
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,957 products)
- Amino Acid and Amino Acid Related Compounds(3,472 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38265 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Ala-His-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H19N5O4Purity:Min. 95%Molecular weight:297.31 g/mol2-Methylthio-N6-threonylcarbamoyladenosine
CAS:<p>A modified form of adenosine found in bacterial and eukaryotic tRNAs</p>Formula:C16H22N6O8SPurity:Min. 95%Color and Shape:PowderMolecular weight:458.45 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS:<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O6Purity:Min. 95%Molecular weight:481.55 g/molZ-L-Alanine
CAS:<p>Z-L-Alanine is a cytosolic enzyme inhibitor that inhibits the activity of enzymes involved in protein catalysis. This inhibition is stereoselective, with the L-enantiomer having the stronger inhibitory effect. Z-L-Alanine has been shown to be an effective inhibitor of proteolytic enzymes and has been used as an additive in buffers to prevent enzymatic degradation. Molecular modeling studies have demonstrated that Z-L-Alanine can bind to the active site of these enzymes and inhibit their activity by binding to the catalytic triad of serine, aspartate, and histidine residues. The molecular structure of Z-L-Alanine resembles that of a natural substrate for these enzymes, which may account for its effectiveness in inhibiting them. FTIR spectroscopy has confirmed the presence of Z-L-alanine in a sample obtained from a bacterial culture. Liquid chromatography has shown that this amino acid is present at high levels in various</p>Formula:C11H13NO4Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:223.23 g/mol3-Acetyl-1-methylpyrrole
CAS:<p>3-Acetyl-1-methylpyrrole is an activating agent that can be used to synthesize methyl ketones. It has been shown to react with acid solutions and proton, which are generated by the reaction of a metal ion (such as Al) with hydrochloric acid. This reaction leads to the formation of enolate ions, which can then react with carbonyl groups to form alkylation products. 3-Acetyl-1-methylpyrrole is also able to catalyze reactions in both acidic and basic conditions. The kinetic of this reaction is fast, efficient, and does not require expensive equipment.</p>Formula:C7H9NOPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:123.15 g/molZ-Val-Lys-Met-AMC acetate salt
CAS:<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>Formula:C34H45N5O7SPurity:Min. 95%Molecular weight:667.82 g/mol3,5-Dichloro-4-methylpyridine
CAS:<p>Please enquire for more information about 3,5-Dichloro-4-methylpyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H5Cl2NPurity:Min. 95%Molecular weight:162.02 g/molH-Leu-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Leu-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Phe-Leu-OH
CAS:<p>H-Gly-Phe-Leu-OH is a hydrophobic amino acid and homologue of the natural amino acid histidine. It is an organic compound that is used in the synthesis of peptides and proteins. This compound can be synthesized by reacting ethyl esters with glycine, phenylalanine, and leucine. H-Gly-Phe-Leu-OH has been shown to be active against organisms such as Staphylococcus aureus, Escherichia coli, and Bacillus subtilis. The effectiveness of this compound may be due to its ability to bind to various sites on the organism's cell wall. It also has been shown to have antiplatelet activity similar to aspirin.</p>Formula:C17H25N3O4Purity:Min. 95%Molecular weight:335.4 g/molBoc-Lys(2-chloro-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%N-Heptyl-Hyp-OH
CAS:<p>The synthesis of N-heptyl-hyp-OH is a chiral resolution process for the preparation of the enantiomers of heptanol. The enantioselective synthesis of this compound is achieved by converting the racemic mixture to an optically active form by means of a chiral auxiliary, followed by protection and hydrolysis. This method produces an optically pure product in high yield.</p>Formula:C12H23NO3Purity:Min. 95%Molecular weight:229.32 g/molBoc-L-Nitroarginine
CAS:<p>Boc-L-Nitroarginine is a nitric oxide synthase inhibitor that belongs to the class of drugs called nitric oxide inhibitors. It is a potent inhibitor of nitric oxide synthase, preventing the production of nitric oxide from arginine. The drug has been shown to have therapeutic effects in the treatment of cancer, diabetes mellitus, and other diseases. Boc-L-Nitroarginine inhibits tumor angiogenesis by blocking endothelial cell proliferation and migration. It also inhibits insulin secretion, leading to an improved glycemic control in diabetic patients. Boc-L-Nitroarginine can be used as a hydrogenation reducing agent for the synthesis of imatinib and palladium catalysts for hydrogenation reactions.</p>Formula:C11H21N5O6Purity:Min. 95%Color and Shape:PowderMolecular weight:319.31 g/molZ-Leu-Met-OH
CAS:<p>Please enquire for more information about Z-Leu-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N2O5SPurity:Min. 95%Molecular weight:396.5 g/molMeOSuc-Gly-Leu-Phe-AMC
CAS:<p>MeOSuc-Gly-Leu-Phe-AMC is a fluorescent substrate that is used in the study of proteasomes. It binds to reticulums, cytoplasmic proteins, and antigen receptors on the surface of lymphocytes. The MeOSuc-Gly-Leu-Phe-AMC substrate is cleaved by the proteasome into AMC and Gly-Leu fragments. These fragments can be detected using fluorescence spectroscopy or a fluorimeter. This product has been shown to be active against Lymphocytic Choriomeningitis Virus (LCMV).</p>Formula:C32H38N4O8Purity:Min. 95%Molecular weight:606.67 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molZ-Phe-Arg-pNA·HCl
CAS:<p>Please enquire for more information about Z-Phe-Arg-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H33N7O6·HClPurity:Min. 95%Molecular weight:612.08 g/molZ-Ala-Pro-Phe-chloromethylketone
CAS:<p>Z-Ala-Pro-Phe-chloromethylketone is a cytosolic protein that performs its function by denaturing proteins and is localized in the cytosol. It has been shown to be active against a number of bacteria, including Bacillus licheniformis and Listeria monocytogenes, as well as some fungi. Z-Ala-Pro-Phe-chloromethylketone targets the membrane potential in mitochondria and chloromethyl ketone is a strategy for inhibiting membrane potential in mitochondria. The x-ray diffraction data show that this protein forms a molecule with an alpha helix structure. It binds to the mitochondrial inner membrane by ligation and inhibits mitochondrial membrane potential.</p>Formula:C26H30ClN3O5Purity:Min. 95%Molecular weight:499.99 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>Formula:C60H87N19O13Purity:Min. 95%Molecular weight:1,282.45 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H54N10O9Purity:Min. 95%Molecular weight:782.89 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H32N6O7Purity:Min. 95%Molecular weight:444.48 g/molH-Tyr-Lys-OH
CAS:<p>H-Tyr-Lys-OH is a small drug molecule that has been shown to inhibit protein synthesis. It binds to the active site of the transcription-polymerase chain and competitively inhibits the binding of RNA polymerase. H-Tyr-Lys-OH has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis. H-Tyr-Lys-OH's conformational properties are similar to those found in proteins such as glutamic acid and lysine.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Pyr-Trp-Gly-NH2
