
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,451 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38234 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Gly-D-Gln-OH
CAS:<p>H-Gly-D-Gln-OH is a chiral molecule that has been used to identify the presence of cholinergic receptors in ventricular myocytes. It is a substrate for the enzyme acetylcholinesterase, which breaks down acetylcholine, an important neurotransmitter. H-Gly-D-Gln-OH binds to nicotinic and muscarinic acetylcholine receptor sites in cardiac muscle cells and can be detected in platelet membranes after injection. The dose of H-Gly-D-Gln-OH that is injected into mice will depend on the animal's weight.</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/molAc-Lys-Gln-Leu-Arg-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Lys-Gln-Leu-Arg-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51F3N10O8Purity:Min. 95%Molecular weight:796.84 g/molCrustacean Cardioactive Peptide
CAS:<p>Crustacean Cardioactive Peptide H-Pro-Phe-Cys-Asn-Ala-Phe-Thr-Gly-Cys-NH2 (Disulfide bond) is a peptide that has been shown to have cardiac and locomotor activity. It also has receptor activity, which is likely due to the presence of an alpha helix in the structure. Crustacean Cardioactive Peptide H-Pro-Phe-Cys-Asn-Ala-Phe-Thr-Gly-Cys (Disulfide bond) has been shown to inhibit voltage dependent calcium channels and stimulate ryanodine receptors. This peptide has been used as a model system for studying heart function, including its effects on cardiac muscle cells, neurons, and biochemical properties.</p>Formula:C42H57N11O11S2Purity:Min. 95%Molecular weight:956.1 g/mol(D-Phe6,Leu-NHEt 13,des-Met14)-Bombesin (6-14) trifluoroacetate salt
CAS:<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>Formula:C49H69N13O9Purity:Min. 95%Molecular weight:984.15 g/mol2-Phenylacetamide
CAS:Controlled Product<p>2-Phenylacetamide is a nitro, acetate extract that has been shown to have antimicrobial activity. It can inhibit HIV infection and has been investigated as an antiviral drug. 2-Phenylacetamide binds to the 2-adrenergic receptor, which is found in high concentrations in the brain and inhibits the release of neurotransmitters. It also binds to κ-opioid receptors and sodium carbonate, which are found on cells throughout the body. The biological properties of this substance have not been fully elucidated but some studies suggest that it may be able to inhibit microbial metabolism or stimulate monoamine neurotransmitters.</p>Formula:C8H9NOPurity:Min. 95%Color and Shape:White PowderMolecular weight:135.16 g/molBoc-Ala-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about Boc-Ala-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H24N4O7Purity:Min. 95%Molecular weight:360.36 g/mol(D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molH-Gly-Gly-Sar-OH
CAS:<p>Gly-Gly-Sar is a synthetic peptide that acts as a substrate for the peptide transporter, which is part of the membrane of cells. It is an amide with a reactive group that can form a ternary complex with two hydroxyl ions and one proton. Gly-Gly-Sar has been shown to be taken up by caco-2 cells in an extravesicular manner and undergoes proteolysis by peptidases. This leads to bond cleavage and formation of free Gly-Gly and Sar. The free Gly and Gly are then transported across the cell membrane into the cell cytoplasm, where they are hydroxylated by enzymes such as glycyl-l-leucine hydroxylase to form glycolic acid and glyoxylic acid, respectively.</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/molLys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin
CAS:<p>Please enquire for more information about Lys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N19O14S2Purity:Min. 95%Molecular weight:1,394.67 g/molBoc-S-tert-butylthio-L-cysteine
CAS:<p>Boc-S-tert-butylthio-L-cysteine is a di-sulfide linked cysteine</p>Formula:C12H23NO4S2Purity:Min. 95%Molecular weight:309.45 g/molGalanin (1-13)-Spantide I
CAS:<p>Spantide I is a peptide that is a member of the Galanin family. It has been shown to have a proliferative effect on retinal cells in vitro, and may be effective in treating diabetic retinopathy. Spantide I also inhibits the production of pancreatic enzymes and choroidal neovascularization. It is a diagnostic marker for cancer and other diseases, as well as being used in the treatment of hepatitis. The sequences for Spantide I are GG-S-P-A-N-T-I-D-E--I--H--Gly--Trp--Thr--Leu--Asn--Ser--Ala--Gly--Tyr--Leu--Leu---Gly---Pro---D----Arg---Pro-----Lys---Pro-------Gln-------D------Trp------Phe------D------Trp------Leu-------Leu-----NH2</p>Formula:C138H199N35O30Purity:Min. 95%Molecular weight:2,828.27 g/mol1-(4-Acetylphenyl)-2-methyl-1-propanone
CAS:<p>1-(4-Acetylphenyl)-2-methyl-1-propanone (AMP) is a synthetic analgesic that has been evaluated for the treatment of pain. It is primarily used in pharmaceuticals and medicinal preparations, as well as being a common solvent in chemical syntheses. AMP has been shown to be an effective treatment for joint pain, muscle pain, and other types of pain. The mechanism of action for this compound is unknown but may involve the inhibition of an enzyme called hydratropic acid group. This molecule also has a carboxylic acid group that undergoes detoxification through elemental analysis or mechanochemistry.</p>Formula:C12H14O2Purity:Min. 95%Molecular weight:190.24 g/molH-Gly-Lys-OH·HCl
CAS:<p>Please enquire for more information about H-Gly-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H17N3O3·HClPurity:Min. 95%Molecular weight:239.7 g/molcis-4-Hydroxy-D-proline
CAS:<p>Cis-4-Hydroxy-D-proline is a metabolite of the amino acid proline. It has been shown to have beneficial effects on heart function in vitro and in vivo, as well as on collagen synthesis. Cis-4-Hydroxy-D-proline was also shown to inhibit herpes simplex virus replication and to induce apoptosis in hepatocyte-like cells. The affinity constants for cis-4-Hydroxy-D-proline were determined by ph assays, kinetic data, and structural analysis. The optimum pH for cis-4-Hydroxy D proline is 8.0 and the hydroxyl group makes this molecule more soluble in water than other molecules with a similar chemical structure.</p>Formula:C5H9NO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:131.13 g/molH-Cys(Acm)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-D-Tyr(tBu)-allyl ester·HCl
CAS:<p>Please enquire for more information about H-D-Tyr(tBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H23NO3·HClPurity:Min. 95%Molecular weight:313.82 g/mol(Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N15O10Purity:Min. 95%Molecular weight:1,122.32 g/molBoc 8-Lys4-Lys2-Lys-b-Ala-PAM resin (200-400 mesh)
CAS:<p>Boc 8-Lys4-Lys2-Lys-b-Ala-PAM resin (200-400 mesh) is a versatile research chemical used in various applications. It contains aminooxyacetic acid, which is commonly used in the synthesis of fatty acids and other organic compounds. This resin is often employed in the purification and separation of target molecules, such as ochratoxin, collagen, synthetic cannabinoids, naphthalene derivatives, fatty acids, steroids, and more. Additionally, it can be utilized as an inhibitor for various enzymes or complexes like arp2/3 complex. The Boc 8-Lys4-Lys2-Lys-b-Ala-PAM resin has also been used in the synthesis of cefazolin sodium, an antibiotic widely used in medical settings. With its high-quality composition and fine particle size (200-400 mesh), this resin offers excellent performance and efficiency for biomass-related studies and other research endeavors.</p>Formula:C45H91N15O9·xC2HF3O2Purity:Min. 95%H-Ser-Glu-Gly-OH
CAS:<p>H-Ser-Glu-Gly-OH is an atypical compound that has shown anti-cancer activity in vitro. It is a member of the family of compounds known as glycine receptor antagonists. H-Ser-Glu-Gly-OH has been shown to inhibit the proliferation of A549 lung cancer cells and to induce cell cycle arrest and apoptosis. The compound also inhibits the activation of signal regulated kinase (ERK) in A549 lung cancer cells, which may be due to its ability to inhibit the production of cytokines such as IL6, IL8, and TNFα. H-Ser-Glu-Gly-OH also has mitogenic and antiproliferative activities for a variety of nonmalignant cell lines including human umbilical vein endothelial cells (HUVEC), human embryonic kidney cells (HEK293), and mouse erythroleukemia cells (MEL).</p>Formula:C10H17N3O7Purity:Min. 95%Molecular weight:291.26 g/molmono-Methyl terephthalate
