
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Gly-Pro-Arg-Pro-NH2 acetate salt
CAS:<p>H-Gly-Pro-Arg-Pro-NH2 acetate salt is a peptide with antiplatelet activity. It has been shown to inhibit the interaction between fibrinogen and platelets, which leads to the inhibition of thrombin formation and subsequent clotting. The amide bond in this peptide is susceptible to hydrolysis by enzymes such as phospholipase A2, which means that it can be broken down into smaller fragments that have different biological activities. H-Gly-Pro-Arg-Pro-NH2 acetate salt has been shown to inhibit the growth of babesia microti, a causative agent of babesiosis in cattle, through lysis of infected erythrocytes. This drug also inhibits the growth of hemagglutinating virus type 3 (HV3) and filovirus, two viruses that are not yet fully understood.</p>Formula:C18H32N8O4Purity:Min. 95%Molecular weight:424.5 g/mol2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt
CAS:<p>2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt (2HMP) is a diagnostic agent that can be used for the detection of bacterial infections. The conformational properties of 2HMP are similar to those of ATP, which allows it to bind to the polymerase chain reaction enzyme and initiate an enzymatic reaction. This leads to the production of a signal that can be detected by spectrophotometry or fluorometry. 2HMP has also been shown to have chemokine activity in vitro, but this has not been tested in vivo. 2HMP is a competitive inhibitor of human protein serine proteases, such as trypsin and chymotrypsin, with an IC50 value of approximately 1 μM.</p>Formula:C3H7NaO4S2Purity:Min. 95%Molecular weight:194.2 g/molH-Tyr-Tyr-Phe-OH acetate salt
CAS:<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>Formula:C27H29N3O6Purity:Min. 95%Molecular weight:491.54 g/molMyristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H105N17O12Purity:Min. 95%Molecular weight:1,256.58 g/molHomoterephalic acid
CAS:<p>Homoterephalic acid is a polycarboxylic acid. It has been shown to be effective in the treatment of tumors, and in clinical studies, it has been shown to have anti-cancer activity. Homoterephalic acid inhibits the growth of tumor cells by inhibiting the synthesis of l-glutamic acid. This compound also exhibits anti-inflammatory properties by inhibiting tumor necrosis factor alpha (TNFα) production. Homoterephalic acid is also an inhibitor of human lung diastereomer 1210 cells, as well as erythrocytes infected with L1210 leukemia cells. Homoterephalic acid is a substrate for glycinamide ribonucleotide synthetase and can be used for the biosynthesis of thymidylate. It can be used for the synthesis of polycarboxylic acids that are important for cell metabolism and protein synthesis.</p>Formula:C11H12O4Purity:Min. 95%Molecular weight:208.21 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS:<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O6Purity:Min. 95%Molecular weight:481.55 g/mol4-Methoxycarbonylphenylboronic acid
CAS:<p>4-Methoxycarbonylphenylboronic acid is an organic compound that can be synthesized from biphenyl. It is a diazonium salt with a bidentate ligand and a carbonyl group, which allows it to form an intermolecular hydrogen bond. The phenyl group of 4-methoxycarbonylphenylboronic acid can be oxidized to the corresponding carboxylic acid or reduced to the corresponding alcohol.<br>4-Methoxycarbonylphenylboronic acid is also soluble in halides, iodinations, and mercaptoacetic acid. This compound has been used as an acceptor in the oxidation of aluminium with diborane as a catalyst. 4-Methoxycarbonylphenylboronic acid has also been used to synthesize other compounds such as metronidazole (a drug) and erythromycin (an antibiotic).</p>Formula:C8H9BO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:179.97 g/molProinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H239N47O46Purity:Min. 95%Molecular weight:3,340.71 g/molTumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt
<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C94H174N32O22S2Purity:Min. 95%Molecular weight:2,168.72 g/mol(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester
CAS:<p>(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester is an acidic substance that can be produced by the amination of piperazine with chloroacetic acid. The reaction solution is heated to a temperature of about 120°C for about 30 minutes and then cooled to room temperature. The product precipitates as a white solid. This compound has been shown to have antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA) in plates.</p>Formula:C15H13F2NO4Purity:Min. 95%Molecular weight:309.26 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H72N14O8Purity:Min. 95%Molecular weight:1,081.27 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H83N17O11Purity:Min. 95%Molecular weight:1,062.27 g/molUrocortin (rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C206H338N62O64Purity:Min. 95%Molecular weight:4,707.27 g/molH-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35ClN4O3Purity:Min. 95%Molecular weight:390.95 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N10O18Purity:Min. 95%Molecular weight:1,023.05 g/molGastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H209N35O38SPurity:Min. 95%Molecular weight:3,010.43 g/molEthylene glycol monoacetoacetate monomethacrylate
CAS:<p>Ethylene glycol monoacetoacetate monomethacrylate is a metal chelate that is used to treat muscle diseases. It has been shown to act as a gamma-aminobutyric acid agonist and inhibit the release of acetylcholine from nerve endings. This drug can also be used as a chemical stabilizer in the synthesis of polymers in organic chemistry. Ethylene glycol monoacetoacetate monomethacrylate is insoluble in water and soluble in organic solvents such as ethanol, acetone, or benzene. It has been found to have a phase transition temperature at -139°C, which is suitable for applications that require low temperatures. Ethylene glycol monoacetoacetate monomethacrylate reacts with sodium carbonate to form an ester and methacrylic acid (MAA). The reaction solution is typically heated with stirring until it reaches 40°C-50°C. The particle size of</p>Formula:C10H14O5Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:214.22 g/molThymosin α1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H215N33O55·xC2HF3O2Purity:Min. 95%Molecular weight:3,108.28 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/molMCLV3 trifluoroacetate salt
CAS:<p>Please enquire for more information about MCLV3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H89N19O19Purity:Min. 95%Molecular weight:1,344.43 g/molSodium dimethyldithiocarbamate hydrate
CAS:<p>Sodium dimethyldithiocarbamate hydrate is a salt of dimethyldithiocarbamic acid. It is used as an additive in paints and coatings to prevent corrosion of metal. Sodium dimethyldithiocarbamate hydrate is also used in the production of polyurethane and polyester resins, where it acts as a curing agent. Dimethyldithiocarbamic acid has been shown to be a ligand for the influenza virus, inhibiting viral activity by binding to the hemagglutinin protein. The crystal system of this substance is hexagonal; its salts exist in both acidic and basic forms. The functional theory explains the stabilization of this compound through coordination with nitrogen atoms on one side and phenyl substituents on the other side. Hexamethylenetetramine reacts with sodium chloride to form sodium dimethyldithiocarbamate hydrate, which can then react with methanol or eth</p>Formula:C3H6NNaS2·xH2OPurity:Min. 95%Color and Shape:White PowderMolecular weight:143.2 g/mol(D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H36N8O5Purity:Min. 95%Molecular weight:540.61 g/molNociceptin trifluoroacetate salt