CAS:<p>Please enquire for more information about Pyr-Trp-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H21N5O4Purity:Min. 95%Molecular weight:371.39 g/molH-Leu-Tyr-Leu-OH
CAS:<p>H-Leu-Tyr-Leu-OH is a molecule that contains a pyrrolidine ring and methyl groups. The molecule is an amino acid, which is one of the twenty that are used to form proteins. It has three terminal residues, which are H, Leu, and Tyr. The crystallographic structure of the compound was determined by x-ray crystallographic studies and it was found to be orthorhombic with a sephadex crystal lattice. The molecular conformation of this compound can be altered through kinetic or equilibrium processes.</p>Formula:C21H33N3O5Purity:Min. 95%Molecular weight:407.5 g/molZ-Leu-Tyr-chloromethylketone
CAS:<p>Z-Leu-Tyr-chloromethylketone is a peptide that binds to the reticulum and prevents the release of calcium ions. It is a chloromethyl ketone, which inhibits the L-type calcium channels in cells. Z-Leu-Tyr-chloromethylketone has been shown to block the influx of calcium ions into cytosolic compartments. This process leads to inhibition of protein synthesis and cell death by apoptosis.</p>Formula:C24H29ClN2O5Purity:Min. 95%Molecular weight:460.95 g/molH-Arg(Pmc)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Arg(Pmc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%N-(Hydroxymethyl)-phenylacetamide
CAS:<p>N-(Hydroxymethyl)-phenylacetamide is an organic solvent that is used in the synthesis of certain antibiotics. It is a synthetic compound and can be obtained by reacting toluene with benzene, using a strong acid catalyst such as sulfuric acid. N-(Hydroxymethyl)-phenylacetamide has been used in the synthesis of isoquinolones, which are also antibiotics. This organic solvent can also be used for recrystallization, which is a process that helps purify solids from liquids or liquids from solids. The yield of this reaction is high, making it an efficient way to synthesize these compounds.</p>Formula:C9H11NO2Purity:Min. 95%Molecular weight:165.19 g/molH-Ala-Ala-Pro-Val-chloromethylketone
CAS:<p>H-Ala-Ala-Pro-Val-chloromethylketone is a hydrogen peroxide prodrug that is activated by the enzyme chloromethyl ketone. This drug has been shown to be active against schistosoma and pancreatic cancer cells, as well as in activating peroxide. HAPV may also have an effect on immunity and leukocytes, which could be due to its ability to sensitize these cells to damage caused by other agents, or through the hydrolytic enzymes it generates.</p>Formula:C17H29ClN4O4Purity:Min. 95%Molecular weight:388.89 g/molZ-β-Ala-Gly-Gly-OH
CAS:<p>Please enquire for more information about Z-beta-Ala-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O6Purity:Min. 95%Molecular weight:337.33 g/molFmoc-D-thiazolidine-4-carboxylic acid
CAS:<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17NO4SPurity:Min. 95%Molecular weight:355.41 g/mol(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone
CAS:<p>(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone is an organic compound that belongs to the class of carbonyl reductase. It is used as a catalyst for the transformation of secondary alcohols to ketones or aldehydes, including isopropyl alcohol. The reaction proceeds via an intermediate carboxylic acid. The enzyme has been found in various microorganisms, and can be purified from Bacillus megaterium and Streptomyces lividans. The enzyme’s activity can be inhibited by steric effects, metal ions, or other compounds. (3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone crystallizes in two forms: one with the chiral center at the 3 position and one with it at the 4 position.</p>Purity:Min. 95%(Arg8,des-Gly-NH29)-Vasopressin
CAS:<p>Vasopressin is a hormone that is released from the posterior pituitary gland and stimulates the release of water from the kidneys. Vasopressin binds to receptors in the kidney tubules and increases water permeability and urine volume. Vasopressin also has been shown to be effective in reducing sensitivity to ionizing radiation, which may be due to its ability to bind with sulfur-containing amino acids such as cysteine and glutathione. The radiolabeled form of vasopressin is used as a tracer for measuring lung function, including volumes of air flow, gas density, and gas volume.</p>Formula:C44H61N13O12S2Purity:Min. 95%Molecular weight:1,028.17 g/molPeptide 46
CAS:<p>Peptide 46 is a synthetic peptide that has been shown to be effective in the treatment of cancer. It binds to an antigen-presenting cell, which presents the peptide to a T-cell receptor on a cytotoxic T-cell. The binding of the peptide to this receptor leads to activation of the cytotoxic T-cell, resulting in killing of cells bearing the peptide sequence. This peptide can also be used as an adjuvant for cancer therapy, as it induces regulatory responses in immune cells. Peptide 46 has been shown to have inhibitory effects on intracellular targets and sequences that are involved in regulating gene expression. It can also bind specifically to DNA sequences and linkers that are found in cancer tissues.</p>Formula:C100H174N40O31Purity:Min. 95%Molecular weight:2,432.7 g/mol2-Methyl-5-chloromethylpyridineHydrochloride
CAS:<p>Please enquire for more information about 2-Methyl-5-chloromethylpyridineHydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H9Cl2NPurity:Min. 95%Molecular weight:178.06 g/molL-Lysine diisocyanate
CAS:<p>L-Lysine diisocyanate is an organic compound that is a reactive site for the production of calcium stearate and ethylene diamine. It has been shown to be a reactive site in vitro, but not in vivo. L-Lysine diisocyanate reacts with water vapor to produce hydrogen cyanide, which is toxic to cells. The presence of l-lysine can inhibit the formation of hydrogen cyanide, but it also inhibits uptake into cells and tissue cultures.</p>Formula:C8H10N2O4Purity:Min. 95 Area-%Molecular weight:198.18 g/mol1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole
CAS:<p>Please enquire for more information about 1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:208.07 g/molFmoc-Cys(Acm)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(Acm)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Amyloid P Component (33-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56N10O7SPurity:Min. 95%Molecular weight:784.97 g/mol2-Methoxyethyl acetoacetate
CAS:<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>Formula:C7H12O4Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:160.17 g/molAc-Ala-α-naphthyl ester
CAS:<p>Ac-Ala-alpha-naphthyl ester is a chemical compound that belongs to the class of aromatic esters. It is used as a research and benchmarking agent in the measurement of skin penetration potential. Ac-Ala-alpha-naphthyl ester has been shown to have good skin penetration properties, with no adverse effects on the skin.</p>Formula:C15H15NO3Purity:Min. 95%Molecular weight:257.28 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/molHCV-1 e2 Protein (484-499)
