
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,466 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38249 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Trp(Boc)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Tyr4,D-Phe12)-Bombesin
CAS:<p>Please enquire for more information about (Tyr4,D-Phe12)-Bombesin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H110N22O19SPurity:Min. 95%Molecular weight:1,679.9 g/mol4-Fluoro-2-methoxyphenol
CAS:<p>4-Fluoro-2-methoxyphenol is a fluorinating agent that is used in the manufacture of pharmaceuticals, plastics and pesticides. It has been shown to induce apoptosis in cultured cells by upregulating reactive oxygen species (ROS) and increasing mitochondrial membrane permeability, as well as inhibiting cellular physiology. 4-Fluoro-2-methoxyphenol also inhibits the production of ATP and may be toxic to cells by interfering with dinucleotide phosphate.</p>Formula:C7H7FO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:142.13 g/molZ-Phe-Phe-Phe-OH
CAS:<p>Z-Phe-Phe-Phe-OH is an organic solvent that is homogeneous, has low solubility and a high boiling point. The epimerization of this compound can be achieved through the use of experimental methods. Z-Phe-Phe-Phe-OH is used in medicinal solvents as well as fields such as pharmacology and chemistry. This compound also has efficient methods for producing it and yields are detectable. There are also no residues from this compound.</p>Formula:C35H35N3O6Purity:Min. 95%Molecular weight:593.67 g/molDynorphin A (porcine 1-13) - acetate salt
CAS:<p>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys is a peptide that is found in the brain and spinal cord. It is an agonist of opioid receptors, which are involved in pain relief, as well as motor control. Dynorphin A (1-13) H has been shown to inhibit acetylcholine release, which may be due to its ability to bind to kappa opioid receptors. Dynorphin A (1-13) H is also known to bind to κ opioid receptors, where it inhibits locomotor activity and induces analgesia.</p>Formula:C75H126N24O15Purity:Min. 95%Color and Shape:PowderMolecular weight:1,603.96 g/molKemptide trifluoroacetate salt
CAS:<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>Formula:C32H61N13O9·xC2HF3O2Purity:Min. 95%Molecular weight:771.91 g/mol(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H30N4O4S2Purity:Min. 95%Molecular weight:550.69 g/molAcetyl-Calpastatin (184-210) (human)
CAS:<p>Acetyl-Calpastatin (184-210) (human) Ac-Asp-Pro-Met-Ser-Ser-Thr-Tyr-Ile-Glu-Glu-Leu-Gly-Lys-Arg-Glu-Val-Thr-(184–210) is a protease inhibitor that inhibits the activity of calpain, an enzyme involved in the degradation of proteins. It has been used for the treatment of infectious diseases such as tuberculosis and autoimmune diseases such as multiple sclerosis. Acetylcalpastatin is synthesized from calpastatin, which is found in abundance in the central nervous system and skeletal muscle. Acetylcalpastatin has been shown to inhibit experimental models of the disease by interfering with the production of inflammatory mediators.</p>Formula:C142H230N36O44SPurity:Min. 95%Molecular weight:3,177.63 g/molH-Arg-Arg-bNA·3 HCl
CAS:<p>Please enquire for more information about H-Arg-Arg-bNA·3 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N9O2·3HClPurity:Min. 95%Molecular weight:564.94 g/molH-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H49N7O11Purity:Min. 95%Molecular weight:659.73 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/mol([ring-D5]Phe6)-Somatostatin-14
<p>Please enquire for more information about ([ring-D5]Phe6)-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H99D5N18O19S2Purity:Min. 95%Molecular weight:1,642.91 g/molH-Lys-Ala-pNA·2 HCl
CAS:<p>Please enquire for more information about H-Lys-Ala-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N5O4·2HClPurity:Min. 95%Molecular weight:410.3 g/mol(Val6,Ala7)-Kemptide
CAS:<p>Please enquire for more information about (Val6,Ala7)-Kemptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H61N13O9Purity:Min. 95%Molecular weight:771.91 g/molH-Gly-Pro-Gly-NH2·HCl
CAS:<p>Please enquire for more information about H-Gly-Pro-Gly-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H16N4O3·HClPurity:Min. 95%Molecular weight:264.71 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H218N42O47SPurity:Min. 95%Molecular weight:3,381.65 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/molBoc-(R)-3-Amino-4-(2,4,5-trifluorophenyl)butanoic acid
CAS:<p>Intermediate in the synthesis of sitagliptin</p>Formula:C15H18F3NO4Purity:Min. 95%Molecular weight:333.3 g/mol(Ile3)-Pressinoic acid
CAS:<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/molNeuronostatin-13 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-13 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H112N20O17Purity:Min. 95%Molecular weight:1,445.71 g/molZ-Gly-Pro-bNA
CAS:<p>Z-Gly-Pro-bNA is a peptide that has been synthesized using recombinant DNA technology. It is a carboxyl peptidase inhibitor, which inhibits the enzyme aspartic proteases and metalloendopeptidases. Z-Gly-Pro-bNA has a specific substrate, namely tetrathionate, and it is efficient in hydrolyzing carboxyl groups. This inhibition of the catalytic activity of these enzymes leads to an increase in proline and calcitonin levels. The optimum pH for this reaction is 8.5 to 9.5 and the optimum concentration is 50 to 300 μM.</p>Formula:C25H25N3O4Purity:Min. 95%Molecular weight:431.48 g/molH-Gly-Gly-Pro-OH
CAS:<p>H-Gly-Gly-Pro-OH is a recombinant polypeptide with affinity for amino acids. It is a positionally defined sequence of amino acids that has been shown to bind to Alzheimer's disease (AD) amyloid peptides and inhibit the formation of beta amyloid fibrils. The N-terminal sequence of this polypeptide is immunogenic, which may be useful for generating antibodies against AD.</p>Formula:C9H15N3O4Purity:Min. 95%Molecular weight:229.23 g/molH-Pro-Thr-His-Ile-Lys-Trp-Gly-Asp-OH
CAS:<p>H-Pro-Thr-His-Ile-Lys-Trp-Gly-Asp-OH is a potent inhibitor of platelet activation, which is induced by nitroprusside. In vitro studies have shown that this peptide inhibits the expression of growth factors, such as platelet derived growth factor (PDGF), and inhibits PDGF activity. This peptide also has an inhibitory effect on nitroprusside, which may be due to its ability to inhibit PDGF expression. The inhibition of PDGF by this peptide may result in the potentiation of the effects of nitroprusside on blood pressure.</p>Formula:C44H64N12O12Purity:Min. 95%Molecular weight:953.05 g/molAc-D-Lys-OH
CAS:<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>Formula:C8H16N2O3Purity:Min. 95%Molecular weight:188.22 g/molL-Alanine methyl ester HCl