CAS:<p>Nociceptin trifluoroacetate salt is an opioid with low potency that is used in the treatment of pain. It has been shown to bind to the protein and inhibit protease, which has been proposed as a possible mechanism for its analgesic effects. Nociceptin trifluoroacetate salt may also have indirect effects on brain functions by regulating levels of nociceptin, a neuropeptide that interacts with nociceptive neurons in the brain. This drug has been shown to have nootropic effects in mice, including increased locomotor activity and improved memory retention. Nociceptin trifluoroacetate salt inhibits kappa-opioid receptors and is therefore used as a pharmacological tool for research into opioid receptor function.</p>Formula:C79H129N27O22Purity:Min. 95%Molecular weight:1,809.04 g/molMca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H110N22O20Purity:Min. 95%Molecular weight:1,675.84 g/molBenzimidazole-5-carboxylic acid
CAS:<p>Benzimidazole-5-carboxylic acid is a monoclonal antibody that binds to the amide group of an amino acid. It has been shown to be a potent inhibitor of cell growth in cervical cancer cells and rat liver microsomes. It also showed inhibitory activity against fatty acid and nucleotide synthesis. Benzimidazole-5-carboxylic acid is a benzimidazole compound that has been shown to have anti-inflammatory effects in animal models and also inhibits the replication of HIV. This drug can inhibit the replication of influenza A virus in vitro and may be useful as an antiviral agent for treatment of influenza A infection.</p>Formula:C8H6N2O2Purity:Min. 98%Color and Shape:PowderMolecular weight:162.15 g/molGRF (1-29) amide (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Formula:C148H239ClN44O42Purity:Min. 95%Molecular weight:3,342.21 g/molAbz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N17O13Purity:Min. 95%Molecular weight:1,124.25 g/molH-Arg-His-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N8O2Purity:Min. 95%Molecular weight:310.36 g/molLinoleic acid - powder
CAS:<p>Linoleic acid is a polyunsaturated fatty acid that is an important component of cell membranes. It has been shown to inhibit oxidative injury and improve mitochondrial functions. Linoleic acid also has a role in energy metabolism, as it is the precursor for biosynthesis of eicosanoids and arachidonic acid. The physiological effects of linoleic acid have been studied using a model system consisting of isolated rat adipose tissue and mitochondria. This model system has been used to investigate the inhibitory properties of linoleic acid on caproic acid-induced lipid peroxidation. Linoleic acid has also been shown to have anion radical scavenging activity when in the presence of iron. This compound can be analyzed using gas chromatography-mass spectrometry (GC-MS) based on its chemical composition, which consists mainly of linear 18-carbon chains with two double bonds at positions 9 and 12.</p>Formula:C18H32O2Purity:Min. 95%Color and Shape:PowderMolecular weight:280.45 g/mol(Glu9)-Exenatide (2-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Glu9)-Exenatide (2-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C179H277N47O59SPurity:Min. 95%Molecular weight:4,063.46 g/mol2,6-Dichloro-5-fluoronicotinic acid
CAS:<p>2,6-Dichloro-5-fluoronicotinic acid (2,6-DCFNA) is a chlorinating agent that is activated in acidic solutions. It is used to produce the disinfectant peracetic acid and in the industrial process of producing phenol. 2,6-DCFNA reacts with chloride to form hypochlorous acid (HOCl), which causes inflammation in cells by activating inflammatory cells such as neutrophils and macrophages. 2,6-DCFNA also inhibits tyrosine kinase activity, which may contribute to its anti-inflammatory properties. The toxic effects of 2,6-DCFNA have been studied on hematopoietic cells in vitro. Studies show that this compound can cause apoptosis or death of these cells and may be useful for the treatment of inflammatory diseases such as rheumatoid arthritis. 2,6-DCFNA has also been shown to inhibit tumor growth when</p>Formula:C6H2Cl2FNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:209.99 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H86N14O13SPurity:Min. 95%Molecular weight:1,087.34 g/mol2-Iodo-5-methoxybenzoic acid
CAS:<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>Formula:C8H7IO3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.04 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H209N41O38Purity:Min. 95%Molecular weight:3,014.36 g/molMCH (salmon) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C89H139N27O24S4Purity:Min. 95%Molecular weight:2,099.49 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/molH-D-Arg(Me)-OH acetate salt
CAS:Controlled Product<p>H-D-Arg(Me)-OH is a peptide that has been shown to inhibit the proliferation of cancer cells in culture. It inhibits the growth of tumor cells by blocking the activity of the oxytocin receptor, which regulates cell adhesion and migration. The H-D-Arg(Me)-OH acetate salt has also been shown to promote the differentiation of basophilic leukemia cells into normal myeloid cells. This peptide is used as a control for incubated cell cultures, such as liver cells, and can be used to study protein synthesis.</p>Formula:C7H16N4O2Purity:Min. 95%Molecular weight:188.23 g/molo-Cresol-4-sulphonic acid
CAS:<p>o-Cresol-4-sulphonic acid is a fine chemical with the CAS number 7134-04-5. It is a versatile building block that can be used as a reagent in research, as a speciality chemical and as an intermediate in the production of other compounds. o-Cresol-4-sulphonic acid has been used to synthesize pharmaceuticals, agrochemicals, dyes, perfumes and many more products. This compound has also been used as a reaction component in organic synthesis to form new compounds and scaffolds.</p>Formula:C7H8O4SPurity:Min. 95%Color and Shape:PowderMolecular weight:188.2 g/moltert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate
CAS:<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40FN3O6SPurity:Min. 95%Molecular weight:577.71 g/molVEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about VEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H99N23O18SPurity:Min. 95%Molecular weight:1,666.82 g/mol1-(Mercaptomethyl)cyclopropaneacetic acid
CAS:<p>1-(Mercaptomethyl)cyclopropaneacetic acid is a reaction product of hydrolysis, transfer, and industrialization. It is used in the synthesis of organic compounds such as quinolinediols and thioureas. 1-(Mercaptomethyl)cyclopropaneacetic acid is typically prepared by the reaction of an alkylsulfonyl chloride with an inorganic base such as lithium or sodium carbonate in an organic solvent such as acetonitrile. The compound is also used to produce other organosulfur compounds, including imino sulfides and disulfides.</p>Formula:C6H10O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:146.21 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molH-Val-Ile-His-Thr-EDANS acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H48N8O8SPurity:Min. 95%Molecular weight:716.85 g/mol12-Doxyl stearic acid