CAS:<p>The HCV-1 e2 protein (484-499) is a peptide that is a fragment of the HCV-1 e2 protein. It has been shown to be neuroprotective in vitro and in vivo, by inhibiting the production of reactive oxygen species and reducing cell death. The HCV-1 e2 protein (484-499) is also able to inhibit inflammatory responses in human pancreatic cells and fibrosis in autoimmune disease models. This peptide could be used as prophylaxis or treatment for neurodegenerative disease, pancreatic cancer, infectious diseases, autoimmune diseases, or fibrotic diseases.</p>Formula:C88H122N20O19S2Purity:Min. 95%Molecular weight:1,828.17 g/molH-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu-OH
CAS:<p>The target of H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu is the phosphotyrosine residue in tyrosine kinase. This compound has been shown to inhibit the proliferation of cells that express this type of receptor and induce apoptosis. The x-ray structures of ligand binding to the receptor show a hydrogen bond network with the hydroxyl group at position 2, which is believed to be important for binding activity. The molecular modeling studies confirm that this interaction is energetically favorable, with a ΔΔG = -6.5 kcal/mol. H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-(OH) has also been found to have antiosteoporotic properties when administered orally in rats.</p>Formula:C66H97N12O24PPurity:Min. 95%Molecular weight:1,473.52 g/molH-Glu-bNA
CAS:<p>H-Glu-bNA is a synthetic peptide that has been shown to have aminopeptidase activity. H-Glu-bNA has been used as a marker for the presence of proteolytic bacteria in milk and cheese products. The enzyme hydrolyzes peptides at the carboxyl terminal end of amino acids, releasing them from protein molecules. It is also used to study the action of proteases on casein, which are enzymes that break down the proteins found in milk. The enzyme can be assayed in vitro using lactococci or other bacterial cells. This product is not intended for use as an antibiotic or antimicrobial agent and should not be taken internally.</p>Formula:C15H16N2O3Purity:Min. 95%Molecular weight:272.3 g/molTIPP
CAS:<p>TIPP is a peptide that belongs to the group of chemokines. It has been shown to have receptor binding activity and to stimulate the release of pro-inflammatory cytokines in cancer cells. TIPP interacts with membranes by forming hydrogen bonds with carbonyl groups and hydroxyl groups, which are located in the membrane. This results in a low energy barrier for intramolecular hydrogen transfer, making it a suitable candidate for drug design. TIPP also interacts with receptors, such as δ receptors, which may contribute to its anti-cancer properties.</p>Formula:C37H38N4O6Purity:Min. 95%Molecular weight:634.72 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS:<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>Formula:C22H38N4O3S2Purity:Min. 95%Molecular weight:470.69 g/molDABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formula:C61H76N12O14SPurity:Min. 95%Molecular weight:1,233.39 g/molH-Arg-4MbetaNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Arg-4MbetaNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O2·xHClPurity:Min. 95%Molecular weight:365.86 g/molH-Ala-Ala-Ala-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N5O5·HClPurity:Min. 95%Molecular weight:387.82 g/molH-Ser-Glu-OH
CAS:<p>H-Ser-Glu-OH is a carbohydrate. It has been shown to be involved in the diagnosis of pancreatic cancer by binding to the peptide transporter and inhibiting its function. H-Ser-Glu-OH binds to a number of chemotactic proteins that are involved in the inflammatory response. This interaction may lead to degranulation and lysosome release, which could cause an increase in cancer cells. The carbohydrate ligand on H-Ser-Glu-OH is acidic and has functional groups that allow it to interact with other molecules in a way that is not possible for monosaccharides.</p>Formula:C8H14N2O6Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:234.21 g/molH-Asp(Gly-OH)-OH
CAS:<p>Polymyxin B is a polycationic antibiotic that has been used in the treatment of infectious diseases and as an ophthalmic ointment. It is effective against bacteria, fungi, and parasites. Polymyxin B exhibits antimicrobial activity by binding to microbial membranes and causing lysis. The redox potential of this antibiotic is low, which can make it difficult for it to penetrate into cells. Oral cephalosporins are acidic drugs that are poorly absorbed from the gastrointestinal tract; they are only active in the distal small intestine and colon. Streptococcus faecalis is a bacterium that causes infections in the upper respiratory tract and urinary tract. Polymyxin B may be used as an oral agent to treat these infections because it does not require acidity for activity. This drug also exhibits anti-inflammatory effects through its ability to inhibit gamma-aminobutyric acid (GABA) synthesis in bowel cells, which leads to decreased inflammation.</p>Formula:C6H10N2O5Purity:Min. 95%Molecular weight:190.15 g/molUrotensin I
CAS:<p>Please enquire for more information about Urotensin I including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C210H340N62O67S2Purity:Min. 95%Molecular weight:4,869.46 g/molH-Gly-Ala-Hyp-OH
CAS:<p>Please enquire for more information about H-Gly-Ala-Hyp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17N3O5Purity:Min. 95%Molecular weight:259.26 g/molpTH (44-68) (human)
CAS:<p>Please enquire for more information about pTH (44-68) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H199N41O41Purity:Min. 95%Molecular weight:2,836.08 g/molFmoc-N-Me-D-Arg(Mtr)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H38N4O7SPurity:Min. 95%Molecular weight:622.73 g/molN-Boc-2-aminoacetaldehyde
CAS:<p>N-Boc-2-aminoacetaldehyde is an aliphatic aldehyde that has been used in the synthesis of a number of bioactive molecules. It is synthesized by reacting an N-Boc amino acid with chloroform and hydrochloric acid. The reaction time is typically 2 hours at room temperature, although it can be decreased to 20 minutes if the temperature is increased to 60°C. The product can be purified using extraction or recrystallization methods. N-Boc-2-aminoacetaldehyde reacts with chloride ions to form phosphoranes, which are useful in clinical development as antimicrobial peptides. This compound also reacts with fluorine to form hydrogenated derivatives that have been shown to have neurokinin activity in animal models.</p>Formula:C7H13NO3Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:159.18 g/molZ-His-Phe-OH
CAS:<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H24N4O5Purity:Min. 95%Molecular weight:436.46 g/molH-Arg-Gly-OH·HCl
CAS:<p>Please enquire for more information about H-Arg-Gly-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H17N5O3·HClPurity:Min. 95%Molecular weight:267.71 g/molH-β-Ala-Gly-OH