CAS:<p>Mono-methyl terephthalate (MMT) is a monomer used in the manufacturing of polyester and other types of plastic. It is produced from terephthalic acid, which is derived from crude oil or natural gas. The oxidation catalyst used in this process is usually manganese dioxide. MMT has been shown to inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. This active form is metabolized through a number of metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. MMT also specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains (e.g., ESX-1 secretion system protein) and inhibits cell growth in culture.</p>Formula:C9H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:180.16 g/molPoly(D,L-lactide-co-glycolide) - lactide: glycolide (75:25), average MW 50000 to 75000
CAS:<p>Poly (D,L-lactide-co-glycolide) is a synthetic polymer that consists of 75% lactide and 25% glycolide. It has been used in the treatment of incisional hernia, which is a type of hernia that occurs when an organ protrudes through an incision made in the abdominal wall. Poly (D,L-lactide-co-glycolide) has also been used to prevent neuronal death in experimental animals. Histological analysis of the subcutaneous tissue showed significantly less neuronal death with poly (D,L-lactide-co-glycolide). This polymer has also been shown to be effective for women with rectocele and was found to be safe for use in this population. Poly (D,L-lactide-co-glycolide) is a synthetic polymer consisting primarily of 75% lactides and 25% glycolides. This polymer has been used as an</p>Formula:C3H4O2xC2H2O2yPurity:Min. 95%Color and Shape:White PowderCD36 (93-110)-Cys
CAS:<p>Please enquire for more information about CD36 (93-110)-Cys including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H151N29O33SPurity:Min. 95%Molecular weight:2,271.47 g/molFor-Met-Leu-p-iodo-Phe-OH
CAS:<p>Please enquire for more information about For-Met-Leu-p-iodo-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30IN3O5SPurity:Min. 95%Molecular weight:563.45 g/molH-D-Ile-OBzl·p-tosylate
CAS:<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>Formula:C13H19NO2·C7H8O3SPurity:Min. 95%Molecular weight:393.5 g/molFmoc-Pra-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pra-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H98N18O22Purity:Min. 95%Molecular weight:1,411.52 g/molH-Lys-Ala-Pro-OH hydrochloride salt
<p>Please enquire for more information about H-Lys-Ala-Pro-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H26N4O4Purity:Min. 95%Molecular weight:314.38 g/molThrombospondin-1 (1016-1021) (human, bovine, mouse)
CAS:<p>Please enquire for more information about Thrombospondin-1 (1016-1021) (human, bovine, mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H59N9O8SPurity:Min. 95%Molecular weight:814.01 g/molZ-Arg-Arg-Arg-4MbetaNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H53N13O6Purity:Min. 95%Molecular weight:775.9 g/molLeucokinin II
CAS:<p>Leucokinin II is a fatty acid. It is a diagnostic agent that can be used to identify bacteria, such as Stenotrophomonas maltophilia, which produce β-amino acids. Leucokinin II can also be used for the diagnosis of cancer and inflammatory diseases. Its analogs are being studied for their potential use in diagnosing infectious diseases. Leucokinin II binds to the receptor and activates it, resulting in the production of biochemical or electrochemical signals that can be detected by a detector.</p>Formula:C39H50N10O12Purity:Min. 95%Molecular weight:850.87 g/mol4-Chloro-2-iodo-phenol
CAS:<p>Please enquire for more information about 4-Chloro-2-iodo-phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4ClIOPurity:Min. 95%Molecular weight:254.45 g/molH-D-Phe-Ala-OH
CAS:<p>3-Hydroxy-4-phenylbutyrate (H-D-Phe-Ala) is a fatty acid that is metabolized by the liver. It has been shown to be a potent inhibitor of the enzyme 3-hydroxyacyl coenzyme A dehydrogenase, which catalyzes the first step in fatty acid metabolism. H-D-Phe-Ala also inhibits the production of hormones such as insulin and glucagon and may be used to treat diabetes. This compound may also be useful for preventing or treating liver disease caused by alcohol abuse or other causes, due to its ability to inhibit enzymes that break down proteins in the cell. The addition of H-D-Phe-Ala has been shown to prevent formation of toxic metabolites in rats given an experimental drug, phenacetin, which can lead to kidney damage.</p>Formula:C12H16N2O3Purity:Min. 95%Molecular weight:236.27 g/mol1-Methyl-3-phenyl-piperazine
CAS:<p>1-Methyl-3-phenylpiperazine is a molecule with the chemical formula C6H14N2. It is an amide that belongs to the group of hexanes. 1-Methyl-3-phenylpiperazine is a colorless liquid with a strong ammonia odor and an irritating effect on skin. The molecule has been tested in vivo and found to be irritants when applied to the skin of rabbits, and can cause severe irritation when injected into the eyes of rabbits or rats. 1-Methyl-3-phenylpiperazine is not soluble in water but can be dissolved in ethanolamine, dimethyl sulfoxide, acetone, or chloroform.</p>Formula:C11H16N2Purity:Min. 95%Color and Shape:PowderMolecular weight:176.26 g/mol(Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H296N54O56Purity:Min. 95%Molecular weight:4,292.77 g/molN-Boc-1,2-phenyldiamine
CAS:<p>N-Boc-1,2-phenyldiamine is a histone acetyltransferase (HAT) inhibitor. It is an acetylated molecule that contains two phenyl rings, one of which is substituted with an amine group. This compound was designed to inhibit the activity of HATs, which are enzymes involved in the chemical modification of histones and other proteins. N-Boc-1,2-phenyldiamine inhibits the activities of these enzymes and prevents the acetylation of lysines on histones or other proteins. It has been shown to be efficient in inducing apoptosis in human cancer cells and may also have some antitumor effects.</p>Formula:C11H16N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:208.26 g/molH-Leu-His-Leu-OH
CAS:<p>H-Leu-His-Leu-OH is a peptide fragment of human growth hormone. It is a stabilized, cleaved, and lyophilized form of the substance that is used as an additive in buffering solutions. It has been shown to be a potent inhibitor of the proteolytic enzymes cathepsin B, elastase, and chymotrypsin in vitro. The stability of this fragment can be attributed to its resistance to proteolysis by enzymes such as cathepsin's B, elastase, and chymotrypsin because it does not contain any free amino acid residues.</p>Formula:C18H31N5O4Purity:Min. 95%Molecular weight:381.47 g/mol4-Fluoro-3-methoxyphenylacetone
CAS:<p>4-Fluoro-3-methoxyphenylacetone is a high quality reagent that can be used as an intermediate in the synthesis of complex compounds. This compound is also useful for creating fine chemicals and speciality chemicals, for research purposes. 4-Fluoro-3-methoxyphenylacetone has been shown to be a versatile building block in organic synthesis, with many possible applications. It can react with other compounds to create new compounds or react with itself to form new molecules. CAS No. 320338-98-5</p>Formula:C10H11FO2Purity:Min. 95%Molecular weight:182.19 g/molC-Peptide (human) acetate salt
CAS:<p>C-Peptide (human) acetate salt H-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala -Gly Ser Leu Gln Pro Leu Ala Leu Glu Gly Ser Leu Gln Pro Leu Ala is a peptide that has been purified from the pancreas of human and bovine sources. It is used in blood sampling and rate constant experiments to measure the response element on a signal peptide. This experiment can be used to study insulin production, as well as other biological samples. C Peptide (human) acetate salt H Glu Ala Glu Asp Leu Gln Val Gly Gln Val Glu Leu Gly Gly Gly Pro Gly Ala Gly Ser Leu Gln Pro Leu Ala has inhibitory properties against</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molCyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.</p>Formula:C26H38N8O7Purity:Min. 95%Molecular weight:574.63 g/molMatrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt
CAS:<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H75N9O11·C2HF3O2Purity:Min. 95%Molecular weight:1,080.2 g/molH-Gly-Sar-Sar-OH