CAS:<p>12-Doxyl stearic acid is a fatty acid that inhibits the vasoactive intestinal peptide (VIP). The inhibitory effect of 12-Doxyl stearic acid on VIP was demonstrated by incubating the cells with this fatty acid and measuring the change in mitochondrial Ca2+ concentration. This inhibition was shown to be due to the inhibition of fatty acids and not an effect on Ca2+ ion channels. Fatty acids are important for normal cellular function, such as maintaining membrane fluidity and aiding in signal transduction. 12-Doxyl stearic acid has been shown to inhibit the production of cardiac fatty acids and may be useful in treating cardiac disorders. 12-Doxyl stearic acid also has a fluorescence probe that can be used to study how cells react to different conditions, such as changes in water vapor or pH levels.</p>Formula:C22H42NO4Purity:Min. 95%Color and Shape:Yellow Clear LiquidMolecular weight:384.57 g/molH-Arg-Val-OH acetate salt
CAS:<p>H-Arg-Val-OH acetate salt is a recombinant humanized monoclonal antibody that binds to the serine protease, which is an enzyme that cleaves proteins at specific sites. The antibody inhibits the activity of this enzyme and prevents the release of proteins from cells. It has been shown to be clinically relevant in treating heart failure, chronic pulmonary disease, and congenital heart disease. In addition, H-Arg-Val-OH acetate salt inhibits the release of inflammatory molecules like interleukin 6 (IL6) and tumor necrosis factor alpha (TNFα), which are involved in a variety of diseases.</p>Formula:C11H23N5O3Purity:Min. 95%Molecular weight:273.33 g/molTetrahydro-3-furoic acid
CAS:<p>Tetrahydro-3-furoic acid is an organic acid that can be found in the form of its tautomers, alpha-methylene-gamma-butyrolactone and 3-hydroxy-2,4-pentadienoic acid. It is a proapoptotic compound that induces cell death in cancer cells by inhibiting protein synthesis. Tetrahydro-3-furoic acid has been shown to have low expression levels in most tissues, with high levels found in the liver. The mechanism behind this inhibition is not yet known but may be due to the formation of a Schiff base between the amine and the carbonyl group of tetrahydro-3-furoic acid. This reaction mechanism has been proposed as a possible explanation for why tetrahydro-3-furoic acid is more toxic than other furoates such as ethyl-, propyl-, butyl-, and amyl-. Tet</p>Formula:C5H8O3Purity:Min. 95%Molecular weight:116.12 g/molC-Peptide (human) trifluoroacetate salt
CAS:<p>C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molAc-Gly-Ala-Lys-AMC trifluoroacetate salt
<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H31N5O6Purity:Min. 95%Molecular weight:473.52 g/molAmyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H81N17O16Purity:Min. 95%Molecular weight:1,104.22 g/molNeurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt
CAS:<p>Neurotensin is a peptide hormone that regulates the release of other hormones and neurotransmitters, such as dopamine. It has been shown to be able to regulate appetite and bowel disease in animal models. Neurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt is a neurotensin molecule with an acetate group attached to it. This molecule is completely soluble in water and has been shown to have no effect on energy metabolism or polymerase chain reactions.</p>Formula:C78H121N21O20Purity:Min. 95%Molecular weight:1,672.92 g/moltert-Butyl 4,7-diazaspiro[2.5]octane-4-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 4,7-diazaspiro[2.5]octane-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fibrinopeptide B (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>Formula:C66H93N19O25Purity:Min. 95%Molecular weight:1,552.56 g/molAbz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H114N26O18Purity:Min. 95%Molecular weight:1,595.81 g/molβ-Casomorphin (1-4) (bovine) acetate salt
CAS:<p>Beta-Casomorphin (1-4) is a tetrapeptide that is derived from the amino acid sequence of bovine beta-casein. It inhibits the binding of opioid receptors and has been shown to have an inhibitory effect on muscle activity. Beta-Casomorphin (1-4) has also been shown to have a stabilizing effect on the genotype, which may be due to its ability to bind to DNA. Beta-Casomorphin (1-4) is detectable in urine and can be used as a marker for assessing the effectiveness of treatments in infants with Colic.</p>Formula:C28H34N4O6Purity:Min. 95%Molecular weight:522.59 g/molFibronectin Fragment (1954-1959) trifluoroacetate salt
CAS:<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H63N11O7Purity:Min. 95%Molecular weight:713.91 g/mol(Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H283N51O53SPurity:Min. 95%Molecular weight:4,125.63 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/molOvokinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H67N13O11Purity:Min. 95%Molecular weight:1,002.13 g/mol(Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molAmyloid β-Protein (16-20) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>Formula:C35H52N6O6Purity:Min. 95%Molecular weight:652.82 g/molMethyl 6-oxo-1,6-dihydropyridazine-3-carboxylate
CAS:<p>Please enquire for more information about Methyl 6-oxo-1,6-dihydropyridazine-3-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6N2O3Purity:Min. 95%Molecular weight:154.12 g/molPAR-2 (1-6) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 agonist is a synthetic peptide that activates PAR-2. It binds to PAR-2 receptors, which are present in the mesenteric vasculature and in various other tissues. Activation of PAR-2 leads to an increase in intracellular calcium concentration, activation of protein kinase C, cytosolic calcium ion release, phosphorylation of myosin light chain, muscle cell proliferation, transcription and translation initiation, and increased production of vasoactive intestinal peptide. This drug also has anti-inflammatory effects and stimulates epidermal growth factor (EGF) and thrombin receptor expression as well as growth factor production.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/mol4-(2'-N-Boc-hydrazino)benzoic acid
CAS:<p>Please enquire for more information about 4-(2'-N-Boc-hydrazino)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O4Purity:Min. 95%Molecular weight:252.27 g/molAmyloid β-Protein (1-15) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (1-15) is a peptide fragment of the amyloid protein that is associated with Alzheimer's disease. Amyloid beta-Protein (1-15) activates the transcription of a number of genes, including those that encode neurotrophic factors and growth factors. It has been shown to have neurotrophic properties and to increase the survival rate of neurons in vitro. It also protects against neuronal death induced by oxidative stress and high concentrations of glutamate. The structure of amyloid beta-protein (1-15) has been elucidated using molecular modeling techniques and X-ray crystallography. The trifluoroacetate salt form is stable at physiological pH levels and shows good solubility in water, making it an attractive therapeutic drug candidate.</p>Formula:C78H107N25O27Purity:Min. 95%Molecular weight:1,826.84 g/molDocosahexaenoic acid