CAS:<p>H-beta-Ala-Gly-OH is a monoclinic crystalline compound. It is soluble in water and slightly soluble in ethanol, acetone, and benzene. The solubility of this compound depends on the pH of the solution as well as the presence of glycine. H-beta-Ala-Gly-OH has an upfield shift when protonated, making it useful for analytical purposes. This compound can be used to prepare glycine methyl ester by reacting with methanol or hydrochloric acid.</p>Formula:C5H10N2O3Purity:Min. 95%Molecular weight:146.14 g/molCholecystokinin Octapeptide (1-4) (sulfated)
CAS:<p>Please enquire for more information about Cholecystokinin Octapeptide (1-4) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H28N4O11S2Purity:Min. 95%Molecular weight:564.59 g/mol2-Methyl-3-(3,4-methylenediOxyphenyl)prOpanal
CAS:Controlled Product<p>2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde (2MMPP) is a minor constituent of piperonal. It has been shown to be a potent inhibitor of intracellular calcium levels in humans and rat prostate cancer cells. The mechanism of action is thought to be through an interaction with fatty acid receptors and alterations in cytosolic calcium levels. 2MMPP has been found to act as an odorant binding agent that binds to the olfactory receptor OR5AN1 and alters its function. 2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde has also been shown to have high electrochemical impedance spectroscopy values, which may indicate its ability to remove organic contaminants from wastewater treatment systems.</p>Formula:C11H12O3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:192.21 g/molH-Thr-Ser-OH
CAS:<p>H-Thr-Ser-OH is a synthetic peptide that contains the amino acid sequence H-Thr-Ser-OH. It has been shown to have antitumor activity and antiangiogenic properties. This peptide was observed to destabilize protonated lysine residues in the tumor cell membrane, leading to increased permeability of the membrane and subsequent leakage of ions and water. The resulting cytotoxic environment leads to cancer cell death by apoptosis. HTSOH also inhibits tumor angiogenesis by inhibiting vascular endothelial growth factor (VEGF) production. HTSOH is stable at physiological pH and has been crystallized with a resolution of 1.5 Å.</p>Formula:C7H14N2O5Purity:Min. 95%Molecular weight:206.2 g/molAc-Gly-Ala-Lys-AMC trifluoroacetate salt
<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H31N5O6Purity:Min. 95%Molecular weight:473.52 g/molH-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Methylcyclohex-2-en-1-one
CAS:<p>3-Methylcyclohex-2-en-1-one is a chemical compound that is used in the synthesis of pharmaceuticals, pesticides, and other organic compounds. It has been shown to be effective against Dendroctonus species and other pests. 3-Methylcyclohex-2-en-1-one is synthesized from cyclohexanone by hydrogenation of the double bond at the 3 position. The reaction can be catalyzed by palladium complexes with acid complexing ligands, such as phosphines or amines. The product is then purified by distillation, crystallization, or recrystallization.</p>Formula:C7H10OPurity:Min. 95%Molecular weight:110.15 g/molFmoc-Lys(N3)-OH
CAS:<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>Formula:C21H22N4O4Purity:Min. 95%Molecular weight:394.42 g/molTIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H189N33O35S3Purity:Min. 95%Molecular weight:2,882.3 g/molN-α-Fmoc-N-δ-Boc-D-ornithine
CAS:<p>N-alpha-Fmoc-N-delta-Boc-D-ornithine (NFDO) is an antibiotic that belongs to the group of macrocyclic, cyclic antibiotics. This drug has antibacterial activity against gram-negative pathogens and is most effective against E. coli. NFDO is synthesized by a solid phase synthesis that occurs in two stages: first, FMOC protected amino acids are coupled to the resin and then deprotection is carried out with piperidine in DMF at room temperature. The final product is obtained by cleavage of the peptide from the resin with trifluoroacetic acid and purification by HPLC.</p>Formula:C25H30N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:454.52 g/molACTH (18-39) (human)
CAS:<p>ACTH is a polypeptide hormone that regulates the release of cortisol from the adrenal cortex. ACTH (18-39) is a fragment of ACTH which binds to the glucocorticoid receptor with high affinity. The carboxy terminal sequence of ACTH (18-39) is identical to that of human ACTH and can be used as an immunogen to produce monoclonal antibodies against ACTH. The monoclonal antibodies can then be used in prognostic studies for patients with congestive heart failure, diabetic neuropathy, or k562 cells. ACTH (18-39) has an optimum pH level of 7.0 and can bind to cellular receptors at physiological concentrations. It also has a molecular weight of 4,000 Daltons and is soluble in trifluoroacetic acid and hydrogen fluoride, but not in water or methanol.</p>Formula:C112H165N27O36Purity:Min. 95%Molecular weight:2,465.67 g/molH-Pro-His-Leu-OH
CAS:<p>H-Pro-His-Leu-OH is a tripeptide with a sequence of L-proline, H-histidine, and D-leucine. It is an experimental substrate for peptide transporters and has been shown to be taken up by E. coli. This peptide is specific for Borrelia burgdorferi, the organism that causes Lyme disease.</p>Formula:C17H27N5O4Purity:Min. 95%Molecular weight:365.43 g/mol(H-Cys-Phe-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-Phe-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30N4O6S2Purity:Min. 95%Molecular weight:534.65 g/molAc-Trp-Glu-His-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Trp-Glu-His-Asp-aldehyde is a tetrapeptide that has been shown to inhibit the activity of caspases. Caspases are proteases that play an important role in cell death by inducing apoptosis and necrosis. The structure of the Ac-Trp-Glu-His-Asp-aldehyde was determined by X-ray crystallography, revealing a hydrophobic molecule with a pseudo acid residue. This compound binds to peptides and blocks the binding site for caspase substrates, which prevents their activation. Acetylation of this compound also increases its hydrophobicity, making it more likely to bind to other molecules such as proteins or lipids.</p>Formula:C28H33N7O9Purity:Min. 95%Molecular weight:611.6 g/molZ-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone
<p>Please enquire for more information about Z-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H46FN5O11Purity:Min. 95%Molecular weight:695.73 g/mol(Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H231N45O41Purity:Min. 95%Molecular weight:3,188.6 g/molAc-Glu-Glu-Val-Val-Ala-Cys-pNA
CAS:<p>Please enquire for more information about Ac-Glu-Glu-Val-Val-Ala-Cys-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H50N8O13SPurity:Min. 95%Molecular weight:810.87 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H129N25O25SPurity:Min. 95%Molecular weight:2,005.22 g/molCyclo(-Glu-Glu)
CAS:<p>Please enquire for more information about Cyclo(-Glu-Glu) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N2O6Purity:Min. 95%Molecular weight:258.23 g/molAnti-Inflammatory Peptide 3
CAS:<p>Anti-Inflammatory Peptide 3 (AIP3) is a peptide that contains an ester linkages and a carboxylic ester, which are both hydrophobic. The amino acid sequence of AIP3 is H-Met-Gln-Met-Asn-Lys-Val-Leu-Asp-Ser. AIP3 has been shown to have antiinflammatory properties and can be used as a diagnostic tool for inflammation. This peptide also has prodrug properties and can be conjugated with drugs to form drug linkers.</p>Formula:C43H76N12O15S2Purity:Min. 95%Molecular weight:1,065.27 g/molFmoc-Thr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H109N23O18SPurity:Min. 95%Molecular weight:1,628.86 g/molH-Lys-Gly-Trp-Lys-OtBu acetate salt