CAS:<p>H-Gly-Sar-Sar-OH is an amide that is a prodrug for the antibiotic Glycylcycline. This drug has been shown to inhibit peptidases and transport in caco-2 cells, as well as to have affinity for intestinal peptidases. H-Gly-Sar-Sar-OH has also been shown to be able to penetrate the cell membrane and inhibit peptidase activity in extracellular space. The bond cleavage of this drug has been rationalized by comparing it with other bioisosteres.</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molDynorphin B
CAS:<p>Dynorphin B is a peptide hormone that is found in the brain and spinal cord. It is one of the many endogenous opioid peptides that bind to kappa-opioid receptors. Dynorphin B has been shown to have pain-relieving effects, which are mediated by its ability to inhibit neuronal activity in the nociceptive pathway. Dynorphin B has also been shown to have significant anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis. Dynorphin B can also reduce locomotor activity and increase dopamine release, which may be due to its ability to activate dopamine receptors.</p>Formula:C74H115N21O17Purity:Min. 95%Molecular weight:1,570.84 g/molZ-Trp-Phe-OH
CAS:<p>Z-Trp-Phe-OH is a chiral molecule that can be used as a metal ion receptor. It has been shown to interact with zinc ions and form stable complexes in the presence of hydroxyl groups. The formation of these complexes depends on the isomer of Z-Trp-Phe-OH and the pH value. This interaction can be monitored by liquid chromatography and the identification of analytes can be done by means of an appropriate chiral selector.</p>Formula:C28H27N3O5Purity:Min. 95%Molecular weight:485.53 g/mol(Phe7)-Dynorphin A (1-7) acetate salt
CAS:<p>Dynorphin A (1-7) acetate salt is a potent analgesic that has been used to treat pain. It has been shown to be effective in the treatment of laryngitis and other laryngological disorders. Dynorphin A (1-7) acetate salt is a prodrug that is hydrolyzed in vivo to dynorphin A (1-7) by esterases, which can then bind to opioid receptors. This drug has been validated for use as a diagnostic agent in coatings and in algorithms for analysis of polygonal images from laryngoscopy. The dehydrogenase enzymes are added to the coating or algorithm for diagnosis of the presence of vocal cord pathology. Dynorphin A (1-7) acetate salt also shows promising results for analyzing waveforms from laryngoscopy, with the goal of classifying vocal cord pathology.</p>Formula:C43H58N10O9Purity:Min. 95%Molecular weight:858.98 g/mol4-Cbz-(R)-2-methylpiperazine
CAS:<p>Please enquire for more information about 4-Cbz-(R)-2-methylpiperazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H18N2O2Purity:Min. 95%Molecular weight:234.29 g/molH-Leu-Ser-Phe-OH
CAS:<p>H-Leu-Ser-Phe-OH is a synthetic molecule that is a serine protease. It has been shown to have phosphatase activity, which can be used in the processing of milk proteins. This enzyme can also be used in the production of acid casein and colostrum. The enzyme has been shown to convert aspartic acid into asparagine, which is then converted into aminosugars such as melamine and phenylalanine. H-Leu-Ser-Phe-OH can be used for the treatment of fibrinogen deficiency, with its ability to cleave fibrinogen at the γ site. The enzyme has also been shown to have an effect on blood coagulation by cleaving fibrinogens at the γ site, thus preventing clot formation.</p>Formula:C18H27N3O5Purity:Min. 95%Molecular weight:365.42 g/mol(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H83N17O13Purity:Min. 95%Molecular weight:1,226.39 g/molFmoc-α-Me-L-Leucine
CAS:<p>Please enquire for more information about Fmoc-alpha-Me-L-Leucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H25NO4Purity:Min. 95%Molecular weight:367.44 g/mol(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt acetate salt is a synthetic hormone that belongs to the group of gonadotropin releasing hormones (GnRH). It is used in veterinary medicine to stimulate ovulation and follicular growth in animals. (Des-Gly10, tBu-D-Gly6, Pro -NHEt9)-LHRH acetate salt Pyr -His -Trp -Ser -Tyr -tBu -D -Gly -Leu -Arg -Pro NHEt acetate salt is a prodrug that is hydrolyzed in vivo to buserelin, its active form. This drug has been shown to be effective against estradiol benzoate and sodium salts</p>Formula:C59H84N16O12·xC2H4O2Purity:Min. 95%Molecular weight:1,209.4 g/molBoc-L-glutamic acid γ-methyl ester
CAS:<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>Formula:C11H19NO6Purity:Min. 95%Molecular weight:261.27 g/molIGF-II (33-40)
CAS:<p>This is a synthetic IGF-II peptide fragment (33-40) that has been immunized with an antiserum against the human growth hormone. It is used to measure the level of IGF-II in blood or serum. The immunizing antiserum cross-reacts with IgF-I and can also be used as a control for deficiency.</p>Formula:C38H74N20O12Purity:Min. 95%Molecular weight:1,003.12 g/molLHRH hydrochloride salt
CAS:<p>LHRH is a hormone that has been used to treat endometriosis, prostate cancer, and ovarian cysts. It is an agonist of the gonadotropin-releasing hormone receptor (GnRH receptor). LHRH binds to the GnRH receptor in the pituitary gland and stimulates the release of follicle-stimulating hormone and luteinizing hormone. This leads to increased production of estrogen and testosterone. LHRH has been shown to be effective in treating infectious diseases such as tuberculosis and HIV/AIDS. LHRH can also be used as a diagnostic aid for determining whether or not a tumor is cancerous by measuring its protein content.</p>Formula:C55H75N17O13·xHClPurity:Min. 95%Molecular weight:1,182.29 g/mol(2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester
CAS:<p>Please enquire for more information about (2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H23N5O7Purity:Min. 95%Molecular weight:493.47 g/mol2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide
CAS:<p>2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide is a signal molecule that has antimicrobial activity. It inhibits the proliferation of cells and is used as an antifungal agent. 2,5,6-Trimethyloxathiinium ion has been shown to induce apoptosis in human leukemia cells and inhibit the growth of erythrocytes infected with Plasmodium falciparum. This compound also inhibits wild type strains of bacteria and fungi and can be used as a natural fungicide. 2,5,6-Trimethyloxathiinium ion has been found to be effective in treating autoimmune diseases such as diabetes mellitus type II, which may be due to its ability to regulate glucose metabolism and suppress inflammatory responses.</p>Formula:C12H13NO2SPurity:Min. 95%Molecular weight:235.3 g/molNeuromedin B trifluoroacetate salt
CAS:<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/molN-α,ε-bis-Z-L-Lysine N-hydroxysuccinimide ester
CAS:<p>N-alpha,epsilon-bis-Z-L-Lysine N-hydroxysuccinimide ester is a methyl ester of the amino acid Lysine. This drug has been shown to have antinociceptive effects in animal models and may be useful for the treatment of inflammatory pain. The active conformation of this drug is dependent on the presence of hydroxybenzimidazole (HOBt). In the absence of HOBt, the compound does not have any activity. Acetylation or amidation may also affect its activity. The reaction with nitric acid yields a nitro derivative, which can be reduced back to the original compound by catalytic hydrogenation using palladium on carbon. A carboxylic acid group at the amino terminus can be converted to an amide or amido group by treatment with an appropriate reagent such as acetonitrile. This drug binds to a catalytic site on</p>Formula:C26H29N3O8Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:511.52 g/molFormyl-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H70N16O12Purity:Min. 95%Molecular weight:1,099.2 g/molH-Trp-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>H-Trp-Nle-Arg-Phe-NH2 acetate salt is a muscle relaxant that binds to the muscle receptor site, which is responsible for contraction of skeletal muscles. It has been shown to be effective in treating anterior retractor mytilus in horses.</p>Formula:C32H45N9O4Purity:Min. 95%Molecular weight:619.76 g/mol1-O-Hexadecyl-sn-glycerol