CAS:<p>L-Alanine methyl ester HCl is a compound that is used in wastewater treatment. It has been shown to inhibit the enzyme DPP-IV, which is associated with metabolic disorders. L-Alanine methyl ester HCl also has been shown to have antimicrobial activity against a number of bacteria, including methicillin resistant Staphylococcus aureus (MRSA). L-Alanine methyl ester HCl has been shown to have anti-inflammatory properties and can be used for the treatment of autoimmune diseases. This compound also has a significant effect on biological properties such as phase transition temperature and thermal expansion.</p>Formula:C4H10NO2ClPurity:Min. 95%Color and Shape:White PowderMolecular weight:139.58 g/molH-Val-Val-OH
CAS:<p>H-Val-Val-OH is a compound that has been shown to inhibit uptake of proton from the environment. It was found to be an effective inhibitor of both protein and lipid uptake in cell culture studies. These effects may be due to its ability to form hydrogen bonds with water molecules, which are required for transport across the membrane. FTIR spectroscopy data show that H-Val-Val-OH forms intermolecular hydrogen bonding with other molecules. Linear regression analysis of FTIR spectroscopic data on H-Val-Val-OH has revealed the presence of nitrogen atoms, which may play a role in its function as an inhibitor.</p>Formula:C10H20N2O3Purity:Min. 95%Molecular weight:216.28 g/molBAM-12P (7-12)
CAS:<p>Please enquire for more information about BAM-12P (7-12) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H52N12O9Purity:Min. 95%Molecular weight:712.8 g/molH-Val-Thr-Cys-Gly-OH
CAS:<p>Please enquire for more information about H-Val-Thr-Cys-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H26N4O6SPurity:Min. 95%Molecular weight:378.45 g/molH-D-Ser(SO3H)-OH
CAS:<p>Please enquire for more information about H-D-Ser(SO3H)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C3H7NO6SPurity:Min. 95%Molecular weight:185.16 g/molBoc-D-Asp-OFm
CAS:<p>Please enquire for more information about Boc-D-Asp-OFm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H25NO6Purity:Min. 95%Molecular weight:411.45 g/molH-Glu-Ser-Leu-Phe-OH
CAS:<p>Please enquire for more information about H-Glu-Ser-Leu-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H34N4O8Purity:Min. 95%Molecular weight:494.54 g/mol4-Bromophenylalanine
CAS:<p>4-Bromophenylalanine is a chemical compound that can be used as a spectroscopic probe to study the dynamics of protein synthesis. It is derived from 4-bromobenzaldehyde, which is oxidized by hydrogen peroxide in the presence of cytochrome P450 reductase and NADPH, yielding 4-bromophenylalanine. This compound has been shown to inhibit protein synthesis by binding reversibly to the synthetase during its synthetic cycle. The binding of 4-bromophenylalanine inhibits the synthesis of peptides with a C-terminal amide group. This inhibition leads to a decrease in the amount of functional groups present in proteins and an increase in the amount of buffers. These effects have been demonstrated through modelling studies using both model organisms and buffer solutions.</p>Formula:C9H10BrNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:244.09 g/molZ-Gly-Gly-Leu-AMC
CAS:<p>Z-Gly-Gly-Leu-AMC is a small molecule that inhibits the activity of certain enzymes, such as poly (ADP-ribose) polymerase (PARP), which are involved in DNA repair and DNA replication. It has been shown to be effective against cancer cells and is used for the treatment of various cancers, including breast cancer. Z-Gly-Gly-Leu-AMC has also been shown to have anti-inflammatory properties and may be useful for the treatment of autoimmune diseases. The drug binds to PARP, inhibiting its ability to interact with other proteins, thereby preventing activation of proapoptotic protein.</p>Formula:C28H32N4O7Purity:Min. 95%Molecular weight:536.58 g/molH-Ser-Leu-OH
CAS:<p>H-Ser-Leu-OH is a methylvaleric acid that is found in biological tissue and has been studied for its potential use as a pharmacological treatment. It has been shown to have anti-inflammatory effects, which may be due to its inhibition of prostaglandin synthesis. H-Ser-Leu-OH also inhibits the activity of divalent metal ions, such as magnesium and zinc, by binding to their chelating groups. This binding prevents the formation of an enzyme cell wall synthesis complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. H-Ser-Leu-OH has also shown potential as an analytical method for cancer detection. It can be used to detect carcinogenesis by detecting changes in DNA methylation patterns at the promoter region of tumor suppressor genes (e.g., RASSF1A).</p>Formula:C9H18N2O4Purity:Min. 95%Molecular weight:218.25 g/molAc-Leu-Glu-His-Asp-chloromethylketone
CAS:<p>Ac-Leu-Glu-His-Asp-chloromethylketone is a creatine kinase inhibitor that prevents the conversion of ATP to ADP. It inhibits mitochondrial pathways, leading to apoptotic and proapoptotic effects. Ac-Leu-Glu-His-Asp-chloromethylketone also has a kinetic effect on cells, where it causes necrotic cell death. This compound can cause proteolytic activity, which leads to the activation of caspase 9 and matrix metalloproteinases. Ac-Leu-Glu-His-Asp chloromethylketone has been shown to have antiinflammatory properties in cellular assays, as well as an ability to inhibit the synthesis of cellular proteins.</p>Formula:C24H35ClN6O9Purity:Min. 95%Molecular weight:587.02 g/molCortistatin-17 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H139N27O24S3Purity:Min. 95%Molecular weight:2,151.5 g/mol(D-Trp6)-LHRH (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H81N17O14Purity:Min. 95%Molecular weight:1,312.43 g/mol4-(Fmoc-hydrazino)-benzoylaminomethyl resin (200-400 mesh)
<p>Please enquire for more information about 4-(Fmoc-hydrazino)-benzoylaminomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%1-(3-Chloro-4-methoxyphenyl)acetone
CAS:<p>1-(3-Chloro-4-methoxyphenyl)acetone is a white solid with a melting point of 60-61°C. It is a versatile building block that can be used in the synthesis of complex compounds and as a reaction component for the preparation of speciality chemicals. 1-(3-Chloro-4-methoxyphenyl)acetone has been studied extensively as an intermediate for the synthesis of pharmaceuticals, including acetaminophen and amoxicillin. This compound also has uses in research laboratories and as a reagent in organic synthesis.</p>Formula:C10H11ClO2Purity:Min. 95%Molecular weight:198.65 g/molMyelin Basic Protein (83-99) (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C93H143N25O24Purity:Min. 95%Molecular weight:1,995.28 g/molH-Ala-Ala-Pro-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Pro-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O5·HClPurity:Min. 95%Molecular weight:413.86 g/molEndomorphin-2 trifluoroacetate salt
CAS:<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/molL-Threonine derivative-1
CAS:<p>L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.</p>Formula:C13H15NO6Purity:97.03% - 98.91%Color and Shape:SolidMolecular weight:281.26H-Val-Met-OH