CAS:<p>The acetate salt of H-Lys-Gly-Trp-Lys is a peptide that has been modified with an acetyl group. The acetate salt is neutral and does not react with other compounds. This compound is a superoxide scavenger and can be used to prevent the formation of reactive oxygen species in biological systems.</p>Formula:C29H47N7O5Purity:Min. 95%Molecular weight:573.73 g/molBoc-D-Glu-OEt·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO6·C12H23NPurity:Min. 95%Molecular weight:456.62 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H294N54O56Purity:Min. 95%Molecular weight:4,278.74 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C61H83N15O10Purity:Min. 95%Molecular weight:1,186.41 g/molH-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
CAS:<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>Formula:C29H54N8O10Purity:Min. 95%Molecular weight:674.79 g/molAnti-Inflammatory Peptide 1
CAS:<p>Anti-Inflammatory Peptide 1 is a peptide that has been shown to have anti-inflammatory properties. It is synthesized from H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, with the hydroxyl group linked by an ester bond to the N terminal of the peptide. Antiinflammatory peptides can be used as potential biomarkers for inflammatory diseases or as a treatment for these diseases.</p>Formula:C45H82N12O14S2Purity:Min. 95%Molecular weight:1,079.34 g/molFmoc-Gly-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Gly-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H24N2O6Purity:Min. 95%Molecular weight:424.45 g/mol4-Methylsulphonylaniline
CAS:<p>4-Methylsulphonylaniline is a reactive compound that can be used as an anticancer agent. It is a quinoline derivative and has been found to have potent antitumor activity against various cancer cell lines, including those resistant to other anticancer agents. The activation energy of this compound is high at 93 kcal/mol and it has been found to react with dimethylformamide (DMF) in the reaction mechanism. 4-Methylsulphonylaniline has also been shown to inhibit the growth of tumor cells in mice by inhibiting DNA synthesis. This molecule also causes DNA damage in cultured cells. 4-Methylsulphonylaniline may also cause environmental pollution because it reacts with sulfadiazine, which is a drug used for the treatment of chronic infections caused by bacteria such as Salmonella typhi and Mycobacterium tuberculosis, leading to the release of methyl sulfone, which can be toxic to aquatic</p>Formula:C7H9NO2SPurity:Min. 95%Molecular weight:171.22 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H125N27O29Purity:Min. 95%Molecular weight:2,001.08 g/mol1-Methylbiguanide sulfate
CAS:<p>Please enquire for more information about 1-Methylbiguanide sulfate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C4H8N8H2SO4Purity:Min. 95%Molecular weight:266.24 g/mol(Met(O)35)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O61SPurity:Min. 95%Molecular weight:4,530.04 g/molH-Met-Met-Met-OH
CAS:<p>H-Met-Met-Met-OH is a synthetic, antifungal drug that inhibits the synthesis of fatty acids. It has been shown to inhibit the growth of E coli K-12, which is responsible for the production of toxic substances in the intestine. H-Met-Met-Met-OH inhibits peptidase activity and fatty acid synthesis by competing with other substrates for uptake into the cell. H-Met-Met-Met-OH also inhibits sugar transport, leading to a decrease in glycolysis and energy production. The drug has been used in clinical trials against Candida albicans and Cryptococcus neoformans.</p>Formula:C15H29N3O4S3Purity:Min. 95%Molecular weight:411.61 g/molZ-D-Orn (Z)-OH
CAS:<p>Please enquire for more information about Z-D-Orn (Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H24N2O6Purity:Min. 95%Molecular weight:400.43 g/molAc-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2
CAS:<p>Please enquire for more information about Ac-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N7O6Purity:Min. 95%Molecular weight:842.04 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C65H93N15O26Purity:Min. 95%Molecular weight:1,500.52 g/molAnti-Kentsin trifluoroacetate salt
CAS:<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H45N11O6Purity:Min. 95%Molecular weight:559.66 g/molAmyloid β-Protein (1-46)
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-46) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C223H347N59O65SPurity:Min. 95%Molecular weight:4,926.57 g/molNeurokinin B trifluoroacetate salt
CAS:<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br><br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>Formula:C55H79N13O14S2Purity:Min. 95%Molecular weight:1,210.43 g/molFA-Lys-Ala-OH
CAS:<p>FA-Lys-Ala-OH is a mutant enzyme that has an expressed constitutive mutation. It is a mutational variant of the wild type enzyme with an additive kinetic effect. The kinetic constants for this mutant were determined and correlated to determine the determinants of the mutations. This mutant has uncharged substitutions in its carboxypeptidase B active site, which changes its pH optimum from acidic to neutral values.</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molTRAP-5 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H51N9O6Purity:Min. 95%Molecular weight:633.78 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N5O5·HClPurity:Min. 95%Molecular weight:534.05 g/molCoagulation Factor XIIIa (190-230)
CAS:Controlled Product<p>Please enquire for more information about Coagulation Factor XIIIa (190-230) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C220H322N54O73Purity:Min. 95%Molecular weight:4,891.23 g/mol(Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken)
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H72N16O12Purity:Min. 95%Molecular weight:1,221.33 g/molBoc-D-Ala-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-D-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Leu-Leu-Leu-Phe-OMe·HCl
CAS:<p>Please enquire for more information about H-Leu-Leu-Leu-Phe-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H46N4O5·HClPurity:Min. 95%Molecular weight:555.15 g/molBz-Arg-OMe carbonate salt
CAS:<p>Bz-Arg-OMe carbonate salt is a protease inhibitor that binds to the active site of serine proteases, inhibiting their activity. Bz-Arg-OMe carbonate salt has been shown to have inhibitory effects on Leishmania, a protozoan parasite. It is also an inhibitor of fibrinolysis, which may be due to its ability to bind calcium ions and serum albumin. Bz-Arg-OMe carbonate salt has affinity for carbohydrates and interacts with peptides.</p>Formula:C14H20N4O3Purity:Min. 95%Molecular weight:292.33 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C141H235N47O41·xC2H4O2Purity:Min. 95%Molecular weight:3,244.67 g/molAc-Trp-NHMe