CAS:<p>1-O-Hexadecyl-sn-glycerol is a glycol ether that is used as a surfactant and emulsifier in cosmetic products. It has been shown to have minimal toxicity, and to not be carcinogenic or teratogenic. 1-O-Hexadecyl-sn-glycerol has been shown to increase the stability of proteins in rat liver microsomes, and it also prevents the hydrolysis of carbohydrates. The surface glycoprotein adsorbed by 1-O-Hexadecyl-sn-glycerol may play an important role in the binding of monoclonal antibodies. This compound affects cellular calcium levels, with high concentrations resulting in increased cytosolic calcium concentrations. Zirconium oxide can replace calcium ions in 1-O-Hexadecyl-sn-glycerol for this purpose, although this substitution reduces enzyme activity.</p>Formula:C19H40O3Purity:Min. 95%Molecular weight:316.52 g/molH-Lys(acetimidoyl)-OH
CAS:<p>Lysine acetimidate is a reactive compound that can be activated by the addition of an acid. Lysine acetimidate is a potent activator of macrophages and other inflammatory cells. It has been used in experimental models to study bowel disease and repair mechanisms. In these models, lysine acetimidate has shown to have anti-inflammatory effects, which may be due to its ability to decrease the production of pro-inflammatory cytokines by immune cells. The metabolic disorder caused by lysine acetimidate is still being studied. Lysine acetimidate also has immunomodulatory effects, as it can inhibit the synthesis of epidermal growth factor (EGF) in lung cells and cause damage to alveolar type II cells in the lung.</p>Formula:C8H17N3O2Purity:Min. 95%Molecular weight:187.24 g/molBoc-Phe-Tyr-OH
CAS:<p>Boc-Phe-Tyr-OH is a pancreatic enzyme that has been shown to be stable in the presence of buffers and tissues. It is used for the treatment of cancer and pancreatic diseases, such as cystic fibrosis and diabetes. Boc-Phe-Tyr-OH has been shown to have high uptake rates in caco-2 cells, which are human intestinal cells that are used to study drug transport. This compound also has an inhibitory effect on cell proliferation and DNA synthesis.</p>Formula:C23H28N2O6Purity:Min. 95%Molecular weight:428.48 g/mol(Leu15)-Gastrin I (human)
CAS:<p>Gastrin I (human) Pyr-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Leu-Asp, is a peptide that belongs to the family of cholecystokinin. It is synthesized by solid phase synthesis on a carboxyl group with an efficiency of more than 95%. Gastrin I (human) Pyr-Gly-Pro-Trp... has been shown to be selective towards amide bond cleavage and has high yield. It is also stable in acidic conditions and can be detritylated with phenoxy.</p>Formula:C98H126N20O31Purity:Min. 95%Molecular weight:2,080.17 g/molFmoc-Lys(Mtt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Lys(Mtt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-D-Asn-ONp
CAS:<p>Please enquire for more information about Boc-D-Asn-ONp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O7Purity:Min. 95%Molecular weight:353.33 g/molXenopsin-Related Peptide 1 (XP-1) trifluoroacetate salt
CAS:<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>Formula:C51H79N15O9Purity:Min. 95%Molecular weight:1,046.27 g/molAc-Val-Tyr-Leu-Lys-Ala-SBzl
CAS:<p>Please enquire for more information about Ac-Val-Tyr-Leu-Lys-Ala-SBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H56N6O7SPurity:Min. 95%Molecular weight:740.95 g/molLeptin (138-167) (human)
CAS:<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H224N37O47S2Purity:Min. 95%Molecular weight:3,253.64 g/molH-Cys(Bzl)-AMC
CAS:<p>H-Cys(Bzl)-AMC is a mesocosm study that measures the effects of nutrient additions on coastal ecosystems. Collaboratively, academics and stakeholders work to analyze datasets from these experiments to diagnose the impacts of nutrient inputs on coastal systems. This exploratory initiative will help stakeholders understand the impacts of nutrient inputs on their ecosystems in order to make better decisions about how they manage their natural resources.</p>Formula:C20H20N2O3SPurity:Min. 95%Molecular weight:368.45 g/mol3-Cyano-2-methylphenylboronic acid
CAS:<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>Formula:C8H8BNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:160.97 g/molpTH (1-31) (human)
CAS:<p>Please enquire for more information about pTH (1-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H269N49O47S2Purity:Min. 95%Molecular weight:3,719.3 g/molFITC-β-Ala-Amyloid β-Protein (1-40)
CAS:<p>Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C218H311N55O64S2Purity:Min. 95%Molecular weight:4,790.27 g/molH-D-Val-Leu-Arg-pNA·2 AcOH
CAS:<p>H-D-Val-Leu-Arg-pNA·2 AcOH is a kallikrein inhibitor that can be used as a blood pressure lowering agent. It inhibits the enzymatic activity of kallikrein, which is responsible for the conversion of kininogen to bradykinin, and thus prevents the production of natriuretic peptides. H-D-Val-Leu-Arg-pNA·2 AcOH has been shown to decrease blood pressure in animals by inhibiting filtration through the glomerulus and by blocking renin release from juxtaglomerular cells.</p>Formula:C23H38N8O5·2C2H4O2Purity:Min. 95%Molecular weight:626.7 g/molHIV-1 gag Protein p24 (137-154)
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (137-154) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C92H158N26O26SPurity:Min. 95%Molecular weight:2,076.46 g/molBiotinyl-Angiotensin I/II (1-7) Biotinyl-Asp-Arg-Val-Tyr-Ile-His-Pro-OH
CAS:<p>Please enquire for more information about Biotinyl-Angiotensin I/II (1-7) Biotinyl-Asp-Arg-Val-Tyr-Ile-His-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H76N14O13SPurity:Min. 95%Molecular weight:1,125.3 g/molMeOSuc-Ala-Ala-Pro-Ala-chloromethylketone
CAS:<p>MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone is a peptidyl substrate for the enzyme carboxypeptidase A. This substrate has a high specificity for carboxypeptidase A and does not bind to other enzymes such as carboxypeptidase B, D, or L. The hydrophobic nature of this substrate has been shown in both hamsters and macaques. MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone also shows cardiovascular effects in both animal models. It is possible that this effect is due to the proteolytic activity of the enzyme. More research needs to be done to identify the sequence of this peptide and how it may affect humans.</p>Formula:C20H31ClN4O7Purity:Min. 95%Molecular weight:474.94 g/molFmoc-D-His(1-Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-His(1-Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H35N3O4Purity:Min. 95%Molecular weight:633.73 g/molOsteostatin (human) trifluoroacetate salt
CAS:<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>Formula:C142H228N42O58Purity:Min. 95%Molecular weight:3,451.58 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate
CAS:<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>Formula:C109H159N25O32S5•(C2H4O2)xPurity:Min. 95%Molecular weight:2,491.91 g/molBoc-Gly-Phe-OBzl
CAS:<p>Please enquire for more information about Boc-Gly-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molSar-Ala-OH
CAS:<p>Please enquire for more information about Sar-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O3Purity:Min. 95%Molecular weight:160.17 g/molH-D-Leu-bNA·HCl
CAS:<p>Please enquire for more information about H-D-Leu-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N2O·HClPurity:Min. 95%Molecular weight:292.8 g/molGlutathione-monoethyl ester (reduced)
CAS:<p>Glutathione-monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is a polymerase chain reaction (PCR) enhancer that consists of a glutathione monoester and an ethyl ester. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is used as a cancer therapeutics agent in the treatment of cells with high levels of reactive oxygen species. It also inhibits drug efflux from cells and induces apoptosis in endothelial cells, which can lead to the inhibition of tumor growth. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH has been shown to cause changes in intracytoplasmic sperm and protein thiols in PC12 cells, which may be related to its ability to inhibit cell proliferation.</p>Formula:C12H21N3O6SPurity:Min. 95%Molecular weight:335.38 g/molH-Thr-Gly-OH
CAS:<p>H-Thr-Gly-OH is a synthetic polymerase chain reaction product. It is a mixture of H-Thr and Gly, which are two amino acids that are involved in the replication of DNA. The sequences of these two amino acids have been determined and found to be phylogenetically related to each other. H-Thr-Gly-OH was synthesized by the ethyl esterification of H-Thr with Gly. This reaction product has been shown to have locomotor activity in Drosophila melanogaster and may also possess some other properties that are unknown at this time.</p>Formula:C6H12N2O4Purity:Min. 95%Molecular weight:176.17 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molHIV Protease Substrate III
