Carboxylic Acids

<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>

<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>

<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>

<p>Ethylenediaminetetraacetic acid tripotassium salt dihydrate is an anticoagulant that can be used as a coagulant for blood samples. It is often used in polymerase chain reactions to synthesize DNA, or to isolate and purify genomic DNA. This compound has ferroelectric properties and can be used as a target cell in optical imaging applications. Ethylenediaminetetraacetic acid tripotassium salt dihydrate is also used in the production of polyurethanes and as a polymerization inhibitor in cinnamon oil.</p>

<p>D-Isoascorbic acid is a sodium salt of ascorbic acid. It is used for the prevention and treatment of scurvy, which is caused by vitamin C deficiency. D-Isoascorbic acid functions as an electron donor in biochemical reactions and has been shown to have physiological effects. Ascorbic acid (vitamin C) is a water-soluble antioxidant that can react with hydrogen fluoride in vitro to form free radicals that may cause damage to cells. In addition, D-Isoascorbic acid can be used as a model system for the study of ascorbic acid and p-hydroxybenzoic acid. The analytical method for determining these compounds involves electrochemical impedance spectroscopy.</p>

<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Asp76)-pTH (39-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-(Carboxymethyl)-4,5-dimethoxybenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt H-Ala-Tyr-Pro-Gly-Lys-Phe-OH trifluoroacetate salt is a potent inhibitor of protein kinase C, and has been shown to inhibit the growth of prostate cancer cells. It also inhibits phosphorylation of epidermal growth factor receptors, which leads to lower levels of epidermal growth factor in the cell. This drug also has antiplatelet effects and may be used as an antiplatelet agent for patients with vascular disease or diabetes.</p>

<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>

<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>

<p>Trifluoroacetate salt</p>

<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>

<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>

<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>

<p>Pyromeconic acid is a trifluoroacetic acid derivative that has been shown to have anti-inflammatory properties. Pyromeconic acid has a redox potential of -0.07 V at pH 7 and can act as a reducing agent in biological systems. It has been shown to inhibit the methylation of pueraria lobata and the transferase activity of methionine synthase, which plays a role in the synthesis of proteins. Pyromeconic acid also inhibits the production of sesquiterpene lactones in carthamus tinctorius, which are responsible for its anti-inflammatory effects. It is an acidic chemical that contains a hydroxyl group and coordinates with metals such as copper, zinc, and nickel.</p>

<p>Please enquire for more information about CRAMP-18 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuronostatin-13 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Silver trifluoroacetate is a chemical compound that is a silver salt of trifluoroacetic acid. Silver trifluoroacetate is a white crystalline solid, soluble in water and alcohols, but insoluble in ethers. It has the chemical formula AgCF3CO2H. The crystal structure of silver trifluoroacetate has been determined by x-ray diffraction techniques and found to be orthorhombic with space group Pbam. The molecule consists of two 5-membered heteroaromatic rings, one containing carbon atoms and the other containing nitrogen atoms. The nitrogen atom is bonded to six hydrogen atoms and three fluorine atoms, while the carbon atom is bonded to four oxygen atoms and one fluorine atom. Synthesis methods for this compound include reacting silver nitrate with sodium carbonate in water vapor at 120°C.</p>

<p>2-Phenylpropionic acid is a reactive chemical that can be synthesized by an asymmetric process. It has been used in the synthesis of nonsteroidal anti-inflammatory drugs, as it inhibits the activity of cyclooxygenase and lipoxygenase enzymes. This chemical also binds to the hydroxyl group on target proteins, inhibiting their function. 2-Phenylpropionic acid is metabolized by microbial metabolism and can inhibit the activity of drug-metabolizing enzymes such as CYP3A4 and CYP2D6. It may also interact with other drugs that are processed by these enzymes, including warfarin and carbamazepine. 2-Phenylpropionic acid is a competitive inhibitor that binds to the active site of an enzyme and blocks its access to its substrate molecule. The binding of 2-phenylpropionic acid to enzyme's active site prevents the reactant from entering and reacting with the enzyme, thereby preventing a</p>

<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hydrazine acetate is an organic solution that has a glycoconjugate. It is also found in uridine, hydrogen bond and serine protease. Hydrazine acetate has been shown to have a benzyl group and carbonyl group. Hydrazine acetate interacts with trifluoroacetic acid and particle. This drug can be used for the treatment of autoimmune diseases, such as rheumatoid arthritis, and infectious diseases such as HIV/AIDS. Hydrazine acetate has shown high values for growth factor activity, which may be due to its ability to inhibit the enzyme ns3 protease in the synthesis of proinflammatory cytokines.</p>