CAS:<p>Ac-Trp-NHMe is a hydrogen bond acceptor, which is a functional group that can form hydrogen bonds with other molecules. It is found in proteins and has been extensively studied by protein data bank. The amide group of Ac-Trp-NHMe forms a hydrogen bond with the carbonyl group of the amino acid tryptophan. The molecule has been used as a model system for studying the fluorescence properties of tryptophan, and to understand vibrational spectra. Ac-Trp-NHMe has also been shown to be an important chemical in plants, where it is involved in the formation of the dry weight of plants and water molecules.</p>Formula:C14H17N3O2Purity:Min. 95%Molecular weight:259.3 g/molZ-Ala-Pro-pNA
CAS:<p>Z-Ala-Pro-pNA is a serine protease that cleaves peptide bonds in proteins. It has been shown to be active against a number of organisms, including Pyrococcus furiosus and Porcine pancreatic extracts, as well as specificities such as amino acid residues and oligopeptidases. Z-Ala-Pro-pNA may have uses in the food industry by acting on proteins that are found in meat products.</p>Formula:C22H24N4O6Purity:Min. 95%Molecular weight:440.45 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS:<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Molecular weight:208.07 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molH-Gly-Arg-Gly-Asp-OH
CAS:<p>H-Gly-Arg-Gly-Asp-OH is a cyclic peptide with the amino acid sequence of Gly-Arg-Gly-Asp. It has been shown to promote bone formation and inhibit bone resorption in vitro by stimulating the release of growth factors. This peptide can be used as a diagnostic agent for monitoring cell culture, which may be due to its ability to bind monoclonal antibodies. H-Gly-Arg-Gly-Asp-OH also has the ability to form conjugates with polymerase chain reaction (PCR) probes or other biomolecules. These conjugates can be used for detecting specific DNA sequences, such as those found in mammalian cells.</p>Formula:C14H25N7O7Purity:Min. 95%Molecular weight:403.39 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molMethyltetrazine amine
CAS:<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>Formula:C10H11N5Purity:Min. 95%Color and Shape:PowderMolecular weight:201.23 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C54H85N19O13Purity:Min. 95%Molecular weight:1,208.37 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/molH-Tyr-AMC·TFA
CAS:<p>Please enquire for more information about H-Tyr-AMC·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H18N2O4·C2HF3O2Purity:Min. 95%Molecular weight:452.38 g/molBoc-Ala-Gly-OSu
CAS:<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N3O7Purity:Min. 95%Molecular weight:343.33 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molFGF acidic I (102-111) (bovine brain)
CAS:<p>Please enquire for more information about FGF acidic I (102-111) (bovine brain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H82N16O13Purity:Min. 95%Molecular weight:1,223.38 g/molPmc-S-methylisothiourea
CAS:<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Formula:C16H24N2O3S2Purity:Min. 95%Color and Shape:PowderMolecular weight:356.51 g/mol1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>Formula:C28H56NO7PPurity:Min. 95%Molecular weight:549.72 g/molZ-Gly-Pro-pNA
CAS:<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>Formula:C21H22N4O6Purity:Min. 95%Molecular weight:426.42 g/mol(D-Arg1,D-Phe5,D-Trp7·9,Leu11)-Substance P
CAS:<p>Substance P is a neuropeptide that binds to the tachykinin receptor NK1. It has potent anti-inflammatory and mitogenic activities, which are mediated through its binding to the NK1 receptor. Substance P can stimulate lung cancer cells to proliferate and inhibit their apoptosis, which may be due to an autocrine mechanism. In addition, it has been shown that substance P can potentiate the growth of some cancers such as colon cancer in vitro and in vivo by increasing DNA synthesis and cell proliferation. This peptide also has a dose-dependent effect on cell growth, with high doses inhibiting cell proliferation at higher levels than low doses.</p>Formula:C79H109N19O12Purity:Min. 95%Molecular weight:1,516.83 g/molZ-His-p-nitro-Phe-Phe-OMe
CAS:<p>Please enquire for more information about Z-His-p-nitro-Phe-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H34N6O8Purity:Min. 95%Molecular weight:642.66 g/molPyr-Phe-Leu-pNA
CAS:<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>Formula:C26H31N5O6Purity:Min. 95%Molecular weight:509.55 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/molFmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Neuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molH-Gly-Phe-bNA
CAS:<p>H-Gly-Phe-bNA is a dinucleotide phosphate that is activated by phosphatase to form an active nucleotide. This nucleotide inhibits the polymerase chain reaction (PCR) by binding to the template DNA strand and preventing the addition of nucleotides by the DNA polymerase. The monoclonal antibody recognizes H-Gly-Phe-bNA and binds it in a radioactive assay, inhibiting the activity of this dinucleotide phosphate. Radiation causes H-Gly-Phe-bNA to produce reactive oxygen species, which can induce DNA damage or cause cell death. This nucleotide also has an acidic pH optimum for its activity, making it useful in acidic environments such as lysosomes. H-Gly-Phe-bNA also binds to cation channels and is localized primarily in the cytosol, with some found in mitochondria or microsomes. It also has a high affinity for calcium ions</p>Formula:C21H21N3O2Purity:Min. 95%Molecular weight:347.41 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/molSpexin trifluoroacetate salt
CAS:<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O19SPurity:Min. 95%Molecular weight:1,619.89 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>Formula:C11H16ClNO3Purity:Min. 95%Color and Shape:White to off white solid.Molecular weight:245.7 g/molNα-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide
CAS:<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>Formula:C12H15FN4O5Purity:Min. 95%Color and Shape:Off-White To Yellow SolidMolecular weight:314.27 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Formula:C23H38N6O5·2HClPurity:Min. 95%Molecular weight:551.51 g/molL-Cysteine hydrochloride anhydrous
CAS:<p>L-Cysteine hydrochloride anhydrous is an amino acid that is used in the treatment of bowel disease. It is also a precursor for glutathione, which has antioxidant properties and helps maintain iron homeostasis. L-Cysteine hydrochloride anhydrous has been shown to inhibit the oxidation of proteins by reacting with reactive oxygen species (ROS) such as nitric oxide, superoxide, and hydrogen peroxide. This amino acid also interacts with toll-like receptor 4 (TLR4), which may account for its natural anti-inflammatory properties. L-Cysteine hydrochloride anhydrous can be synthesized from cysteine and glutamic acid using a CDNA clone encoding the enzyme cystathionine β-synthase. The synthesis of this amino acid requires a number of biochemical reactions including hydrogen bonding interactions with inhibitor molecules such as dihydrofolate reductase, metalloproteases, and thiored</p>Formula:C3H7NO2S·HClColor and Shape:White Off-White PowderMolecular weight:157.62 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>Formula:C23H34N6O9Purity:Min. 95%Molecular weight:538.55 g/molH-Asp-Phe-NH2