CAS:<p>HIV protease is a large protein that cleaves the polyprotein of HIV. This enzyme is essential for viral replication and so any drug that inhibits its function will inhibit HIV infectivity. The HIV protease substrate III, which contains histidine at position 3, has been used to study the effects of HIV proteases on different tissue types. It has been shown that this substrate can be detected in the cytoplasm and vacuole of cells infected with HIV, indicating that it may be involved in the transport process. The addition of an acidic amino acid (p-nitro-phenylalanine) to the substrate increases its antiviral activity by increasing its stability against proteolytic enzymes and allowing it to penetrate into cells more easily.</p>Formula:C58H95N19O16Purity:Min. 95%Molecular weight:1,314.49 g/molFA-Asp-Ala-OH
CAS:<p>FA-Asp-Ala-OH is a catalytic, acidic, and hydrophilic molecule. It has been shown to be an activating residue for carboxypeptidases. This molecule can hydrolyze other amino acids in the presence of water. Mutations to the FA-Asp-Ala-OH have been shown to have a profound effect on the kinetic properties of carboxypeptidases. The FA-Asp-Ala-OH residue is also important because it can increase the activity of carboxypeptidases by as much as 3 times as compared to wild type enzymes.</p>Formula:C14H16N2O7Purity:Min. 95%Molecular weight:324.29 g/molNeuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H135N25O24Purity:Min. 95%Molecular weight:1,915.16 g/molH-Thr-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Thr-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O5Purity:Min. 95%Molecular weight:233.22 g/molH-Gln-Glu-OH
CAS:<p>H-Gln-Glu-OH is a pharmacological inhibitor that blocks the epidermal growth factor receptor (EGFR) and inhibits cell proliferation. It has been shown to inhibit endothelial cell proliferation in vitro. H-Gln-Glu-OH also inhibits the tyrosine kinase activity of EGFR, which is necessary for the activation of phospholipase C. This inhibition prevents atherogenic cell functions and has been shown to inhibit the growth of human epidermoid carcinoma in tissue culture.</p>Formula:C10H17N3O6Purity:Min. 95%Molecular weight:275.26 g/molACTH (1-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N21O20SPurity:Min. 95%Molecular weight:1,680.88 g/molPHM-27 (human) trifluoroacetate salt
CAS:<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>Formula:C135H214N34O40SPurity:Min. 95%Molecular weight:2,985.41 g/mol(Glu8·9)-Helodermin
CAS:<p>Please enquire for more information about (Glu8·9)-Helodermin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H283N45O51Purity:Min. 95%Molecular weight:3,845.4 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/molN-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine
CAS:<p>N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is a chiral, electron deficient reagent that reacts with aldehydes and boronic esters to form products with high chemical yields. This compound can be used as a catalyst for acylation reactions, such as the synthesis of p-nitrophenol. N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is synthesized by the reaction of trifluoroacetic acid and an amine, followed by chloroformate displacement. The product is then reacted with acylating agents in the presence of catalysts.</p>Formula:C13H23NOSiPurity:Min. 95%Color and Shape:Clear Colourless To Pale Yellow LiquidMolecular weight:237.41 g/molSuc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid
CAS:<p>Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid is a synthetic peptide that has been shown to have the ability to inhibit the function of an enzyme called isomerase. It binds to the catalytic region of the enzyme and blocks its activity, which prevents the production of amino acid molecules. Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid also has immunosuppressive properties, which are due to its ability to bind to regulatory domains in cells and prevent their transcriptional activation. This molecule also has a catalytic function and can be used as a building block for synthesizing other molecules with similar functions.</p>Formula:C37H45N5O9•xCF3CO2HPurity:Min. 95%Molecular weight:703.78 g/molZ-Leu-Leu-Glu-bNA
CAS:<p>Z-Leu-Leu-Glu-bNA is a polypeptide that has been shown to activate the cytosolic fatty acid oxidation pathway in Xenopus oocytes. The polypeptide was found to inhibit the activity of enzymes involved in fatty acid synthesis and activation, such as acyl CoA synthetase, lipoyl CoA transferase, and acyl CoA oxidase. Z-Leu-Leu-Glu-bNA also inhibited protein synthesis in Caco2 cells by inhibiting the activity of protein kinase A (PKA) and phosphorylation of protein kinase B (PKB). These effects are mediated by lysine residues and proteolytic cleavage of Z-Leu-Leu-Glu-bNA.</p>Formula:C35H44N4O7Purity:Min. 95%Molecular weight:632.75 g/mol1-Boc-1-methylhydrazine
CAS:<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/molCaloxin 2A1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.52 g/molH-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-D-Pra-OH
CAS:<p>H-D-Pra-OH is a chemical substance that inhibits the synthesis of proteins. It binds to the active site of enzymes, thereby blocking the formation of an enzyme-substrate complex and inhibiting enzyme activity. H-D-Pra-OH is an enzyme inhibitor that can be used to study protein synthesis in vitro. It is most effective on renal proximal tubules cells, where it inhibits potassium uptake by competitive inhibition with d-alanine. H-D-Pra-OH also inhibits the uptake of aziridine, which is a reactive substance that can cause cellular damage. The carbonyl group in this substance may react with other substances such as potassium dichromate, forming a chromium compound that can be seen under the microscope.</p>Formula:C5H7NO2Purity:Min. 95%Molecular weight:113.11 g/mol(Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H76N14O11Purity:Min. 95%Molecular weight:1,097.27 g/molH-Pro-Glu-OH
CAS:<p>H-Pro-Glu-OH is a homologous peptide that belongs to the group of proteins. It is synthesized in the cells by polymerase chain reaction and can be used for diagnosis of infectious diseases. It has been shown to induce antibody response in mice. H-Pro-Glu-OH is also active against Mycobacterium tuberculosis, which may be due to its ability to bind to the tyrosine kinase domain on protein genes. This peptide has been shown to have anti-inflammatory properties, inhibiting fatty acid production and leading to necrotic cell death.</p>Formula:C10H16N2O5Purity:Min. 95%Molecular weight:244.24 g/molDynorphin A (1-7)
CAS:<p>Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH is a peptide that acts as a cryoprotectant. It has been shown in animal models to inhibit the proliferation of cells in culture and to have neuroprotective properties. Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH has also been shown to have antiinflammatory properties in animals, although the exact mechanism of action is not known. This peptide can be used as an excipient in pharmaceutical formulations or as a diluent for lyophilisates.</p>Formula:C40H61N13O9Purity:Min. 95%Molecular weight:867.99 g/molNeuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C175H290N56O59Purity:Min. 95%Molecular weight:4,122.52 g/molTetrahydropyran-2-methanol
CAS:<p>Tetrahydropyran-2-methanol is a hydrogenated, hydrated, triflic acid derivative that belongs to the group of organic compounds known as ethers. The presence of a hydroxyl group on one end and a chloride group on the other end provides tetrahydropyran-2-methanol with two reactive sites for reactions with metals. It has been shown to react with metal surfaces in order to form an adduct under acidic conditions that can be used as an ion exchange resin. Tetrahydropyran-2-methanol also reacts rapidly with hydrochloric acid to form tetrahydrothiophene and methanol. This reaction time can be sped up by heating the liquid at atmospheric pressure or by adding sulfuric acid. Tetrahydropyran-2-methanol is also capable of reacting with water in order to produce hydrogen gas and alcohol.</p>Formula:C6H12O2Purity:Min. 98%Molecular weight:116.16 g/mol(D-Pen 2,p-chloro-Phe4,D-Pen 5)-Enkephalin