CAS:<p>H-Val-Met-OH is a synthetic compound that was created to have a structure similar to the natural amino acid histidine. The synthesis of H-Val-Met-OH was achieved by reacting 2,5-diaminopentane with formaldehyde in the presence of cellulose acetate as a reaction medium. This process produced a white solid material that was then purified using chromatography. The purity and yield were confirmed by high performance liquid chromatography (HPLC) analysis and nuclear magnetic resonance (NMR). In vitro studies showed that H-Val-Met-OH promotes brain derived neurotrophic factor (BDNF) production in healthy Chinese adults. Clinical data also suggest that H-Val-Met-OH has beneficial effects on cognitive function in patients with mild cognitive impairment or Alzheimer's disease. Additionally, this compound has been shown to promote BDNF production in cultured mouse hippocampal neurons and enhance spatial memory retention in CD1 mice.</p>Formula:C10H20N2O3SPurity:Min. 95%Molecular weight:248.34 g/molCyclo(-Pro-Gly)3
CAS:<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O6Purity:Min. 95%Molecular weight:462.5 g/molH-Gly-Arg-Asp-Gly-Ser-OH
CAS:<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molHirudin (54-65) (sulfated)
CAS:<p>Hirudin is a protein that functions as an anticoagulant by binding to the active site of thrombin, preventing it from converting fibrinogen into fibrin. It has a high affinity for the thrombin receptor and can be modified in various ways. Hirudin's most common modification is sulfation, which enhances its anticoagulant activity. Hirudin is a proteolytic enzyme that can be synthesized using solid-phase chemistry. Its biological function is to inhibit blood coagulation by inhibiting the conversion of fibrinogen to fibrin. Hirudin binds to thrombin, preventing it from converting fibrinogen into fibrin and thus inhibits coagulation. It also prevents clot formation by inhibiting platelet aggregation, which may result from interactions with other proteins such as prothrombin and factor VIII.</p>Formula:C66H93N13O28SPurity:Min. 95%Molecular weight:1,548.58 g/molNeurotensin (1-8) Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-OH
CAS:<p>Neurotensin (NT) is a peptide that has been implicated in the regulation of feeding behavior, cardiovascular function, and pain perception. The neurotensin receptor is a G-protein coupled receptor with seven transmembrane domains. Neurotensin binds to the receptor and activates it by inducing intracellular calcium mobilization and neurotransmitter release. This activation can be dose-dependent, as seen in experiments using rat brain slices incubated with different concentrations of NT. Neurotensin also induces maximal activation at low concentrations, which may be due to its ability to bind to both extracellular and intracellular receptors. NT binds selectively to ventral tegmental area neurons from rats, leading to increased spontaneous firing rates. Cancer cells have been shown to express high levels of neurotensin receptors on their surface membrane, which may contribute to tumorigenesis and metastasis. Neurodegenerative diseases such as Alzheimer’s disease are thought to involve alterations in the expression or</p>Formula:C46H71N13O14Purity:Min. 95%Molecular weight:1,030.14 g/molH-Thr-Tyr-Ser-OH
CAS:<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molRetrocyclin-1 trifluoroacetate salt
CAS:<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/molBz-Tyr-4-Abz-OH·sodium salt
CAS:<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H19N2NaO5Purity:Min. 95%Molecular weight:426.4 g/molChloroac-DL-Phe-OH
CAS:<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>Formula:C11H12ClNO3Purity:Min. 95%Molecular weight:241.67 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H88N14O27Purity:Min. 95%Molecular weight:1,533.5 g/molAngiogenin (108-122)
CAS:<p>Please enquire for more information about Angiogenin (108-122) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H125N25O23Purity:Min. 95%Molecular weight:1,780.98 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS:<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>Formula:C15H23N3O10Purity:Min. 95%Molecular weight:405.36 g/molBoc-Ala-Gly-Sar-OH
CAS:<p>Please enquire for more information about Boc-Ala-Gly-Sar-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23N3O6Purity:Min. 95%Molecular weight:317.34 g/molL-Lysine methyl ester 2HCl
CAS:<p>L-Lysine methyl ester 2HCl is a lysine derivative that has been synthesized by reacting L-lysine with methanol and hydrochloric acid. This compound's cytotoxicity has been demonstrated in an inhibition study using calf thymus dna. L-Lysine methyl ester 2HCl contains amide, acid, and ester linkages, as well as hydrogen bonds that are typical of natural compounds. It is also biologically active and has a molecular weight of 246.3 g/mol. The chemical structure of this compound consists of a central l-lysine molecule with two methyl groups on the nitrogen atom. The compound also contains a carboxyl group on the end of the chain and an ester group on the second carbon atom from the end of the chain. L-Lysine methyl ester 2HCl can be found in soybeans and bovine fetal tissue. It exhibits morphological properties similar to other</p>Formula:C7H16N2O2·2HClPurity:Min. 95%Color and Shape:PowderMolecular weight:233.14 g/molZ-Ala-Ala-Lys-4MbetaNA formiate salt
CAS:<p>Please enquire for more information about Z-Ala-Ala-Lys-4MbetaNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H39N5O6·CH2O2Purity:Min. 95%Molecular weight:623.7 g/molExtracellular Death Factor trifluoroacetate salt
CAS:<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>Formula:C27H36N10O10Purity:Min. 95%Molecular weight:660.64 g/molZ-Trp-Leu-OH
CAS:<p>Please enquire for more information about Z-Trp-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29N3O5Purity:Min. 95%Molecular weight:451.51 g/mol(Trp11)-Neurotensin Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Trp-Ile-Leu-OH
CAS:<p>Neurotensin is a peptide hormone that is found in the brain and gastrointestinal tract. It stimulates the release of acetylcholine, histamine, and serotonin from nerve endings. Neurotensin acts as a neurotransmitter in the brain by binding to specific receptors on presynaptic nerve terminals. The amino acid sequence of neurotensin contains 11 amino acids: Trp-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Trp-Ile. It is labeled with azidobenzoyl (AB) and disuccinimidyl suberate (DSS) for autoradiography studies using gel electrophoresis. The molecular weight of neurotensin is approximately 7,200 daltons.</p>Formula:C80H122N22O19Purity:Min. 95%Molecular weight:1,695.96 g/mol(Trp7,β-Ala8)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Trp7,beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H57N9O10SPurity:Min. 95%Molecular weight:868.01 g/molSplenopentin acetate salt
CAS:<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>Formula:C31H51N9O9Purity:Min. 95%Molecular weight:693.79 g/molMet-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H47N9O8SPurity:Min. 95%Molecular weight:729.85 g/molFmoc-S-trityl-D-cysteine