CAS:<p>Docosahexaenoic acid (DHA) is a fatty acid that is usually obtained from fish oil. DHA has been shown to decrease the production of prostaglandin E2 (PGE2), which can lead to inflammation in various parts of the body. The synthesis and release of PGE2 is regulated by toll-like receptor 4 (TLR4). DHA has also been shown to reduce tumor size and improve survival rates in mice with breast cancer. DHA is a long-chain polyunsaturated fatty acid that can be found in many types of cells, including neurons. It has been shown to have beneficial effects on neuronal death during experimental models of stroke and traumatic brain injury.</p>Formula:C22H32O2Purity:Min. 95%Color and Shape:PowderMolecular weight:328.49 g/molpTH (2-34) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-34) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H286N54O49S2Purity:Min. 95%Molecular weight:4,030.64 g/mol4-Bromobutyl acetate
CAS:<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>Formula:C6H11BrO2Purity:Min. 95%Molecular weight:195.05 g/molH-Met-Cys-Glu-Lys-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Met-Cys-Glu-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H35N5O7S2Purity:Min. 95%Molecular weight:509.64 g/molFITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about FITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H191N37O25S2Purity:Min. 95%Molecular weight:2,748.28 g/molMyelin Proteolipid Protein (139-151) (depalmitoylated) (human, bovine, dog, mouse, rat) trifluoroacetate salt
CAS:<p>MPLP(139-151) is a peptide that is derived from the myelin proteolipid protein (PLP). MPLP(139-151) has been shown to inhibit macrophage inflammatory in vitro and brain inflammation in vivo. The inhibition of macrophages was mediated by the induction of apoptosis and inhibition of NF-κB. MPLP(139-151) also induced regression of experimental autoimmune encephalomyelitis in mice, which suggests that it might be useful as a therapeutic agent for multiple sclerosis or other inflammatory diseases.</p>Formula:C72H104N20O16SPurity:Min. 95%Molecular weight:1,537.79 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H285N55O57SPurity:Min. 95%Molecular weight:4,271.69 g/molGRPP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about GRPP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H215N41O58SPurity:Min. 95%Molecular weight:3,384.47 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molDSP
CAS:<p>DSP is a widely used disulfide crosslinker in ADC synthesis. It forms reversible conjugates via intracellular reduction, enabling payload release.</p>Formula:C14H16N2O8S2Purity:Min. 95%Color and Shape:SolidMolecular weight:404.42 g/molExendin-4 (1-8) trifluoroacetate salt
CAS:<p>Please enquire for more information about Exendin-4 (1-8) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N11O13Purity:Min. 95%Molecular weight:833.85 g/molDehydroacetic acid sodium salt
CAS:<p>Dehydroacetic acid sodium salt is a chemical compound with the formula CH3COOCH2NaO2. It is an ionic liquid that can be used as a preservative or stabilizer in foods and other products. Dehydroacetic acid sodium salt has been shown to inhibit the growth of bacteria and fungi in biological studies. The analytical method for dehydroacetic acid sodium salt is based on x-ray diffraction data, which is used to identify its purity and concentration. The reaction solution includes dehydroacetic acid, water vapor, sodium salts, phosphorus pentoxide, and control analysis.</p>Formula:C8H7O4NaPurity:Min. 95%Color and Shape:PowderMolecular weight:190.13 g/molNocistatin (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O32Purity:Min. 95%Molecular weight:1,927.07 g/molpTH (1-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH (1-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H316N58O54S2Purity:Min. 95%Molecular weight:4,401.09 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>Formula:C60H87N19O13Purity:Min. 95%Molecular weight:1,282.45 g/molGLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H273N51O57Purity:Min. 95%Molecular weight:4,111.45 g/mol(1-Methyl-1H-pyrazol-4-yl)boronic acid
CAS:<p>(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.</p>Formula:C4H7BN2O2Purity:Min. 95%Molecular weight:125.92 g/mol(Asp76)-pTH (39-84) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp76)-pTH (39-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C211H356N66O73Purity:Min. 95%Molecular weight:4,985.49 g/molMelanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H72N10O15Purity:Min. 95%Molecular weight:1,005.12 g/molMca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H105N19O19SPurity:Min. 95%Molecular weight:1,656.86 g/mol2-Chloro-3,4-dihydroxybenzoic acid
CAS:<p>Cefepime is a broad-spectrum antibiotic that is used to treat bacterial infections. It inhibits cell wall synthesis by binding to the penicillin-binding proteins and interfering with the cross-linking of peptidoglycan. Cefepime has been shown to be active against gram-negative pathogens such as Aeruginosa, Stenotrophomonas maltophilia, and P. aeruginosa. Cefepime also inhibits the growth of gram-positive bacteria such as Staphylococcus aureus, Enterococcus faecalis, and Streptococcus pneumoniae. The chemical structure of cefepime is similar to that of other beta-lactam antibiotics like methicillin, oxacillin, cloxacillin, ampicillin, and amoxicillin. Cefepime has been shown to be effective in treating resistant gram-negative organisms such as Pseudomonas aeruginosa (P.</p>Formula:C7H5ClO4Purity:Min. 95%Color and Shape:White To Yellow To Light Brown SolidMolecular weight:188.56 g/mol2-Amino-5-(trifluoromethoxy)benzoic acid
CAS:<p>Please enquire for more information about 2-Amino-5-(trifluoromethoxy)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H6F3NO3Purity:Min. 95%Molecular weight:221.13 g/molXenopsin-Related Peptide 1 (XP-1) trifluoroacetate salt
CAS:<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>Formula:C51H79N15O9Purity:Min. 95%Molecular weight:1,046.27 g/mol(Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H114N32O13SPurity:Min. 95%Molecular weight:1,499.8 g/mol2-[(3,5,6-Trichloro-2-pyridinyl)oxy]acetic acid
CAS:<p>Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.</p>Formula:C7H4Cl3NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:256.47 g/molAnthranilyl-HIV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H65N13O11Purity:Min. 95%Molecular weight:940.06 g/mol5-Aminopyridine-3-carboxylic acid
CAS:<p>5-Aminopyridine-3-carboxylic acid (5APC) is a structural analog of nicotinic acid that has been shown to have anti-inflammatory effects. 5APC inhibits the production of inflammatory cytokines, such as IL-10 and IL-17, by inhibiting the activation of NFκB and MAPK pathways. This drug also has significant inhibitory activities against dextran sulfate sodium (DSS)-induced acute colitis in experimental models. 5APC is thought to act by interrupting the assembly of p38 mitogen activated protein kinase (MAPK) and nuclear factor kappa B (NFκB) signaling complexes.</p>Formula:C6H6N2O2Purity:Min. 95%Molecular weight:138.12 g/molFibronectin Fragment (1376-1380) trifluoroacetate salt
CAS:<p>Please enquire for more information about Fibronectin Fragment (1376-1380) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H39N11O8Purity:Min. 95%Molecular weight:609.64 g/molAtrial Natriuretic Factor (3-28) (rat) trifluoroacetate salt