CAS:<p>D-Pen 2,p-chloro-Phe4,D-Pen 5)-Enkephalin H-Tyr-D-Pen-Gly-p-chloro-Phe-D-Pen (Disulfide bond) is a peptide that belongs to the family of opioid drugs. It has low potency and is used in pharmacological studies as a nonselective antagonist of δ-, μ-, and κ-(kappa) receptors. This drug blocks pain by binding to the same receptor sites that are activated by endogenous opioids and has been shown to be effective against both inflammatory and neuropathic pain. DPDPE has also been shown to have a high safety profile with minimal side effects.</p>Formula:C30H38ClN5O7S2Purity:Min. 95%Molecular weight:680.24 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H100N22O14S3Purity:Min. 95%Molecular weight:1,449.77 g/molZ-Pro-Leu-Ala-NHOH
CAS:<p>Z-Pro-Leu-Ala-NHOH is a potent inhibitor of stromal cells. It is a hydroxamic acid molecule that acts as an inhibitor of protein synthesis in the ribosome. Z-Pro-Leu-Ala-NHOH has been shown to have potent inhibitory activity against ethyl palmitate and lipiodol, which are used for therapeutic purposes. The molecule also inhibits viscosity in pharmaceutical preparations and pluripotent stem cells. This compound has shown inhibitory activities against stromal cells, which are responsible for growth, differentiation, and tissue repair. It also prevents the formation of embryoid bodies or pluripotent stem cells by suppressing the expression of proteins needed for early development.</p>Formula:C22H32N4O6Purity:Min. 95%Molecular weight:448.51 g/molFmoc-Mating Factor a TFA salt
CAS:<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H124N20O19S(freebase)Purity:Min. 95%Molecular weight:1,906.21 g/molNocistatin (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O32Purity:Min. 95%Molecular weight:1,927.07 g/mol(Cys(Bzl)84)-CD4 (81-92)
CAS:<p>The CD4 molecule is a major component of the human immune system. It interacts with other cells, such as T-cells, and plays an important role in the immune response. The CD4 molecule is a glycoprotein that consists of two subunits, (Cys(Bzl)84)-CD4 and (81-92) H-Thr-Tyr-Ile-Cys(Bzl)-Glu-Val-Glu-Asp-Gln-Lys-Glu-. The sequence of this molecule is important for its function, as it has been shown to be essential for binding to HIV particles. This protein may also play a role in regulating the growth of T cells. It was found that the amino acid sequence of CD4 is not conserved among different species. The amino acid sequence specificity in the CD4 molecule is due to the cysteine residues. These residues are able to form disulfide bridges with other cyste</p>Formula:C69H102N14O26SPurity:Min. 95%Molecular weight:1,575.69 g/molBoc-Ala-Pro-Nva-4-chloro-SBzl
CAS:<p>Please enquire for more information about Boc-Ala-Pro-Nva-4-chloro-SBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36ClN3O5SPurity:Min. 95%Molecular weight:526.09 g/molH-Val-Leu-OH·HCl
CAS:<p>H-Val-Leu-OH·HCl is a hydrolytic cleavage product of the covalent adduct of valproic acid and HCl. It is an acidic compound that can be produced by hydrolysis or by exposure to alcohols. This compound is also known as ethylene glycol monobutyl ether, which is formed when ethylene reacts with butanol. H-Val-Leu-OH·HCl has been shown to cause termination in animal experiments and has been detected in humans following alcohol exposure. It also has some toxic effects on animals such as liver damage, kidney damage, and death.</p>Formula:C11H22N2O3·HClPurity:Min. 95%Molecular weight:266.76 g/molPolyphemusin II-Derived Peptide
CAS:<p>Polyphemusin II-derived peptide H-Arg-Arg-2-Nal-Cys-Tyr-Arg-Lys-D-Lys-Pro-Tyr-Arg-Cit (PIIH) is a cyclic polypeptide with a disulfide bond. PIIH binds to the alpha4beta1 integrin receptor, which is involved in the adhesion of leukocytes to endothelial cells and the migration of monocytes and lymphocytes. PIIH has been shown to be a potent inhibitor of chemokine binding to cxcr4, an important regulator of inflammatory response in mouse tumor models. PIIH also inhibits hiv infection as it inhibits the release of virus from infected cells. This pharmacological effect is mediated by its ability to bind HIV gp120 and block gp120 binding to CD4 receptors on target cells.</p>Formula:C90H141N33O18S2Purity:Min. 95%Molecular weight:2,037.43 g/molAcetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH
CAS:<p>Please enquire for more information about Acetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H147N29O24SPurity:Min. 95%Molecular weight:2,135.45 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H160N30O26S4Purity:Min. 95%Molecular weight:2,434.89 g/molBovine Pineal Antireproductive Tripeptide acetate salt
CAS:<p>Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.</p>Formula:C13H26N4O6Purity:Min. 95%Molecular weight:334.37 g/molBoc-Lys(Fmoc)-Leu-Ala-Leu-OH
CAS:<p>Please enquire for more information about Boc-Lys(Fmoc)-Leu-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H59N5O9Purity:Min. 95%Molecular weight:765.94 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N53O64SPurity:Min. 95%Molecular weight:4,552.13 g/mol4-Bromo-1-methyl-1H-imidazole
CAS:<p>4-Bromo-1-methyl-1H-imidazole is an organic compound that belongs to the group of imidazoles. It is a chiral molecule with two stereoisomers, 4-bromo-1H-imidazole and 1H-imidazole. This compound can be synthesized by reacting ethyl formate with α-amino acid and chlorides in the presence of magnesium, followed by reduction with lithium aluminum hydride. The yield of this reaction is low, so it is not used in industrial processes. The imidazoles are important for their pharmacological activity as they are a class of drugs such as nitrofurantoin or griseofulvin. The dinitrate derivatives are also important for their metallation reactions and use in organic synthesis.</p>Formula:C4H5BrN2Purity:Min. 95%Molecular weight:161 g/mol(Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molN-α-Allyloxycarbonyl-N-ε-2-Fmoc-L-lysine
CAS:<p>The synthesis of semaglutide is accomplished by a solid-phase synthetic route. The peptide is synthesized on a polymeric support. The side chains are assembled in the liquid phase and then condensed with the peptide chain. The condensation reaction between the side chains and peptide chain is catalyzed by an acid such as trifluoroacetic acid or ethyl chloroformate. Semaglutide was synthesized using this method to produce high purity, concentration, and yield.</p>Formula:C25H28N2O6Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:452.5 g/molN-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam
CAS:<p>Please enquire for more information about N-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H71N15O9Purity:Min. 95%Molecular weight:1,074.24 g/molAntifreeze Polypeptide 6 (winter flounder) trifluoroacetate salt
CAS:<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>Formula:C133H225N43O51•xC2HF3O2Purity:Min. 95%Molecular weight:3,242.47 g/molAntho-RFamide Pyr-Gly-Arg-Phe-NH2
CAS:<p>Antho-RFamide Pyr-Gly-Arg-Phe-NH2 is an acidic amino acid. It has been shown to be a precursor of dopamine β-hydroxylase, which is a key enzyme in the synthesis of epinephrine and norepinephrine. This compound has a diameter of 0.8 nm, and it's been observed in cnidarians and multicellular animals. The biological function of Antho-RFamide Pyr-Gly-Arg-Phe-NH2 is not yet known, but it has been sequenced and identified as fatty acid with a sequence that is identical to serotonin. Analysis shows that this molecule contains an acidic environment with an alkaline pH.</p>Formula:C22H32N8O5Purity:Min. 95%Molecular weight:488.54 g/molH-Arg-Gly-Tyr-Ala-Leu-Gly-OH
CAS:<p>H-Arg-Gly-Tyr-Ala-Leu-Gly-OH is a synthetic, competitive inhibitor of the aminopeptidase that cleaves the amino acid Arg from peptide chains. This compound has been shown to inhibit kinases in vitro and block viral replication in cell culture. H-Arg-Gly-Tyr-Ala-Leu-Gly-OH is reversibly inhibited by endogenous aminopeptidases, which have been shown to be involved in the regulation of cell proliferation and apoptosis.</p>Formula:C28H45N9O8Purity:Min. 95%Molecular weight:635.71 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/molAc-Val-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H36F3N7O11Purity:Min. 95%Molecular weight:751.66 g/molCarbamoyl-Asp-OH·magnesium salt/Carbamoyl-Asp-OH·dipotassium salt (1:1)