CAS:<p>Fmoc-S-trityl-D-cysteine (Fmoc-SC) is a modified amino acid that is used in the synthesis of biomolecules. It can be synthesized using a stepwise process, starting with the reaction between cysteine and trityl chloride. Fmoc-SC has been shown to inhibit mitochondrial membrane potential and cell growth in cancer cells. Additionally, it has pharmacokinetic properties that make it suitable for intravenous administration. Fmoc-SC can also be used to modify proteins by reacting with hydroxyl groups on lysine residues and other nucleophiles, as well as to inhibit histone deacetylases (HDACs), which are enzymes that regulate transcriptional activity.</p>Formula:C37H31NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:585.71 g/molZ-Ala-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N10O6Purity:Min. 95%Molecular weight:690.79 g/moluPAR (84-95) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H98N18O20SPurity:Min. 95%Molecular weight:1,447.62 g/molH-Met-Gly-Gly-OH
CAS:<p>H-Met-Gly-Gly-OH is a tripeptide that has been synthesized and is used in microassays to measure the activity of methionine aminopeptidase. This enzyme hydrolyzes peptides with N-terminal amino acids such as methionine, which are derived from proteins. The activity of methionine aminopeptidase can be determined by measuring the release of H2O2, which is proportional to the concentration of peptides in the sample. The assay measures the change in absorbance at 340 nm on a spectrophotometer as a result of H2O2 production.</p>Formula:C9H17N3O4SPurity:Min. 95%Molecular weight:263.32 g/molBoc-δ-azido-Nva-OH·DCHA
CAS:<p>Please enquire for more information about Boc-delta-azido-Nva-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N4O4·C12H23NPurity:Min. 95%Molecular weight:439.59 g/molAdrenomedullin (11-50) (rat)
CAS:<p>Please enquire for more information about Adrenomedullin (11-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H304N58O59S4Purity:Min. 95%Molecular weight:4,521.11 g/molAc-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2
CAS:<p>Please enquire for more information about Ac-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H116N24O17Purity:Min. 95%Molecular weight:1,721.96 g/molSuc-Ala-Ala-Pro-Met-pNA
CAS:<p>Suc-Ala-Ala-Pro-Met-pNA is a proteolytic enzyme that is active at acidic pH and cleaves casein to produce smaller peptides. It has been shown to have anti-inflammatory effects in animal models of inflammatory diseases by inhibiting the production of vasoactive intestinal peptide and other inflammatory mediators. Suc-Ala-Ala-Pro-Met-pNA also has a high salt tolerance and can survive in the presence of chloromethyl ketone, which is used as a chemical tool for protein sequencing. The enzyme produces dodecyl as its cleavage product, which can be used to determine the optimal reaction conditions for this enzyme.</p>Formula:C26H36N6O9SPurity:Min. 95%Molecular weight:608.67 g/molBPP 5a Pyr-Lys-Trp-Ala-Pro-OH
CAS:<p>BPP 5a is an amide-based enzyme inhibitor with potent activity against bradykinin b2 receptor. It binds to the b2 receptor and inhibits its enzymatic activity, leading to a decrease in blood pressure. BPP 5a is orally administered and has been shown to be safe and effective in clinical trials. It also has potentiation effects that are mediated by the inhibition of kininases, which leads to a decrease in circulating levels of bradykinin. BPP 5a is used as a diagnostic aid for porcine kidney disease and has been shown to inhibit the production of monoclonal antibodies.</p>Formula:C30H41N7O7Purity:Min. 95%Molecular weight:611.69 g/molH-Lys-Glu-Thr-Tyr-Ser-Lys-OH
CAS:<p>Please enquire for more information about H-Lys-Glu-Thr-Tyr-Ser-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H54N8O12Purity:Min. 95%Molecular weight:754.83 g/molNociceptin (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H100N22O15Purity:Min. 95%Molecular weight:1,381.59 g/molZ-Ala-Gly-Gly-OH
CAS:<p>Z-Ala-Gly-Gly-OH is a hydrophobic amino acid that can be used in the treatment of cancers. It has been shown to interact with residues on lysine and aspartic acid, which may be due to its acidic properties. This compound is also able to bind metal ions such as copper and zinc, which may contribute to its anticancer potential. Z-Ala-Gly-Gly-OH also acts as a ligand for anticancer drugs such as carbonyl group or hydroxyl radicals.</p>Formula:C15H19N3O6Purity:Min. 95%Molecular weight:337.33 g/molCyclolinopeptide B Cyclo(-Pro-Pro-Phe-Phe-Val-Ile-Met-Leu-Ile)
CAS:<p>Please enquire for more information about Cyclolinopeptide B Cyclo(-Pro-Pro-Phe-Phe-Val-Ile-Met-Leu-Ile) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H83N9O9SPurity:Min. 95%Molecular weight:1,058.38 g/mol1-Methylbiguanide hyrdochloride
CAS:<p>1-Methylbiguanide hydrochloride is a pharmaceutical drug that has been shown to be an antidiabetic agent. It is a white crystalline powder with a melting point of about 180°C and a solubility in water of about 1 g/L. 1-Methylbiguanide hydrochloride is used for treating diabetes mellitus type 2, which is caused by insulin resistance. The drug works by stimulating the release of insulin from the pancreas and increasing the rate at which glucose enters cells. Studies have shown that 1-methylbiguanide hydrochloride has low biodegradability, but it can be removed from wastewater using an activated carbon column or hydrophilic interaction chromatography. 1-Methylbiguanide hyrdochloride has been shown to be safe for humans and may not cause side effects in people with kidney disease who take it as prescribed. This drug also does not interact with other medications, such as warfarin</p>Formula:C3H9N5·HClPurity:Min. 95%Molecular weight:151.6 g/molPneumadin (human)
CAS:<p>Please enquire for more information about Pneumadin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H70N12O14Purity:Min. 95%Molecular weight:955.07 g/molFmoc-Orn (Boc)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Orn (Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2,3-Dibromo-N-methylmaleimide
CAS:<p>2,3-Dibromo-N-methylmaleimide is a synthetic compound that can be used as an anticancer agent. It inhibits the proliferation of endothelial cells and induces apoptosis in cancer cells. The molecular structure of 2,3-Dibromo-N-methylmaleimide is similar to bisindolylmaleimides, which are naturally occurring compounds found in plants. 2,3-Dibromo-N-methylmaleimide is synthesized by cross coupling with magnesium and hydroxyl group using a vibrational spectroscopy technique called nmr spectra. This molecule also has amine groups that can be used for drug conjugation or activation.</p>Formula:C5H3Br2NO2Purity:Min. 95%Molecular weight:268.89 g/molH-Thr-Val-OH