CAS:<p>Natriuretic factor is a peptide hormone that regulates blood pressure. This peptide is encoded by a gene located on chromosome 10 and is made up of 28 amino acids. Natriuretic factor binds to the membrane of mitochondria and zymogen granules, causing them to release their contents into the cytosol. The resulting increase in cytosolic volume causes an increased diastolic pressure, as well as an increased glomerular filtration rate and cardiac output. Natriuretic factors have also been shown to stimulate the production of natriuretic peptides, which are involved in water balance and electrolyte homeostasis.</p>Formula:C119H189N43O36S2Purity:Min. 95%Molecular weight:2,862.17 g/mol3-Methylbenzofuran-2-carboxylic acid
CAS:<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:176.17 g/mol16-Hydroxyhexadecanoic acid
CAS:<p>16-Hydroxyhexadecanoic acid is a fatty acid that contains 16 carbons and 2 hydroxyl groups. It can be found in rat liver microsomes, where it binds to the cytochrome P450 enzyme, inhibiting its activity. The structural analysis of this compound has been shown to have intermolecular hydrogen bonding between the nitrogen atoms and the oxygen atoms in the hydroxyl group. 16-Hydroxyhexadecanoic acid also exhibits phase transition temperatures, which are increased by adding water molecules. This compound also has an inhibitory effect on recombinant cytochrome P450 enzymes from p. pastoris and can be used as a substrate for methyl myristate metabolism. In addition, 16-hydroxyhexadecanoic acid binds to dinucleotide phosphate (NADPH) and fluoresces when excited at 340 nm using a fluorescence detector.</p>Formula:C16H32O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:272.42 g/molTRAP-6 amide trifluoroacetate salt
CAS:<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>Formula:C34H57N11O8Purity:Min. 95%Color and Shape:PowderMolecular weight:747.89 g/mol6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C247H361N57O80S2Purity:Min. 95%Molecular weight:5,472.98 g/molRVG-9R trifluoroacetate salt
CAS:<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C201H334N82O55S2Purity:Min. 95%Molecular weight:4,843.45 g/molH-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt
<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H62N14O16SPurity:Min. 95%Molecular weight:1,051.09 g/mol2-Hydroxysuccinic acid methyl ester
CAS:<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>Formula:C5H8O5Purity:90% MinMolecular weight:148.11 g/molAmyloid b-Protein (6-20) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H119N23O23Purity:Min. 95%Molecular weight:1,843.01 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/mol4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid
CAS:<p>4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid is a diazirine that is used to form copper complexes. These complexes are then used as diagnostic agents for the detection of nucleic acids in biological samples, such as wheat germ and human tissue. 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid may also be used in the production of polymer films. It has been shown to have a dihedral angle (C), which is an important factor in the properties of surfactants. The properties of 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid depend on its functional groups, fatty acids, and dimethylformamide content.</p>Formula:C9H5F3N2O2Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:230.14 g/molSPLUNC1 (22-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O25Purity:Min. 95%Molecular weight:1,815.08 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molH-Asn-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Asn-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O4Purity:Min. 95%Molecular weight:289.29 g/molNaphthenic acid
CAS:<p>Naphthenic acid is a metal chelate that is used in synchronous fluorescence spectroscopy. It has been shown to have biodegradation properties and can be used as an indicator for water quality. Naphthenic acid has been found to be a potent inhibitor of corrosion and is often used as an additive to petroleum products, such as gasoline, that are made from crude oil. Naphthenic acid also has acute toxicities and can cause toxicity studies on humans. It is able to inhibit energy metabolism in cells by binding to the mitochondrial membrane, which may be due to its ability to bind with benzalkonium chloride. Naphthenic acid can also be used for analytical methods, such as electrochemical impedance spectroscopy, because it has high sensitivity and specificity.</p>Formula:C7H10O2Color and Shape:Clear LiquidMolecular weight:126.15 g/molH-Gly-Gly-Lys-Arg-OH acetate salt
CAS:<p>The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.</p>Formula:C16H32N8O5Purity:Min. 95%Molecular weight:416.48 g/mol4-Aminopicolinic acid
CAS:<p>4-Aminopicolinic acid is a synthetic amine that has been shown to activate plant science. 4-Aminopicolinic acid is a cyclic peptide with two subunits, one of which is 4-amino-3-pyridinecarboxylic acid. This compound has been synthesized from picolinic acid, an agriculturally important compound that is found in plant and animal tissues. The synthesis of 4-aminopicolinic acid involves the reaction of picolinic acid with nitrous oxide, followed by hydrolysis and oxidation to form the desired product. Hplc analyses have confirmed the presence of picolinic acid in extracts from various plants containing this compound.</p>Formula:C6H6N2O2Purity:Min. 95%Color and Shape:White To Beige Or Pink To Light Brown SolidMolecular weight:138.12 g/molPHM-27 (human) trifluoroacetate salt
CAS:<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>Formula:C135H214N34O40SPurity:Min. 95%Molecular weight:2,985.41 g/molMethyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate
CAS:<p>Please enquire for more information about Methyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8BrNO3Purity:Min. 95%Molecular weight:246.06 g/molChloromethyl acetate
CAS:<p>Chloromethyl acetate is a potent antibacterial agent that inhibits the growth of bacteria by inhibiting the synthesis of fatty acids. It also has an inhibitory effect on adenosine receptors and is used to treat congestive heart failure, inflammatory diseases, metabolic disorders, and other conditions. Chloromethyl acetate has been shown to be effective against a number of bacterial strains, including methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumoniae, and Mycobacterium tuberculosis. Chloromethyl acetate binds to the cyanoformate group in the bacterial cell wall by competitive inhibition. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme fatty acid synthase that is required for fatty acid biosynthesis, inhibiting protein synthesis and cell division.</p>Formula:C3H5ClO2Purity:Min. 95%Molecular weight:108.52 g/mol(D-Trp8)-γ2-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H99N21O16SPurity:Min. 95%Molecular weight:1,570.78 g/mol(D-Lys6)-LHRH (free acid) acetate salt
CAS:Controlled Product<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H83N17O14Purity:Min. 95%Molecular weight:1,254.4 g/molH-Pro-Pro-Gln-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/molH-Val-Lys-OH monoacetate salt
CAS:<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H23N3O3•C2H4O2Purity:Min. 95%Molecular weight:305.37 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/molNeuropeptide VF (124-131) (human) trifluoroacetate salt