CAS:<p>Carbamoyl-Asp-OH·magnesium salt/Carbamoyl-Asp-OH·dipotassium salt (1:1) is a derivate of p-hydroxybenzoic acid that has been shown to inhibit leukotriene receptor antagonists and basic proteins. It has been found in urine samples, but its function is not yet known. The uptake of this molecule may be a potential biomarker for the diagnosis of orotic aciduria and HIV infection. Carbamoyl-Asp-OH·magnesium salt/Carbamoyl-Asp-OH·dipotassium salt (1:1) has also been shown to be an inhibitor of intramolecular hydrogen transfer reactions in model systems.</p>Formula:C10H12K2MgN4O10Purity:Min. 95%Molecular weight:450.72 g/molFmoc-Tyr(Et)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5Purity:Min. 95%Molecular weight:431.48 g/molH-D-Thr-OBzl·oxalate (1:1)
CAS:<p>Please enquire for more information about H-D-Thr-OBzl·oxalate (1:1) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15NO3·C2H2O4Purity:Min. 95%Molecular weight:299.28 g/molBoc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Deamino-Cys1,Leu4,Lys8)-Vasopressin trifluoroacetate salt
CAS:<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>Formula:C47H67N11O11S2Purity:Min. 95%Molecular weight:1,026.23 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/molH-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH
CAS:<p>Please enquire for more information about H-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N11O21PPurity:Min. 95%Molecular weight:1,118.05 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS:<p>Amide; Trifluoroacetate salt</p>Formula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molN-Benzoyl-N-phenylhydroxylamine
CAS:<p>N-Benzoyl-N-phenylhydroxylamine is a compound that has been shown to be an optimum concentration for the production of molybdenum. It is a model system for the extraction and separation of molybdenum from other metals. The extraction process involves acidification with nitric acid, followed by precipitation with sodium benzoate. N-Benzoyl-N-phenylhydroxylamine is extracted using an electrode and then purified with a metal chelate. This compound has been shown to have synergistic effects when combined with vanadium, which may be due to their similar chemical properties.</p>Formula:C13H11NO2Purity:Min. 95%Molecular weight:213.23 g/molH-Glu-Tyr-OH
CAS:<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>Formula:C14H18N2O6Purity:Min. 95%Molecular weight:310.3 g/mol(Nle 10)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Nle 10)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H56N8O10Purity:Min. 95%Molecular weight:748.87 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/mol3-Bromo-2-methylaniline
CAS:<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>Formula:C7H8BrNPurity:Min. 95%Color and Shape:Clear Colourless To Yellow To Brown Or Red-BrownMolecular weight:186.05 g/molNeuropeptide VF (56-92) (human) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H304N52O51S2Purity:Min. 95%Molecular weight:4,256.95 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molBoc-Ser(Leu-Fmoc)-OH
CAS:<p>Boc-Ser(Leu-Fmoc)-OH is a peptide that has been synthesized using the Fmoc strategy. The peptide has been synthesized in an efficient manner and it is an epimer of Boc-Ser(Leu-OH).</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/mol(Tyr65,Phe67)-C5a (65-74) (human)
CAS:<p>Please enquire for more information about (Tyr65,Phe67)-C5a (65-74) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H85N15O16SPurity:Min. 95%Molecular weight:1,244.42 g/molH-Gln-Gly-Pro-OH·TFA
CAS:<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N4O5·C2HF3O2Purity:Min. 95%Molecular weight:414.33 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/mol(Pro7)-Neurokinin B
CAS:<p>Please enquire for more information about (Pro7)-Neurokinin B including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H77N13O14S2Purity:Min. 95%Molecular weight:1,208.41 g/molMCLV3 trifluoroacetate salt
CAS:<p>Please enquire for more information about MCLV3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H89N19O19Purity:Min. 95%Molecular weight:1,344.43 g/molAc-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu-NH2
CAS:<p>The peptide Ac-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu (AFGP) is a small molecule that has been shown to be effective in the prophylaxis and treatment of infectious diseases. AFGP is used as an excipient in intravenous solutions, such as antibiotics, vaccines, and other injectable drugs. It also functions as a diluent for lyophilized products. In addition to its use in the pharmaceutical industry, AFGP is also used as an excipient for vaccine preparations and other injectable drugs. AFGP has been shown to reduce the symptoms of inflammatory diseases, such as asthma and rheumatoid arthritis. This peptide has also been shown to have antiinflammatory and antifibrotic properties.</p>Formula:C96H123N19O22Purity:Min. 95%Molecular weight:1,895.12 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molH-Tyr-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/molBoc-Lys(Z)-Lys(Z)-Lys(Z)-Lys(Z)-OBzl
CAS:<p>Please enquire for more information about Boc-Lys(Z)-Lys(Z)-Lys(Z)-Lys(Z)-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H88N8O15Purity:Min. 95%Molecular weight:1,257.47 g/molBoc-Phe-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Bz-Asn-Gly-Thr-NH2
CAS:<p>Please enquire for more information about Bz-Asn-Gly-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O6Purity:Min. 95%Molecular weight:393.39 g/molSomatostatin-14 (3-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H96N16O17S2Purity:Min. 95%Molecular weight:1,509.75 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/mol4-Fluoro-2-methoxyaniline
CAS:<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>Formula:C7H8FNOPurity:Min. 95%Color and Shape:Light Brown To Brown LiquidMolecular weight:141.14 g/molH-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH
CAS:<p>Please enquire for more information about H-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H125N23O19Purity:Min. 95%Molecular weight:1,749.02 g/molH-Pro-Leu-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H26N4O5Purity:Min. 95%Molecular weight:342.39 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/mol(d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H78N13O10S2Purity:Min. 95%Molecular weight:1,121.4 g/molN-α-Benzoyl-L-argininamide
CAS:<p>N-alpha-Benzoyl-L-argininamide is a synthetic compound that is used as an enzyme inhibitor. It binds to the active site of proteases, thereby inhibiting their activity. This drug has been shown to inhibit the activities of phosphodiesterase and phosphatase enzymes in vitro. N-alpha-Benzoyl-L-argininamide also inhibits the proteolytic degradation of hippuric acid and casein in vitro. The binding affinity for this drug is due to its structural similarity with substrates such as glutamate and rhizosphere exudates.</p>Formula:C13H19N5O2Purity:Min 98%Color and Shape:White PowderMolecular weight:277.32 g/mol(D-Cys(tBu)2,Thr(tBu)6)-Leu-Enkephalin-Thr
CAS:<p>Leu-Enkephalin is a synthetic opioid peptide that exhibits potent analgesic effects and is used in the treatment of a variety of pain syndromes. Leu-Enkephalin has been shown to have an inhibitory effect on δ-opioid receptors, which are involved in the transmission of pain signals. Leu-Enkephalin has also been shown to have an inhibitory effect on other enzymes such as aminopeptidases, proteases, and kinases. This drug has been used in the treatment of autoimmune diseases, cancer, and inflammatory diseases. Leu-Enkephalin is also known to increase locomotor activity and reduce sensitivity to pain.</p>Formula:C41H62N6O9SPurity:Min. 95%Molecular weight:815.03 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molS-(1,2-Dicarboxyethyl)glutathione
CAS:<p>S-(1,2-Dicarboxyethyl)glutathione is a glutathione analogue that has been shown to prevent acetaminophen-induced hepatotoxicity in mice. It inhibits the reaction between acetaminophen and hepatic microsomal cytochrome P450 enzymes, which prevents the formation of toxic metabolites. S-(1,2-Dicarboxyethyl)glutathione also inhibits the production of serotonin by inhibiting the enzyme tryptophan hydroxylase. This drug has an anticoagulant effect by preventing the conversion of prothrombin to thrombin. S-(1,2-Dicarboxyethyl)glutathione also affects growth factors and collagen synthesis by affecting both epidermal growth factor (EGF) and fibroblast growth factor (FGF). The optimum pH for this drug is at 7.0.</p>Formula:C14H21N3O10SPurity:Min. 95%Molecular weight:423.4 g/molH-Gly-Gly-Met-OH