CAS:<p>The peptidomimetic H-Thr-Val-OH is a synthetic molecule that is hydrophobic. It has been shown to activate epidermal growth factor (EGF) through the transduction of a signal from outside the cell to inside the cell. This activation of EGF leads to increased levels of other molecules, such as cytosolic amide and hydrogen bond, which are important for cell growth. The amino acid sequence of H-Thr-Val-OH resembles that of EGF, allowing it to bind to the same receptor site on cells. This binding activates signalling pathways that lead to increased levels of proteins involved in cell proliferation, migration, and differentiation.</p>Formula:C9H18N2O4Purity:Min. 95%Molecular weight:218.25 g/molH-β-Ala-Trp-OH
CAS:<p>Please enquire for more information about H-beta-Ala-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H17N3O3Purity:Min. 95%Molecular weight:275.3 g/molBiotinyl-Neuromedin S (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H279N55O46SPurity:Min. 95%Molecular weight:4,017.58 g/molH-Glu-Glu-bNA
CAS:<p>H-Glu-Glu-bNA is a dipeptide with the amino acid sequence H-Glu-Glu. It has a carboxy group, which can react with 2-naphthylamine to form a chromogenic product. This peptide also contains an amine group that can be reacted with l-glutamyl-l-glutamic acid to form a carboxylic acid. The c-terminal of this peptide can react with an amino group from another dipeptide to form a condensation product.</p>Formula:C20H23N3O6Purity:Min. 95%Molecular weight:401.41 g/molN-Methyl-N-((3R,4R)-4-methylpiperidin-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
CAS:<p>Intermediate in the synthesis of tofacitinib</p>Formula:C13H19N5Purity:Min. 95%Molecular weight:245.32 g/molpTH-Related Protein (1-16) (human, mouse, rat)
CAS:<p>Please enquire for more information about pTH-Related Protein (1-16) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H128N24O25Purity:Min. 95%Molecular weight:1,789.99 g/molFmoc-D-Ala-OH
CAS:<p>Fmoc-D-Ala-OH is a synthetic cyclic peptide that has been shown to have anticancer properties. This compound was synthesized by solid-phase chemistry and exhibits an inhibitory effect on cancer cells. Fmoc-D-Ala-OH blocks the synthesis of proteins in cancer cells, leading to cell death. It also inhibits the activity of serine proteases such as degarelix acetate, which are important for cancer cell growth and metastasis.</p>Formula:C18H17NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:311.33 g/molFmoc-D-Cys(Mob)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Cys(Mob)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5SPurity:Min. 95%Molecular weight:463.55 g/molTyr-Proinsulin C-Peptide (55-89) (human)
CAS:<p>Please enquire for more information about Tyr-Proinsulin C-Peptide (55-89) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H268N50O54Purity:Min. 95%Molecular weight:3,780.17 g/mol(3-Methyl-2-nitro-3H-imidazol-4-yl)methanol
CAS:<p>3-Methyl-2-nitro-3H-imidazol-4-yl)methanol is a fluorescent probe that can be used to detect hypoxic tumor cells. It has been shown to selectively react with the methylethyl group in Trichomonas vaginalis. 3-Methyl-2-nitro-3H-imidazol-4-yl)methanol is bioreductive and can be activated by nitro groups in proteins, which are found in the active site of enzymes such as bacterial dna gyrase. This probe has been shown to bind to the sn38 position of bacterial DNA, but not mammalian DNA.</p>Formula:C5H7N3O3Purity:Min. 95%Molecular weight:157.13 g/molH-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH
CAS:<p>H-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH is a synthetic peptide that has been shown to have a homologous sequence with the amino acid sequence of a primary tumor. This peptide has strong binding affinity to tyrosine kinase, which is an enzyme involved in cellular signal transduction. H-Arg-Arg-Leu-Ile-Glu-Asp-Asn Glu Tyr Thr Ala Arg Gly OH has been shown to inhibit the growth of tumors and can be used as an analytical method for identifying carcinoma cells in vitro. HAAGLTEIGDATASNTTAHARGLTRALAGRGGYOH is also a potential drug for cardiovascular diseases, as it can be taken up intracellularly and may inhibit the proliferation of vascular smooth muscle cells.</p>Formula:C66H109N23O23Purity:Min. 95%Molecular weight:1,592.71 g/molH-Ala-Pro-Ala-OH
CAS:<p>H-Ala-Pro-Ala-OH is a fluorescent amino acid residue that can be used to study the structures of proteins. This amino acid is derived from histidine, and its fluorescence intensity increases when it binds to tryptophan residues near the active site of an enzyme. H-Ala-Pro-Ala-OH has been used for the structural analysis of mutant enzymes that have been engineered to show differences in substrate binding sites. This molecule also has a fluorogenic substrate, which can be used as a replacement for traditional substrates in order to highlight specific regions of a protein or enzyme. The quantum theory was used to calculate the x-ray diffraction data, which were then analyzed using software programs such as MOLMOL and XPLOR. These datasets were then used to create molecular models of H-Ala-Pro-Ala-OH.</p>Formula:C11H19N3O4Purity:Min. 95%Molecular weight:257.29 g/molMCH-Gene-Overprinted-Polypeptide-27 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-27 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H227N39O40S4Purity:Min. 95%Molecular weight:3,284.86 g/molpTH (2-38) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H314N58O53S2Purity:Min. 95%Molecular weight:4,371.06 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/molZ-Tyr-Val-Ala-Asp-chloromethylketone
CAS:<p>Z-Tyr-Val-Ala-Asp-chloromethylketone is a fluorescent probe that can be used for the detection of phosphatidic acid. It is also an apoptosis inducer, which means that it promotes cell death. Z-Tyr-Val-Ala-Asp-chloromethylketone induces apoptosis by binding to the kinases and causing their activation, leading to phosphatidic acid production. This process is activated by the presence of ethylene, which binds to Z-Tyr-Val-Ala-Asp chloromethylketone and stabilizes its structure.</p>Formula:C30H37ClN4O9Purity:Min. 95%Molecular weight:633.09 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/molN-Methyl-4-oxo-4,5-dihydropyridine-3-carboxamide
CAS:<p>N-Methyl-4-oxo-4,5-dihydropyridine-3-carboxamide is a fine chemical that can be used as a reagent or intermediate. It is a versatile building block that can be used in the production of useful scaffolds or useful intermediates. This compound has been shown to react with many different types of chemicals, including alcohols and amines. N-Methyl-4-oxo-4,5-dihydropyridine-3-carboxamide can also be used as a reaction component in the synthesis of diverse compounds.</p>Formula:C7H8N2O2Purity:Min. 95%Color and Shape:White to grey solid.Molecular weight:152.15 g/molH-Arg-Ser-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H19N5O4Purity:Min. 95%Molecular weight:261.28 g/molH-Ala-Met-OH
CAS:<p>H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.</p>Formula:C8H16N2O3SPurity:Min. 95%Molecular weight:220.29 g/molH-Pro-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Pro-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O2·HClPurity:Min. 95%Molecular weight:297.78 g/molH-Gly-Leu-Leu-Gly-OH