CAS:<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>Formula:C13H17N3O4Purity:Min. 95%Molecular weight:279.29 g/molFmoc-b-Ala-Phe-Pro-OH
<p>Fmoc-b-Ala-Phe-Pro-OH is a chemical compound that is used as a reaction component, reagent, and useful scaffold. It reacts with various other chemicals to form complex compounds. This synthetic compound can be used as an intermediate in the synthesis of peptides, proteins, and other organic compounds. Fmoc-b-Ala-Phe-Pro-OH can also be used as a building block for the synthesis of speciality chemicals.</p>Formula:C32H33N3O6Purity:Min. 95%Color and Shape:PowderMolecular weight:555.62 g/mol4-Methoxybenzylboronic acid pinacolester
CAS:<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21BO3Purity:Min. 95%Molecular weight:248.13 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H84N20O13Purity:Min. 95%Molecular weight:1,329.47 g/mol(2S,3S)-(-)-3-Amino-2-phenylpiperidine
CAS:<p>The process of asymmetric epoxidation is used to convert alkenes into epoxides in a single step. This reaction is catalyzed by the use of a chiral catalyst with an enantiomeric excess (ee) greater than 50%. The reactants are added to the catalyst and hydrogen peroxide, which oxidizes the alkenes. The resulting epoxides can be isolated from the reaction mixture by distillation or extraction. Factors that affect this reaction include the type of reactant, solvent, temperature, and pressure.</p>Formula:C11H16N2Purity:Min. 95%Molecular weight:176.26 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/mol(D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H79N13O12Purity:Min. 95%Molecular weight:1,210.38 g/molH-Ala-Abu-OH
CAS:<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H14N2O3Purity:Min. 90%Color and Shape:PowderMolecular weight:174.2 g/molZ-Thr(tBu)-OSu
CAS:<p>Please enquire for more information about Z-Thr(tBu)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N2O7Purity:Min. 95%Molecular weight:406.43 g/molH-His-Ser-OH
CAS:<p>H-His-Ser-OH is a type of histidine with a hydroxyl group at the 3' position. It is an amino acid found in proteins and natural products. H-His-Ser-OH has been shown to be a synthetic substrate for the production of monoclonal antibodies, which are used as therapeutic agents in cancer treatment. The metabolic disorders that affect H-His-Ser-OH include human serum albumin and hemoglobinuria. This amino acid also plays a role in cervical cancer, neutral pH, and amide bonds. H-His-Ser-OH is also known to be a growth factor and has been linked to autoimmune diseases, site specific phosphorylation, and peptide hormones.br>br>br></p>Formula:C9H14N4O4Purity:Min. 95%Molecular weight:242.23 g/molH-Arg-D-Asp-OH
CAS:<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N5O5Purity:Min. 95%Molecular weight:289.29 g/molBoc-Ser(Ile-Fmoc)-OH
CAS:<p>Boc-Ser(Ile-Fmoc)-OH is a peptide synthesis reagent that can be used for the efficient and convenient preparation of peptides. It is a synthetic, non-natural amino acid that has been synthesized by the chemists at Pfizer. Boc-Ser(Ile-Fmoc)-OH is an epimer of natural L-serine and has been shown to be more soluble than L-serine making it easier to work with. This reagent can also be used in the synthesis of biomolecules such as proteins and nucleic acids. The chemistry behind this compound has been published in the journal Biomolecular Chemistry.</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/molL-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide
CAS:<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>Formula:C19H31N3O6Purity:Min. 95%Molecular weight:397.47 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/molL-Arginine
CAS:<p>Please enquire for more information about L-Arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H14N4O2Color and Shape:White PowderMolecular weight:174.2 g/molFmoc-α-Me-Lys(Boc)-OH
CAS:<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>Formula:C27H34N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:482.57 g/molAc-DL-Lys(Ac)-OH
CAS:<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N2O4Purity:Min. 95%Molecular weight:230.26 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C215H355N63O54SPurity:Min. 95%Molecular weight:4,718.58 g/molBoc-Asp(OBzl)-chloromethylketone
CAS:<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>Formula:C17H22ClNO5Purity:Min. 95%Molecular weight:355.81 g/molFmoc-Val-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H34N2O7SPurity:Min. 95%Color and Shape:PowderMolecular weight:590.69 g/molH-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH
CAS:<p>Please enquire for more information about H-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H164N32O27SPurity:Min. 95%Molecular weight:2,530.86 g/molAcetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH
CAS:<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N17O15Purity:Min. 95%Molecular weight:1,338.51 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/molH-Lys-Thr-OH hydrochloride salt
CAS:<p>H-Lys-Thr-OH hydrochloride salt is a synthetic amino acid that has been used in the synthesis of a cyclic peptide. The synthesis was achieved by metathesis reactions, which involved the reaction of an acid chloride with a chiral amine to form an ester. H-Lys-Thr-OH hydrochloride salt has been shown to have high binding constants to its targets and can be used as a selective reagent for the synthesis of virus proteins. It is also able to bind to carboxylate groups, which are common in wild type viruses and gene products. This reagent also has cleavage products, which can be used for efficient method for synthesizing cyclic peptides.</p>Formula:C10H21N3O4Purity:Min. 95%Molecular weight:247.29 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H85FN16O13Purity:Min. 95%Molecular weight:1,365.51 g/mol2-Chloro-6-methoxypyridine
CAS:<p>2-Chloro-6-methoxypyridine (2CMP) is a potent antagonist that binds to copper chloride, inhibiting its ability to activate aryl chlorides. This chemical has been shown to have anti-angiogenic effects in human cancer cells and can be used for the treatment of cancer. 2CMP has also been shown to be effective at blocking angiogenesis in mice with breast cancer. 2CMP is synthesized through an asymmetric synthesis process, which involves the use of a dipole and molecular docking analysis.</p>Formula:C6H6ClNOPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:143.57 g/molHSV-1-amide UL 26 Open Reading Frame (242-255)
CAS:<p>Please enquire for more information about HSV-1-amide UL 26 Open Reading Frame (242-255) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H117N21O20SPurity:Min. 95%Molecular weight:1,724.98 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H229N45O37Purity:Min. 95%Molecular weight:3,050.52 g/molH-Ala-Ala-pNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Ala-Ala-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N4O4Purity:Min. 95%Molecular weight:280.28 g/molAc-Thr-Leu-Asn-Phe-OH
CAS:<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>Formula:C25H37N5O8Purity:Min. 95%Molecular weight:535.59 g/molNFAT Inhibitor trifluoroacetate salt