CAS:<p>Neuropeptide VF (124-131) (human) trifluoroacetate salt H-Val-Pro-Asn-Leu-Pro-Gln-Arg-Phe-NH2 trifluoroacetate salt is a peptide that is synthesized in the hypothalamus and is involved in the regulation of gonadotropin secretion. It has been shown to inhibit cell growth in vitro and to have an inhibitory effect on cancer cells. This peptide also binds to receptors α, adenohypophyseal, cellular, testicular, vasoactive intestinal peptide, messenger RNA, estradiol benzoate, cancer, and progesterone receptor.</p>Formula:C45H72N14O10Purity:Min. 95%Molecular weight:969.14 g/mol4-Acetamidophenyl boronic acid
CAS:<p>4-Acetamidophenyl boronic acid is a cross-coupling reagent that has been used in the synthesis of a variety of organic molecules. The reaction is stereoselective and proceeds with high yield. 4-Acetamidophenyl boronic acid has also been used to synthesize amides and azobenzenes, which can be substituted with chloride or uv irradiation to give chloroazobenzene or benzotriazole respectively. 4-Acetamidophenyl boronic acid has shown potent inhibition against the enzyme cyclooxygenase 2 (COX2) and acidic hydrolysis.</p>Purity:Min. 95%H-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/molBoc-(R)-3-Amino-4-(2,4,5-trifluorophenyl)butanoic acid
CAS:<p>Intermediate in the synthesis of sitagliptin</p>Formula:C15H18F3NO4Purity:Min. 95%Molecular weight:333.3 g/mol([ring-D5]Phe8)-Angiotensin II acetate salt
CAS:<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H66D5N13O12Purity:Min. 95%Molecular weight:1,051.21 g/mol4-Hydroxyphenyl acetate
CAS:<p>4-Hydroxyphenyl acetate is a naturally occurring fatty acid that is found in many plants. It has been isolated from the seeds of Telfairia occidentalis and has been shown to inhibit the growth of bacteria at a pH of 7.5, with an optimal pH of 8.0. 4-Hydroxyphenyl acetate is an activated form of this compound, which means it contains two hydroxyl groups and does not have to be synthesized by enzymes. 4-Hydroxyphenyl acetate inhibits bacterial enzyme activities such as DNA gyrase and RNA polymerase, which are necessary for transcription and replication. The structure analysis of 4-hydroxy phenylacetate was determined using trifluoroacetic acid (TFA) on a wild-type strain of Escherichia coli K12.</p>Formula:C8H8O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:152.15 g/molH-DL-Val-Leu-Arg-pNA acetate salt
CAS:<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>Formula:C23H38N8O5Purity:Min. 95%Molecular weight:506.6 g/mol4-Sulfamylbenzoic acid
CAS:<p>4-Sulfamylbenzoic acid is a model system for the study of transporter and receptor activity. It has been shown to have the ability to inhibit tubule cells in carcinoma cell lines by binding to the protein target, nitrogen atoms, and hydrophobic effect. 4-Sulfamylbenzoic acid has also been shown to bind to the drug transporter and receptor activity. This binding prevents the formation of an inhibitor-transmitter complex with the enzyme that is required for transport or receptor activity, as well as inhibiting protein synthesis and cell division. The kinetic and reaction mechanism are not known at this time.</p>Formula:C7H7NO2SPurity:Min. 95%Molecular weight:169.2 g/mol4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid
CAS:<p>4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.</p>Formula:C9H9BrN2O3Purity:(Elemental Analysis) Min. 97%Color and Shape:PowderMolecular weight:273.08 g/mol(d(CH2)51,Tyr(Me)2,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>The monoclonal antibody (mAb) is a recombinant protein that binds to the extracellular region of the vasopressin receptor. It is used in pharmacological research to study the physiological function and pharmacological effects of vasopressin. The mAb has been shown to be minimally toxic, with an LD50 value of greater than 10 mg/kg in mice. It has also been shown to inhibit viruses and inhibit drug-sensitive enzymes. This antibody can be used as a diagnostic tool for congestive heart disease, as well as in experimental models for studying the minimal toxicity and tumor treatment properties of various drugs.</p>Formula:C52H74N14O12S2Purity:Min. 95%Molecular weight:1,151.36 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C54H85N19O13Purity:Min. 95%Molecular weight:1,208.37 g/molLIP2 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H288N58O58Purity:Min. 95%Molecular weight:4,240.61 g/molDi-tert-butyl azodicarboxylate
CAS:<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>Formula:C10H18N2O4Purity:Min. 98%Color and Shape:PowderMolecular weight:230.26 g/mol2,3,4,5-Tetrafluorobenzoic acid
CAS:<p>Tetrafluorobenzoic acid is a synthetic chemical that is used in the synthesis of antimicrobial agents. Tetrafluorobenzoic acid has been shown to bind to the hydroxyl group of 2,3,4,5-tetrafluorobenzoyl chloride and form a covalent bond. The reaction solution was analyzed using crystallography and showed that there are no intermolecular hydrogen bonds between tetrafluorobenzoic acid molecules. The crystal structure was determined by X-ray diffraction analysis and found that the intramolecular hydrogen bonding may be responsible for the anti-microbial activity of this substance.</p>Formula:C7H2F4O2Molecular weight:194.08 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molMagnesium acetate anhydrous
CAS:<p>Magnesium acetate anhydrous is the magnesium salt of acetic acid and has been used as a polymerase chain reaction (PCR) buffer for DNA amplification. This product is also used in wastewater treatment to remove organic acids and carbonates from water. Magnesium acetate anhydrous has been shown to have a Langmuir adsorption isotherm that can be described by a single-site binding model with a Kd value of 2.8x10-2 M. The compound was found to bind to liver cells, which may be due to its hydroxyl group on the central atom of the molecule. Magnesium acetate anhydrous has been shown to have electrochemical impedance spectroscopy properties at Ω=1 MΩ-1, which are indicative of ionic conductivity and good chemical stability.</p>Formula:C4H6MgO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:142.39 g/moltert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N2O3Purity:Min. 95%Molecular weight:256.34 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Biotinyl-Obestatin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H190N34O35SPurity:Min. 95%Molecular weight:2,773.13 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/mol5-Amino-2-methoxyisonicotinic acid
CAS:<p>5-Amino-2-methoxyisonicotinic acid is a carboxylic acid that is used in the synthesis of aminopyridines. The compound can be synthesized from formamidine acetate and diethyl dicarbonate. This process involves lithiation, followed by addition of an amine and finally conversion to the desired product with formamidine acetate. 5-Amino-2-methoxyisonicotinic acid can also be synthesized from formamide and diethyl ether. 5-Amino-2-methoxyisonicotinic acid is an analog of 2,4,6-trimethylaniline and has been shown to have similar properties to this compound, including strong basicity.</p>Formula:C7H8N2O3Purity:Min. 95%Molecular weight:168.15 g/molThr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
CAS:<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>Formula:C145H234N52O44S3Purity:Min. 95%Molecular weight:3,505.93 g/molPhylloseptin-L2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H126N18O19Purity:Min. 95%Molecular weight:1,595.92 g/molAmylin (mouse, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C167H272N52O53S2Purity:Min. 95%Molecular weight:3,920.4 g/mol2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid
CAS:<p>Please enquire for more information about 2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7N3O2S2Purity:Min. 95%Color and Shape:PowderMolecular weight:217.27 g/mol(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H295N55O51S2Purity:Min. 95%Molecular weight:4,217.84 g/molEthyl 2-fluoroacetoacetate
CAS:<p>Ethyl 2-fluoroacetoacetate is a phosphorus oxychloride synthon that can be used to synthesize fluorinated compounds. It has been shown to react with a carbonyl group, like tyrosine, in the presence of an organocatalyst to form a tetrafluoroborate ester. The reaction mechanism of this compound is intramolecular hydrogen transfer from the phosphite oxygen atom to the electrophilic carbon atom. Ethyl 2-fluoroacetoacetate has been shown to react with alkyl halides and hydroxyl groups in the presence of base, forming enantiomeric alcohols. This compound has also been shown to have optical properties that are stable at room temperature and pressure, including infrared absorption maxima at 1740 cm-1 and 1775 cm-1 as well as ultraviolet absorption maxima at 225 nm and 254 nm.</p>Formula:C6H9FO3Purity:Min. 95%Molecular weight:148.13 g/molGalanin Message Associated Peptide (1-41) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C206H326N56O64SPurity:Min. 95%Molecular weight:4,643.2 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Molecular weight:555.63H-Gly-Lys-His-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Lys-His-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H24N6O4Purity:Min. 95%Molecular weight:340.38 g/mol5-bromo-2-(trifluoromethyl)benzoic Acid
CAS:<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H4BrF3O2Purity:Min. 95%Molecular weight:269.02 g/mol6-Maleimidocaproic acid N-hydroxysuccinimide ester
CAS:<p>6-Maleimidocaproic acid N-hydroxysuccinimide ester (6MCA-NHS) is a fluorescent probe that reacts with the hydroxyl group of fatty acids in human serum and other biological samples. 6MCA-NHS binds to the carboxylic acid group at the end of a fatty acid molecule, forming a covalent bond. This process generates light emission that can be detected by a fluorescence probe to measure changes in pH or other chemical properties within the solution. 6MCA-NHS has been used as a tumor treatment, where laser ablation is used to break up tumor cells and release 6MCA-NHS into the cytoplasm. The drug can then bind to DNA molecules and inhibit protein synthesis, which results in cell death.</p>Formula:C14H16N2O6Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:308.29 g/molH-Gly-Tyr-NH2 acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19N3O5Purity:Min. 95%Molecular weight:297.31 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS:<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>Formula:C8H14O4S2Purity:Min. 97%Color and Shape:Colorless Clear LiquidMolecular weight:238.33 g/mol3-Pyridylboronic acid pinacol ester
CAS:<p>3-Pyridylboronic acid pinacol ester is a versatile reagent that can be used in the synthesis of polymers with reactive functionalities. This compound is a crosslinker, which means that it reacts with two or more other molecules to form a covalent bond. 3-Pyridylboronic acid pinacol ester has been shown to react with ring-opening methacrylate monomers and expand their polymer backbone, which leads to an increase in the number of reactive groups on the chain. The introduction of 3-pyridylboronic acid pinacol ester can also introduce fluorescent units into polymers for use as probes for biological systems. There are many possible applications for this versatile reagent, including its use in the synthesis of imidazopyridine ligands.</p>Formula:C11H16BNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:205.06 g/mol4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt
CAS:<p>Please enquire for more information about 4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H6Cl2Na2O8S3Purity:Min. 95 Area-%Color and Shape:White Off-White PowderMolecular weight:491.25 g/mol3-Bromo-6-methylpicolinic acid
CAS:<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H6BrNO2Purity:Min. 95%Molecular weight:252.49 g/molSodium fluoroacetate
CAS:<p>Sodium fluoroacetate is a salt that is synthesized by the reaction of methyl ethyl and sodium trifluoroacetate. It has been used as an insecticide, but also has been used to treat metabolic disorders such as bowel disease and eye disorders. Sodium fluoroacetate also has been used in natural products for the treatment of autoimmune diseases. The toxicological studies of sodium fluoroacetate have shown that it can cause eye disorders and x-ray crystal structures have revealed its mechanism of action.</p>Formula:C2H2FNaO2Color and Shape:White PowderMolecular weight:100.02 g/molH-Pro-Pro-Asp-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H22N4O5·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:440.37 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>Formula:C139H231N43O39SPurity:Min. 95%Molecular weight:3,160.65 g/molpTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C207H334N66O58Purity:Min. 95%Molecular weight:4,675.28 g/molPrion Protein (118-135) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H112N18O22S2Purity:Min. 95%Molecular weight:1,597.86 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H183N45O26Purity:Min. 95%Molecular weight:2,455.83 g/molM65 trifluoroacetate salt
<p>Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H326N64O61S5Purity:Min. 95%Molecular weight:4,823.51 g/mol(R)-2-Hydroxy-4-phenylbutanoic acid
CAS:<p>(R)-2-Hydroxy-4-phenylbutanoic acid is an ester compound that is produced by the conversion of (S)-malic acid to its enantiomer. This reaction is catalyzed by a phosphoric acid esterase. The kinetic, immobilization, and transfer mechanisms have been characterized. The solubilized form of the enzyme was found to be more active than the crystalline form. Enzyme inhibitors such as hydrogen chloride and hydrochloric acid were also investigated in order to determine their effect on the reaction rate and product distribution. A structural formula for (R)-2-Hydroxy-4-phenylbutanoic acid was determined using nuclear magnetic resonance spectroscopy and mass spectrometry, revealing a dinucleotide phosphate as a possible intermediate in the synthesis pathway.</p>Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/molDiethyldithiocarbamic acid sodium trihydrate
CAS:<p>Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.</p>Formula:C5H11NS2•Na•(H2O)3Purity:Min. 95%Color and Shape:PowderMolecular weight:226.32 g/molHemimellitic acid
CAS:<p>Hemimellitic acid is a carboxylate that has an intramolecular hydrogen and a reactive hydroxyl group. It can be used as a precursor to the production of polymers and plastics. Hemimellitic acid is an inorganic acid that contains nitrogen atoms. It can exist as particles with a size range between 1 and 100 nanometers. The chemical structure of hemimellitic acid is related to the malonic acid; it is the methyl ethyl ester of malonic acid. Hemimellitic acid has thermodynamic data, including a standard enthalpy change of -3,079 kJ/mol (-8,726 cal/mol) and Gibbs free energy change of -2,837 kJ/mol (-6,927 cal/mol).</p>Formula:C9H6O6Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:210.14 g/mol1,3,6,8-Pyrenetetrasulfonic acid tetrasodium, 10% aqueous solution