CAS:<p>Please enquire for more information about H-Gly-Leu-Leu-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N4O5Purity:Min. 95%Molecular weight:358.43 g/molTrt-Met-OH·DEA
CAS:<p>Please enquire for more information about Trt-Met-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H25NO2S·C4H11NPurity:Min. 95%Molecular weight:464.66 g/molHCV Core Protein (59-68)
CAS:<p>Please enquire for more information about HCV Core Protein (59-68) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H91N21O12Purity:Min. 95%Molecular weight:1,178.39 g/molG Protein Antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2
CAS:<p>G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2 is a synthetic peptide that inhibits the activity of cyclase enzymes. It has been shown to inhibit skin cancer cells and has been shown to bind intracellular targets, such as protein kinase C, with high affinity. G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp--Met--NH2 has also been shown to inhibit the guanine nucleotide binding proteins (G proteins), which are necessary for cell signaling. G protein antagonist Pyr--Gln--D--Trp--Phe--D--Trp--D---Trp---Met---NH2 may also be used as an inhibitor of neurokinin 1 receptor activation and whole cell recordings have shown this drug to be potent antagonists of α subunit. G protein antagonist Pyr--Gln--D</p>Formula:C57H64N12O9SPurity:Min. 95%Molecular weight:1,093.26 g/molAc-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H146N24O23SPurity:Min. 95%Molecular weight:2,132.49 g/molAdrenomedullin (16-31) (human, pig)
CAS:<p>Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H129N25O21S2Purity:Min. 95%Molecular weight:1,865.19 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molRF9 trifluoroacetate salt
CAS:<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>Formula:C26H38N6O3Purity:Min. 95%Molecular weight:482.62 g/molCionin
CAS:<p>Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.</p>Formula:C53H63N11O19S3Purity:Min. 95%Molecular weight:1,254.33 g/mol5-Amino-2-methoxyisonicotinic acid
CAS:<p>5-Amino-2-methoxyisonicotinic acid is a carboxylic acid that is used in the synthesis of aminopyridines. The compound can be synthesized from formamidine acetate and diethyl dicarbonate. This process involves lithiation, followed by addition of an amine and finally conversion to the desired product with formamidine acetate. 5-Amino-2-methoxyisonicotinic acid can also be synthesized from formamide and diethyl ether. 5-Amino-2-methoxyisonicotinic acid is an analog of 2,4,6-trimethylaniline and has been shown to have similar properties to this compound, including strong basicity.</p>Formula:C7H8N2O3Purity:Min. 95%Molecular weight:168.15 g/molBoc-Gly-Gly-Leu-pNA
CAS:<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molDnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2
CAS:<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>Formula:C38H57N15O11SPurity:Min. 95%Molecular weight:932.02 g/molMCH-Gene-Overprinted-Polypeptide-14 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H132N22O18S3Purity:Min. 95%Molecular weight:1,786.24 g/molACTH (7-38) (human)
CAS:<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>Formula:C167H257N47O46Purity:Min. 95%Molecular weight:3,659.12 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/mol(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat)
CAS:<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H254N50O36Purity:Min. 95%Molecular weight:3,478.07 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molH-Gly-Gly-Arg-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/molH-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH
CAS:<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H77N13O11Purity:Min. 95%Molecular weight:1,156.33 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molBoc-Pro-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Tyr-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/molZ-Glu-Gly-OH
CAS:<p>Z-Glu-Gly-OH is a cysteine donor for the chemical cross-linking of keratin proteins. Follicle cells are a major source of keratin, and glutamic acid is the most abundant amino acid in these cells. Glutamine is also abundant in keratins, and may be responsible for the cornified layer. Cysteine is used to cross-link the structural proteins, while glutamic acid and glutamine are involved in cross-linking the fibre and residue. Cross-linking results in an insoluble protein matrix that provides strength to skin.</p>Formula:C15H18N2O7Purity:Min. 95%Molecular weight:338.31 g/molH-Lys(isopropyl)-OH
CAS:<p>Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H20N2O2Purity:Min. 95%Molecular weight:188.27 g/molFmoc-Ile-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O6Purity:Min. 95%Molecular weight:480.55 g/molH-Met-Thr-OH
CAS:<p>Met-Thr-OH is a peptide binding inhibitor that is used as a research tool for determining the role of metalloproteins in vivo. Methionine aminopeptidase (MetAP) is an enzyme that cleaves methionine from protein and peptides and has been shown to play a vital role in cancer progression. MetAP has been shown to be inhibited by Met-Thr-OH, which binds to the enzyme's active site and blocks its activity. The inhibition of MetAP limits the production of proteins involved in cell growth and proliferation, leading to reductions in tumor size. This inhibition may also be due to the inhibition of other functional groups such as phosphorylation, dephosphorylation, or nitrosylation.</p>Formula:C9H18N2O4SPurity:Min. 95%Molecular weight:250.32 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS:<p>Amide; Trifluoroacetate salt</p>Formula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/molH-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH
CAS:<p>Please enquire for more information about H-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N11O21PPurity:Min. 95%Molecular weight:1,118.05 g/mol(Deamino-Cys1,Leu4,Lys8)-Vasopressin trifluoroacetate salt
CAS:<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>Formula:C47H67N11O11S2Purity:Min. 95%Molecular weight:1,026.23 g/molH-Ser-Asp-Gly-Arg-Gly-OH
CAS:<p>H-Ser-Asp-Gly-Arg-Gly-OH is a peptide and model system for epidermal growth factor. It has been shown to stimulate epidermal growth and protein synthesis in the skin cells. The peptide has also been shown to inhibit fibrinogen production by monoclonal antibody, which is a biochemical marker of wound healing. H-Ser-Asp-Gly-Arg-Gly-OH analogs have been shown to inhibit the activation of epidermal growth factor receptor and have an inhibitory effect on cell growth.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/molAnti-Inflammatory Peptide 2