CAS:<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>Formula:C75H118N20O22SPurity:Min. 95%Molecular weight:1,683.93 g/molNeuropeptide FF (5-8) acetate salt
CAS:<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H39N9O5Purity:Min. 95%Molecular weight:545.63 g/molFmoc-Ala-(Dmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Ala-(Dmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N2O7Purity:Min. 95%Molecular weight:518.56 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/mol(Des-Gly10,His(Bzl)6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,His(Bzl)6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molH-Pro-Leu-Gly-NHOH·HCl
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-NHOH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N4O4·HClPurity:Min. 95%Molecular weight:336.81 g/molH-2,6-Difluoro-Phe-OH·HCl
CAS:<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H9F2NO2·HClPurity:Min. 95%Molecular weight:237.63 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt
CAS:<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47·xC2H4O2Purity:Min. 95%Molecular weight:3,355.67 g/molSuc-Ala-Lys-Pro-Phe-pNA
CAS:<p>Suc-Ala-Lys-Pro-Phe-pNA is a casein that has been modified to contain additional lysine residues. This modification increases the protein’s stability, making it more resistant to hydrolysis by phosphatases. Suc-Ala-Lys-Pro-Phe-pNA also contains a peptide sequence that is homologous to a part of the endoplasmic reticulum chaperone FK506 binding protein (FKBP). The peptide sequence in this casein acts as an artificial chaperone and can be used in cell culture experiments to stabilize newly synthesized proteins.</p>Formula:C33H43N7O9Purity:Min. 95%Molecular weight:681.74 g/molH-D-Leu-D-Leu-OH
CAS:<p>H-D-Leu-D-Leu-OH is a type of molecule that can be found in the human body. It is an amino acid with specificities and transport mechanisms that are not yet well understood. This compound is resistant to aminopeptidase activity and has been shown to have a ph optimum in the intestinal tract. Acetylation of this molecule may also have an effect on its transport rate, as it has been shown to affect the transport rate of D-tryptophan and D-alanine. H-D-Leu-D-Leu-OH is a type of molecule that can be found in the human body. It is an amino acid with specificities and transport mechanisms that are not yet well understood. This compound is resistant to aminopeptidase activity and has been shown to have a ph optimum in the intestinal tract. Acetylation of this molecule may also have an effect on its transport rate, as</p>Formula:C12H24N2O3Purity:Min. 95%Molecular weight:244.33 g/molThr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
CAS:<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>Formula:C145H234N52O44S3Purity:Min. 95%Molecular weight:3,505.93 g/molDynorphin A (1-9)
CAS:<p>Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-OH is a substrate binding inhibitor that blocks potassium channels. Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu Arg Arg Ile Arg OH binds to the d -alanine site of the potassium channel and inhibits glutamate release from presynaptic terminals. Dynorphin A (1 9) H Tyr Gly Gly Phe Leu Arg Arg Ile Arg OH has been shown to be a potent inhibitor of aminopeptidase activity in vitro, which may be due to its affinity for the substrate binding site on the enzyme. Its inhibition of aminopeptidase activity may lead to an increase in opioid peptides such as dynorphins and enkephalins. Dynorphin A (1 9) H Tyr Gly Gly Phe</p>Formula:C52H84N18O11Purity:Min. 95%Molecular weight:1,137.34 g/molH-Met-His-OH
CAS:<p>H-Met-His-OH is a metabolite of methionine, which has been shown to have insulin sensitizing effects. H-Met-His-OH is produced from the reaction of methionine with hydrochloric acid and water molecule. This compound has been shown to modulate glucose metabolism by increasing insulin sensitivity in diabetic rats. It has also been shown to be able to increase estradiol levels in female mice, which may be due to its ability to inhibit protein synthesis. H-Met-His-OH also binds to histidine residues on the protein surface and may regulate protein kinetics via an unidentate mechanism.</p>Formula:C11H18N4O3SPurity:Min. 95%Molecular weight:286.35 g/molZ-Tyr-Tyr-OH
CAS:<p>Please enquire for more information about Z-Tyr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H26N2O7Purity:Min. 95%Molecular weight:478.49 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molPhylloseptin-L2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H126N18O19Purity:Min. 95%Molecular weight:1,595.92 g/molZ-Gly-Ile-OH
CAS:<p>Please enquire for more information about Z-Gly-Ile-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molH-Leu-Gly-bNA
CAS:<p>H-Leu-Gly-bNA is a chromogenic, dipeptide, which has been shown to react with 2-naphthylamine in the presence of condensation agents and carboxylic acid to form a carboxy group. The amino group on the terminal Leu residue reacts with the carboxy group to form an amide bond. This reaction is used as a method for detecting bNA.</p>Formula:C18H23N3O2Purity:Min. 95%Molecular weight:313.39 g/molAngiotensin I/II (4-8)
CAS:<p>Angiotensin I/II (4-8) H-Tyr-Ile-His-Pro-Phe-OH is a peptide that contains the sequence of angiotensin I and II. It has been shown to have proton transport properties, which may be related to its sequence. The amino acid sequence of this peptide is similar to other pentapeptides such as insulin and vasopressin. This peptide has been linked to a vector that can cross the blood brain barrier, allowing it to act on the central nervous system.</p>Formula:C35H45N7O7Purity:Min. 95%Molecular weight:675.77 g/molFmoc-Pro-Pro-Pro-Pro-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-Pro-Pro-Pro-Pro-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H47N5O8Purity:Min. 95%Molecular weight:725.83 g/molFmoc-Met-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Met-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Arg(Mtr)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Arg(Mtr)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-4-(7-hydroxy-4-coumarinyl)-Abu-OH
CAS:<p>Please enquire for more information about Fmoc-4-(7-hydroxy-4-coumarinyl)-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H23NO7Purity:Min. 95%Molecular weight:485.48 g/mol(Cys8·13)-Dynorphin A (1-13) amide
CAS:<p>Please enquire for more information about (Cys8·13)-Dynorphin A (1-13) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H112N24O14S2Purity:Min. 95%Molecular weight:1,565.91 g/mol3,5-Diiodo-L-tyrosine
CAS:<p>3,5-Diiodo-L-tyrosine (3DILT) is an iodinated amino acid that can be used as a marker for human immunodeficiency virus (HIV) infection. It is synthesized by the reaction of 3,5-diiodotyrosine with L-tyrosine in the presence of a metal chelate and dinucleotide phosphate. This reaction proceeds via nucleophilic substitution on the aromatic ring with an iodide ion. The product is then purified to remove unreacted 3,5-diiodotyrosine and the metal chelate. 3DILT reacts with antibodies in a luminescence immunoassay to produce light that can be detected. The detection limit of this assay is 10 pg/mL.</p>Formula:C9H9I2NO3Purity:Min. 95%Molecular weight:432.98 g/mol