CAS:<p>H-Gly-Gly-Met-OH is a hydrophobic amino acid with a decelerated reaction. It has been shown to modulate the growth of organisms, such as Staphylococcus aureus and Streptococcus pneumoniae. This molecule also has aspirin-like activity against S. aureus and can be used for cavity prevention. H-Gly-Gly-Met-OH is effective in inhibiting the growth of S. aureus, but not against Streptococcus pneumoniae. The test organism used in this study was Escherichia coli K12. H-Gly-Gly-Met-OH has been shown to have sequences that are similar to those found in kinetically slow peptides and tripeptides, which may explain its stability when encapsulated in liposomes for oral administration.</p>Formula:C9H17N3O4SPurity:Min. 95%Molecular weight:263.32 g/molH-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H61N9O7S2·C2HF3O2Purity:Min. 95%Molecular weight:970.13 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molH-Leu-allyl ester·p-tosylate
CAS:<p>H-Leu-allyl ester·p-tosylate is an amide with immobilized amino groups. It is an optically active compound that can be cumulated and used for biomolecular chemistry. H-Leu-allyl ester·p-tosylate has been shown to inhibit the growth of fungi by inhibiting the synthesis of tenuazonic acid, a mycotoxin that is found in contaminated grains.</p>Formula:C9H17NO2C7H8O3SPurity:Min. 95%Molecular weight:343.44 g/molBoc-Glu(OBzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Glu(OBzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Amino-5-methoxypyridine
CAS:<p>2-Amino-5-methoxypyridine (2AM5MP) is a synthetic compound that is used to study the nicotinic acetylcholine receptor. It has been shown that 2AM5MP can be used as an agonist for the nicotinic acetylcholine receptor, which may be due to its ability to act as a substrate for amine oxidase. This compound has been shown to have anti-cancer properties and fluoresce when exposed to positron emission tomography (PET) scans. The anti-cancer effects of 2AM5MP are thought to be due to its ability to inhibit cancer cell proliferation and induce cancer cell apoptosis.</p>Formula:C6H8N2OPurity:Min. 95%Molecular weight:124.14 g/molH-Glu-His-bNA
CAS:<p>Please enquire for more information about H-Glu-His-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H23N5O4Purity:Min. 95%Molecular weight:409.44 g/molH-Asp-Trp-OH
CAS:<p>H-Asp-Trp-OH is a peptide that has been shown to have antioxidative activity and neuroprotective effects. It has also been shown to be a reactive compound that can interact with other molecules, such as thiobarbituric acid. H-Asp-Trp-OH has been shown to increase the number of neurons in the brain and may be helpful in reducing neuronal damage by apoptotic cell death. This peptide also has potential use in treating neurodegenerative diseases, such as Alzheimer's disease.</p>Formula:C15H17N3O5Purity:Min. 95%Molecular weight:319.31 g/molMca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H122N22O19Purity:Min. 95%Molecular weight:1,756.02 g/molH-Val-Thr-Cys-Gly-OH
CAS:<p>Please enquire for more information about H-Val-Thr-Cys-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H26N4O6SPurity:Min. 95%Molecular weight:378.45 g/molH-Met-Arg-Phe-Ala-OH
CAS:<p>H-Met-Arg-Phe-Ala-OH is a synthetic peptide that has been shown to be an effective inhibitor of protein synthesis in mammalian cells. It binds to the active site of protein translation machinery, thereby inhibiting the production of proteins vital for cell division. H-Met-Arg-Phe-Ala-OH is stable in aqueous solution and resistant to proteolytic degradation. It also has a high detection sensitivity and can be detected by FTIR spectroscopy, which makes it suitable for use in a variety of applications. H-Met-Arg-Phe-Ala-OH can be used as a tool for studying protein synthesis inhibition or as an antiobiotic agent against cancer cells.</p>Formula:C23H37N7O5SPurity:Min. 95%Molecular weight:523.65 g/molCRAMP-18 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP-18 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H171N27O24Purity:Min. 95%Molecular weight:2,147.61 g/molAcetyl-(Cys(Acm)33·42)-EGF (33-42) amide (mouse)
CAS:<p>Please enquire for more information about Acetyl-(Cys(Acm)33·42)-EGF (33-42) amide (mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H82N16O17S2Purity:Min. 95%Molecular weight:1,255.43 g/molBAM-12P (7-12)
CAS:<p>Please enquire for more information about BAM-12P (7-12) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H52N12O9Purity:Min. 95%Molecular weight:712.8 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/molHCV-1 e2 Protein (554-569)
CAS:<p>Please enquire for more information about HCV-1 e2 Protein (554-569) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H111N19O21S3Purity:Min. 95%Molecular weight:1,698.99 g/molACTH (7-38) (human)
CAS:<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>Formula:C167H257N47O46Purity:Min. 95%Molecular weight:3,659.12 g/molAdipokinetic Hormone (Apis mellifera ligustica) TFA salt
CAS:<p>Adipokinetic hormone is a peptide hormone that has been shown to stimulate the metabolism of fat cells in laboratory animals. This peptide is produced by the gland cells of honeybees and is used to regulate the energy metabolism of honeybees and other insects. Adipokinetic hormone has been shown to increase locomotor activity, inhibit the growth of human pathogens, activate transfer reactions, and inhibit receptor activity. The biological properties of this hormone have not yet been fully elucidated.</p>Formula:C47H65N11O14•C2HF3O2Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:1,122.10 g/molMCH-Gene-Overprinted-Polypeptide-14 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H132N22O18S3Purity:Min. 95%Molecular weight:1,786.24 g/molZ-Pro-Leu-Gly-OEt
CAS:<p>Z-Pro-Leu-Gly-OEt is a cyclic tripeptide that can be synthesized using ammonium sulfate as a catalyst. The reaction time required is between 4 and 12 hours, with the optimum at 8 hours. Resonances have been observed in the 1H NMR spectrum of Z-Pro-Leu-Gly-OEt. The most prominent resonance appears at δ 9.5 ppm. The cyclization of Z-Pro-Leu-Gly-OEt is catalysed by ammonium sulfate, which also produces a reaction yield of 100%. The effect of pH on the rate constant for the reaction has been studied and it was found that there was no significant difference in reactivity when the pH was varied between 7 and 11. Sulfoxide formation has also been monitored during synthesis, but concentrations are low enough to not affect the yield or reactivity of the product. The conformational structure of Z-Pro-Le</p>Formula:C23H33N3O6Purity:Min. 95%Molecular weight:447.52 g/molH-Leu-Val-Leu-Ala-pNA
CAS:<p>Please enquire for more information about H-Leu-Val-Leu-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H42N6O6Purity:Min. 95%Molecular weight:534.65 g/mol(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/molDnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2
CAS:<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>Formula:C38H57N15O11SPurity:Min. 95%Molecular weight:932.02 g/molBoc-Gly-Gly-Leu-pNA
CAS:<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/mol(Cys39)-Tissue Factor (33-53)
CAS:<p>Please enquire for more information about (Cys39)-Tissue Factor (33-53) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H166N26O33S2Purity:Min. 95%Molecular weight:2,456.79 g/molDynorphin A (1-8) acetate salt
CAS:<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>Formula:C46H72N14O10Purity:Min. 95%Molecular weight:981.15 g/mol4-Chloro-6-methoxyquinoline
CAS:<p>4-Chloro-6-methoxyquinoline is an inhibitor of bacterial DNA gyrase. It has antibacterial activity against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus, Enterococcus faecalis, and Pseudomonas aeruginosa. 4-Chloro-6-methoxyquinoline is a synthetic compound that was reinvestigated for its antibacterial activity. It has been shown to be effective in the treatment of Staphylococcal infections. The mechanism of action may involve inhibition of topoisomerase II or interference with the synthesis of DNA by binding to the enzyme bacterial DNA gyrase. Quinidine and cinchonidine are quinine derivatives that have been found to inhibit bacterial DNA gyrase. These compounds are found in the bark of Cinchona species, which includes Cinchona ledgeriana, Cinchona officinalis, and Cinchona succirub</p>Formula:C10H8ClNOPurity:Min. 95%Molecular weight:193.02944