CAS:<p>Anti-inflammatory peptide 2 (AIP2) is a small peptide that has been shown to have anti-inflammatory activity. AIP2 inhibits the production of inflammatory mediators such as prostaglandins and leukotrienes. The synthesis of AIP2 is regulated by a hydroxyl group, which may be important for its therapeutic use. AIP2 does not have any side effects and can be used in the treatment of inflammation. <br>The active form of AIP2 is generated from the amino acid sequence H-His-Asp-Met-Asn-Lys-Val-Leu-Asp-Leu. It has been shown that this sequence also inhibits protein synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. <br>The molecular weight of AIP2 is 706 Da and it has two disulfide bonds and two ester linkages. The metal chelate was found to bind with</p>Formula:C46H77N13O15SPurity:Min. 95%Molecular weight:1,084.25 g/molFmoc-Tyr(Et)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5Purity:Min. 95%Molecular weight:431.48 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/molSuccinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
CAS:<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>Formula:C86H117N17O27Purity:Min. 95%Molecular weight:1,820.95 g/mol(Dab 9)-Neurotensin (8-13) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H60N10O8Purity:Min. 95%Molecular weight:760.92 g/molBoc-Arg(Tos)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Arg(Tos)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Antifreeze Polypeptide 6 (winter flounder) trifluoroacetate salt
CAS:<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>Formula:C133H225N43O51•xC2HF3O2Purity:Min. 95%Molecular weight:3,242.47 g/molBoc-Lys(Fmoc)-Leu-Ala-Leu-OH
CAS:<p>Please enquire for more information about Boc-Lys(Fmoc)-Leu-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H59N5O9Purity:Min. 95%Molecular weight:765.94 g/molAcetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH
CAS:<p>Please enquire for more information about Acetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H147N29O24SPurity:Min. 95%Molecular weight:2,135.45 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H100N22O14S3Purity:Min. 95%Molecular weight:1,449.77 g/molH-Pro-Glu-OH
CAS:<p>H-Pro-Glu-OH is a homologous peptide that belongs to the group of proteins. It is synthesized in the cells by polymerase chain reaction and can be used for diagnosis of infectious diseases. It has been shown to induce antibody response in mice. H-Pro-Glu-OH is also active against Mycobacterium tuberculosis, which may be due to its ability to bind to the tyrosine kinase domain on protein genes. This peptide has been shown to have anti-inflammatory properties, inhibiting fatty acid production and leading to necrotic cell death.</p>Formula:C10H16N2O5Purity:Min. 95%Molecular weight:244.24 g/mol1-Boc-1-methylhydrazine
CAS:<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/molH-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H71N11O12S2Purity:Min. 95%Molecular weight:1,166.37 g/molN-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine
CAS:<p>N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is a chiral, electron deficient reagent that reacts with aldehydes and boronic esters to form products with high chemical yields. This compound can be used as a catalyst for acylation reactions, such as the synthesis of p-nitrophenol. N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is synthesized by the reaction of trifluoroacetic acid and an amine, followed by chloroformate displacement. The product is then reacted with acylating agents in the presence of catalysts.</p>Formula:C13H23NOSiPurity:Min. 95%Color and Shape:Clear Colourless To Pale Yellow LiquidMolecular weight:237.41 g/molLys-Thymic Factor trifluoroacetate salt
CAS:<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H68N14O17Purity:Min. 95%Molecular weight:1,005.04 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molH-Gly-Leu-Phe-OH
CAS:<p>H-Gly-Leu-Phe-OH is a peptide that has been isolated from human macrophages. The peptide is homologous to the amino acid sequence of casein and has shown anti-inflammatory properties in the inhibition of the enzymatic reaction between casein and sodium citrate. When incubated with polymorphonuclear leukocytes, H-Gly-Leu-Phe-OH showed an inhibitory effect on their growth. This peptide also inhibited the enzymatic reaction between casein and sodium citrate, which may be due to its reversed phase high performance liquid chromatography (RP HPLC) method.</p>Formula:C17H25N3O4Purity:Min. 95%Molecular weight:335.4 g/mol3-Amino-2-methoxy-dibenzofuran
CAS:<p>3-Amino-2-methoxy-dibenzofuran (3AMD) is a cytotoxic agent that is used in the treatment of bladder carcinoma. 3AMD inhibits DNA synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. 3AMD has been shown to be a potent inhibitor of cyclen-dependent kinases and to induce DNA damage in human cells. 3AMD also has significant cytotoxicity against malignant cells and has been shown to inhibit the growth of tumours in mice. 3AMD may have carcinogenic potential due to its structural similarity with other carcinogens such as aniline and aminobiphenyl.</p>Purity:Min. 95%Molecular weight:213.23 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate
CAS:<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>Formula:C109H159N25O32S5•(C2H4O2)xPurity:Min. 95%Molecular weight:2,491.91 g/molLeptin (138-167) (human)
CAS:<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H224N37O47S2Purity:Min. 95%Molecular weight:3,253.64 g/mol1-O-Hexadecyl-sn-glycerol
CAS:<p>1-O-Hexadecyl-sn-glycerol is a glycol ether that is used as a surfactant and emulsifier in cosmetic products. It has been shown to have minimal toxicity, and to not be carcinogenic or teratogenic. 1-O-Hexadecyl-sn-glycerol has been shown to increase the stability of proteins in rat liver microsomes, and it also prevents the hydrolysis of carbohydrates. The surface glycoprotein adsorbed by 1-O-Hexadecyl-sn-glycerol may play an important role in the binding of monoclonal antibodies. This compound affects cellular calcium levels, with high concentrations resulting in increased cytosolic calcium concentrations. Zirconium oxide can replace calcium ions in 1-O-Hexadecyl-sn-glycerol for this purpose, although this substitution reduces enzyme activity.</p>Formula:C19H40O3Purity:Min. 95%Molecular weight:316.52 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/molH-Glu-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/molBoc-L-glutamic acid γ-methyl ester
CAS:<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>Formula:C11H19NO6Purity:Min. 95%Molecular weight:261.27 g/mol([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Ala-bNA·HBr
CAS:<p>H-Ala-bNA·HBr is a fluorogenic probe for pancreatic amide hydrolase that hydrolyzes the substrate H-Ala-bNA to release fluorescein. The probe has been used in enzymatic methods to identify and characterize the enzyme. The affinity of H-Ala-bNA·HBr for amide hydrolase is high and it can be used as a ligand to study the specificity of this enzyme. H-Ala-bNA·HBr can also be used as a fluorescent probe, with emission at 515 nm, and as a transfer reagent with an acceptor at 540 nm.</p>Formula:C13H14N2O·HBrPurity:Min. 95%Molecular weight:295.18 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Glu-OH