<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.</p>

<p>Methyl benzofuran-6-carboxylate is a synthetic retinoid that is a conformationally constrained analogue of retinoic acid, which is one of the most powerful biological molecules. Methyl benzofuran-6-carboxylate has been shown to be an effective anti-inflammatory agent and may be useful in the treatment of inflammatory skin diseases. It also inhibits the production of proinflammatory cytokines and chemokines, such as TNF-α, IL-1β, IL-8, CCL2, CXCL1, and CXCL2. Methyl benzofuran-6-carboxylate binds to specific receptors on cell surfaces to inhibit the production of inflammatory mediators. The drug also has been shown to have antiangiogenic activity. This property may be due to its ability to inhibit the production of vascular endothelial growth factor (VEGF) and other angiogenic factors.</p>

<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>

<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Exendin-4 (1-8) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>

<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.</p>

<p>D-alpha-Hydroxyisovaleric acid is a compound that is used to synthesize stereoisomers. It is also a component of supramolecular chemistry and has been used in the construction of supramolecular polymers. D-alpha-Hydroxyisovaleric acid can be found in some plants, such as valinomycin, isovaleric acid, and metarhizium. This stereoisomer can be synthetized from the hydroxy group and an amino acid or peptide. D-alpha-Hydroxyisovaleric acid has the ability to degrade nonribosomal peptides into smaller molecules through its hydrolytic properties. It also inhibits Verticillium dahliae, which causes wilt disease in plants, by inhibiting the synthesis of hydroxycarboxylates. D-alpha-Hydroxyisovaleric acid is biodegradable and can be used for industrial purposes as well as pharmaceuticals.</p>

<p>Trans-2,5-difluorocinnamic acid is a monomer that belongs to the group of organic acids. It is used as a solvent and in analytical methods. Trans-2,5-difluorocinnamic acid is also used to transport other substances and can be used in reactions with other molecules. Trans-2,5-difluorocinnamic acid has been shown to be neuropathic and has been tested for its ability to cause cataracts, but has not shown any evidence of mutagenicity.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (4-Chloro-3-fluorophenyl)acetic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ethyl 2-(2-chloroethoxy)acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SPARC (119-122) (mouse) is an acetate salt of H-Lys-Gly-His-Lys-OH. SPARC (119-122) has been shown to be a mimetic of the c-terminal region of the protein SPARC and can bind to many metal ions including Zn2+, Mn2+, Cu2+, Co2+, Ni2+ and Mg2+. The binding affinity for these metals is dose dependent, with saturation occurring at high concentrations. This property may make this compound a therapeutic target for drug discovery strategies.</p>

<p>Please enquire for more information about (4S,5R)-3-Benzoyl-2-(4-methoxyphenyl)-4-phenyl-5-oxazolidinecarboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Undecanoic acid is a fatty acid that belongs to the class of saturated fatty acids. It has been shown to have a number of biological effects, including lowering cholesterol levels, preventing and treating opportunistic fungal infections, and as a contraceptive. Undecanoic acid is also known to increase the body mass index (BMI) in mice and may be useful in the treatment of coronary heart diseases in humans.</p>

<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dimethyl benzyl carbinol acetate is a polymer that forms a film on the skin and prevents water loss. It has been shown to have enzyme-inhibiting properties, which may be due to its ability to prevent geranyl production. Dimethyl benzyl carbinol acetate has also been used as a sealant in microcapsules, which are then broken down by enzymes in order to release the contents of the capsule. Dimethyl benzyl carbinol acetate can also be used as an antimicrobial agent, where it inhibits bacterial cell growth by interfering with fatty acid synthesis.</p>

<p>Mercaptoacetic acid sodium salt (MAS) is an oxidation catalyst that is used to convert ethyl alcohol into acetic acid. It has been shown to be a good catalyst for the oxidation of hydroxyl groups in the presence of metal hydroxides or inorganic acids, such as sodium carbonate. MAS has also been shown to be toxic to human serum and is not recommended for use in humans. The toxicity of MAS may be due to its ability to react with fatty acids and form mercaptans, which are volatile compounds that can cause irritation. Mercaptoacetic acid sodium salt reacts with potassium dichromate and forms mercaptans and other products, which may contribute to its toxicity.</p>

<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>

<p>Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.</p>

<p>5-Aminopyridine-3-carboxylic acid (5APC) is a structural analog of nicotinic acid that has been shown to have anti-inflammatory effects. 5APC inhibits the production of inflammatory cytokines, such as IL-10 and IL-17, by inhibiting the activation of NFκB and MAPK pathways. This drug also has significant inhibitory activities against dextran sulfate sodium (DSS)-induced acute colitis in experimental models. 5APC is thought to act by interrupting the assembly of p38 mitogen activated protein kinase (MAPK) and nuclear factor kappa B (NFκB) signaling complexes.</p>

<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>

<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>

<p>Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>

<p>Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Please enquire for more information about (2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>