CAS:<p>1,3,6,8-Pyrenetetrasulfonic acid tetrasodium salt (PTS) is a palladium complex that is used as a catalyst in the chemical industry. It can be prepared by the reaction of palladium chloride with sodium sulfide and sodium hydroxide. PTS has been shown to react with diethyl succinate, forming a solid catalyst that can be stored for longer periods of time. This compound has been found to catalyze hydrogenations under constant pressure conditions and also exhibit low energy consumption when performing reactions. PTS is able to bind to DNA, leading to cancer cell death. PTS also has fluorescence properties and can be used in electrochemical impedance spectroscopy.</p>Formula:C16H10O12S4•Na4Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:614.47 g/molDynorphin A (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H127N25O14Purity:Min. 95%Molecular weight:1,602.97 g/molH-Pro-Phe-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O4Purity:Min. 95%Molecular weight:390.48 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H129N25O25SPurity:Min. 95%Molecular weight:2,005.22 g/molFluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H109N23O18SPurity:Min. 95%Molecular weight:1,628.86 g/mol5-Nitro nicotinic acid
CAS:<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>Formula:C6H4N2O4Purity:Min. 95%Molecular weight:168.11 g/molIntermedin-53 (human) trifluoroacetate salt
<p>Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C247H395N83O73S3Purity:Min. 95%Molecular weight:5,791.49 g/mol4-(4-Phenylbutoxy)benzoic acid
CAS:<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>Formula:C17H18O3Purity:Min. 95%Molecular weight:270.32 g/molTRAP-5 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H51N9O6Purity:Min. 95%Molecular weight:633.78 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C141H235N47O41·xC2H4O2Purity:Min. 95%Molecular weight:3,244.67 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS:<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Molecular weight:208.07 g/mol(D-Trp11)-Neurotensin acetate salt
CAS:<p>Acetate salt</p>Formula:C80H122N22O19Purity:Min. 95%Molecular weight:1,695.96 g/mol(Asp371)-Tyrosinase (369-377) (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C42H66N10O16S2Purity:Min. 95%Molecular weight:1,031.16 g/molCyclopropane-1,1-dicarboxylic acid, methylester
CAS:<p>Please enquire for more information about Cyclopropane-1,1-dicarboxylic acid, methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:144.13 g/mol(Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H296N54O56Purity:Min. 95%Molecular weight:4,292.77 g/molD-Isoascorbic acid
CAS:<p>D-Isoascorbic acid is a sodium salt of ascorbic acid. It is used for the prevention and treatment of scurvy, which is caused by vitamin C deficiency. D-Isoascorbic acid functions as an electron donor in biochemical reactions and has been shown to have physiological effects. Ascorbic acid (vitamin C) is a water-soluble antioxidant that can react with hydrogen fluoride in vitro to form free radicals that may cause damage to cells. In addition, D-Isoascorbic acid can be used as a model system for the study of ascorbic acid and p-hydroxybenzoic acid. The analytical method for determining these compounds involves electrochemical impedance spectroscopy.</p>Formula:C6H8O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:170 g/molAF-16 trifluoroacetate salt
CAS:<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>Formula:C71H119N25O25SPurity:Min. 95%Molecular weight:1,754.92 g/molC-Peptide (human) acetate salt
CAS:<p>C-Peptide (human) acetate salt H-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala -Gly Ser Leu Gln Pro Leu Ala Leu Glu Gly Ser Leu Gln Pro Leu Ala is a peptide that has been purified from the pancreas of human and bovine sources. It is used in blood sampling and rate constant experiments to measure the response element on a signal peptide. This experiment can be used to study insulin production, as well as other biological samples. C Peptide (human) acetate salt H Glu Ala Glu Asp Leu Gln Val Gly Gln Val Glu Leu Gly Gly Gly Pro Gly Ala Gly Ser Leu Gln Pro Leu Ala has inhibitory properties against</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molUrotensin II-Related Peptide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>Formula:C49H64N10O10S2Purity:Min. 95%Molecular weight:1,017.23 g/molH-Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys-Ala-OH trifluoroacetate salt (Disulfide bond between Pen2 and Cys9)
CAS:<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>Formula:C35H57N13O14S2Purity:Min. 95%Molecular weight:948.04 g/molPyromeconic acid
CAS:<p>Pyromeconic acid is a trifluoroacetic acid derivative that has been shown to have anti-inflammatory properties. Pyromeconic acid has a redox potential of -0.07 V at pH 7 and can act as a reducing agent in biological systems. It has been shown to inhibit the methylation of pueraria lobata and the transferase activity of methionine synthase, which plays a role in the synthesis of proteins. Pyromeconic acid also inhibits the production of sesquiterpene lactones in carthamus tinctorius, which are responsible for its anti-inflammatory effects. It is an acidic chemical that contains a hydroxyl group and coordinates with metals such as copper, zinc, and nickel.</p>Formula:C5H4O3Purity:Min. 95%Color and Shape:Off-White To Light (Or Pale) Yellow SolidMolecular weight:112.08 g/molCyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.</p>Formula:C26H38N8O7Purity:Min. 95%Molecular weight:574.63 g/mol(Asp28)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H281N49O61SPurity:Min. 95%Molecular weight:4,187.56 g/mol(Phe7)-Dynorphin A (1-7) acetate salt
CAS:<p>Dynorphin A (1-7) acetate salt is a potent analgesic that has been used to treat pain. It has been shown to be effective in the treatment of laryngitis and other laryngological disorders. Dynorphin A (1-7) acetate salt is a prodrug that is hydrolyzed in vivo to dynorphin A (1-7) by esterases, which can then bind to opioid receptors. This drug has been validated for use as a diagnostic agent in coatings and in algorithms for analysis of polygonal images from laryngoscopy. The dehydrogenase enzymes are added to the coating or algorithm for diagnosis of the presence of vocal cord pathology. Dynorphin A (1-7) acetate salt also shows promising results for analyzing waveforms from laryngoscopy, with the goal of classifying vocal cord pathology.</p>Formula:C43H58N10O9Purity:Min. 95%Molecular weight:858.98 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H93N15O14S2Purity:Min. 95%Molecular weight:1,204.51 g/molTLQP-21 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N40O26Purity:Min. 95%Molecular weight:2,432.75 g/molTert-Butyl Trans-4-(2-Oxoethyl)Cyclohexylcarbamate
CAS:<p>Please enquire for more information about Tert-Butyl Trans-4-(2-Oxoethyl)Cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23NO3Purity:Min. 95%Molecular weight:241.33 g/molEthyl 2-(2-chloroethoxy)acetate
CAS:<p>Please enquire for more information about Ethyl 2-(2-chloroethoxy)acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H11ClO3Purity:Min. 95%Molecular weight:166.6 g/molH-Lys-Lys-bNA acetate salt
CAS:<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N5O2Purity:Min. 95%Molecular weight:399.53 g/mol(Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C226H338N60O64SPurity:Min. 95%Molecular weight:4,951.53 g/mol
