approximately 90% homology between trypsin and chymotrypsin. The inhibitory mechanism involves a specific interaction between pepstatin A's hydrophobic side chain and the catalytic triad residues His57, Asp102, and Ser195 in trypsin or His57, Asp102, and Ser188 in chymotrypsin.</p>

<p>Diprotin B is a colony-stimulating factor protein that has inhibitory properties in the colon. It has been shown to be effective in reducing symptoms of bowel disease and inflammatory bowel disease, as well as reducing the recurrence of colon cancer. Diprotin B inhibits the release of inflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6). The inhibition of these proinflammatory cytokines may contribute to the anti-inflammatory effects observed with Diprotin B treatment. Diprotin B also prevents cytosolic calcium accumulation, which can lead to cell lysis. This process is mediated by antimicrobial peptides called defensins that are expressed in Paneth cells found in the small intestine and colon. Defensins have also been shown to induce cell lysis through their ability to bind to bacterial membranes.</p>

<p>Ac-Arg-Leu-Arg-MCA is a fluorogenic substrate for the proteasome that can be used in proteasome research. Ac-Arg-Leu-Arg-MCA has been shown to be a useful fluorescent substrate for the ubiquitin proteasome system substrates and peptides and biochemicals. It is also an Enzyme Substrate of the Peptides &amp; Biochemicals section.</p>

<p>Biotin-dPEG®11-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>β-Sheet Breaker Peptide iAß5 (Bulk) is a peptide that inhibits the formation of β-sheets in proteins. It has been shown to be an excellent inhibitor of protein interactions, with good selectivity for its target. This peptide also has high purity and can be used as a research tool for studying the function of ion channels and antibodies.</p>