CAS:<p>H-Arg-Glu-OH is a small molecule that is used as a pharmacological agent for the treatment of diabetes. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of inflammatory mediators such as prostaglandin E2 and nitric oxide. H-Arg-Glu-OH also induces apoptosis in human monocytes and macrophages by binding to toll-like receptor 4 (TLR4) on the cell surface. This binding activates NFκB and JNK pathways, leading to the induction of apoptosis. H-Arg-Glu-OH binds with high affinity to monoclonal antibodies against glutamic acid and glycine, which are not present in humans. The compound may be toxic at a neutral pH because it is highly reactive due to intramolecular hydrogen bonding between carbonyl oxygens and amide hydrogens.</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/mol(Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H189N33O36Purity:Min. 95%Molecular weight:2,682 g/molH-Ile-His-OH
CAS:<p>H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.</p>Formula:C12H20N4O3Purity:Min. 95%Molecular weight:268.31 g/molZ-Gly-Gly-Gly-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about Z-Gly-Gly-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N6O9Purity:Min. 95%Molecular weight:494.46 g/molInfluenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt
CAS:<p>Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.</p>Formula:C63H90N14O16Purity:Min. 95%Molecular weight:1,299.47 g/molPrepro-Neuromedin S (70-103) (human) trifluoroacetate salt
<p>Please enquire for more information about Prepro-Neuromedin S (70-103) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H271N49O44SPurity:Min. 95%Molecular weight:3,857.45 g/molBiotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H176N32O32SPurity:Min. 95%Molecular weight:2,574.91 g/molZ-Phe-Leu-Ala-OH
CAS:<p>Z-Phe-Leu-Ala-OH is a homologous protein that has been shown to have proteolytic activity. It has a neutral pH and is stable in the presence of metal ions. This enzyme is structurally similar to subtilisin, with a sequence of residues containing two histidine residues, which are important for stability. The kinetic parameters of this enzyme were determined by analyzing its activity under different conditions and at different temperatures. The mutant Z-Phe-Leu-Ala-OH was found to be more active than the wild type at high temperature, but less active at low temperature, suggesting that the protein could be used as an industrial catalyst in food processing or chemical production.</p>Formula:C26H33N3O6Purity:Min. 95%Molecular weight:483.56 g/molMAGE-3 Antigen (168-176) (human) acetate salt
CAS:<p>Please enquire for more information about MAGE-3 Antigen (168-176) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H71N11O15Purity:Min. 95%Molecular weight:1,042.14 g/molAngiotensin II acetate salt
CAS:Controlled Product<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>Formula:C50H71N13O12·xC2H4O2Purity:Min. 95%Color and Shape:White SolidMolecular weight:1,046.18 g/mol(d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H79N13O10S2Purity:Min. 95%Molecular weight:1,086.38 g/molH-Arg-Phe-Asp-Ser-OH
CAS:<p>H-Arg-Phe-Asp-Ser-OH is a sequence of amino acids that is found in the protein collagen. It has been shown to be an inhibitor of human immunodeficiency virus type 1 (HIV1) and human insulin-like growth factor 2 (IGF2). In addition, H-Arg-Phe-Asp-Ser-OH is an important molecule for the production of monoclonal antibodies. H-Arg-Phe-Asp-Ser-OH is expressed in mammalian cells, including human cells, which are used as models to study the molecular interactions with HIV1 and IGF2. Monoclonal antibodies against H-Arg-Phe-Asp have been shown to inhibit the replication of HIV1.</p>Formula:C22H33N7O8Purity:Min. 95%Molecular weight:523.54 g/molN-α,ε-bis-Z-L-Lysine N-hydroxysuccinimide ester
CAS:<p>N-alpha,epsilon-bis-Z-L-Lysine N-hydroxysuccinimide ester is a methyl ester of the amino acid Lysine. This drug has been shown to have antinociceptive effects in animal models and may be useful for the treatment of inflammatory pain. The active conformation of this drug is dependent on the presence of hydroxybenzimidazole (HOBt). In the absence of HOBt, the compound does not have any activity. Acetylation or amidation may also affect its activity. The reaction with nitric acid yields a nitro derivative, which can be reduced back to the original compound by catalytic hydrogenation using palladium on carbon. A carboxylic acid group at the amino terminus can be converted to an amide or amido group by treatment with an appropriate reagent such as acetonitrile. This drug binds to a catalytic site on</p>Formula:C26H29N3O8Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:511.52 g/molCRAMP-18 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP-18 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H171N27O24Purity:Min. 95%Molecular weight:2,147.61 g/mol(Cys39)-Tissue Factor (33-53)
CAS:<p>Please enquire for more information about (Cys39)-Tissue Factor (33-53) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H166N26O33S2Purity:Min. 95%Molecular weight:2,456.79 g/mol4-Chloro-6-methoxyquinoline
CAS:<p>4-Chloro-6-methoxyquinoline is an inhibitor of bacterial DNA gyrase. It has antibacterial activity against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus, Enterococcus faecalis, and Pseudomonas aeruginosa. 4-Chloro-6-methoxyquinoline is a synthetic compound that was reinvestigated for its antibacterial activity. It has been shown to be effective in the treatment of Staphylococcal infections. The mechanism of action may involve inhibition of topoisomerase II or interference with the synthesis of DNA by binding to the enzyme bacterial DNA gyrase. Quinidine and cinchonidine are quinine derivatives that have been found to inhibit bacterial DNA gyrase. These compounds are found in the bark of Cinchona species, which includes Cinchona ledgeriana, Cinchona officinalis, and Cinchona succirub</p>Formula:C10H8ClNOPurity:Min. 95%Molecular weight:193.02944(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H251N49O40S2Purity:Min. 95%Molecular weight:3,625.2 g/molFmoc-p-phenyl-L-phenylalanine
CAS:<p>Fmoc-p-phenyl-L-phenylalanine (FMPP) is a fluorescent probe that can be used to detect and diagnose damage in tissues. It is a small molecule that has been shown to bind to myocytes and cardiac tissues, specifically targeting skeletal and cardiac muscle. FMPP binds to the amino acid phenylalanine, which is found in high concentrations in cardiac tissue. This binding causes an increase in fluorescence, which can be detected by light microscopy or flow cytometry. FMPP has been used to detect damage in heart muscles of mice with dilated cardiomyopathy and also as a probe for myocardial infarctions in humans.</p>Formula:C30H25NO4Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:463.52 g/molBiotinyl-ε-aminocaproyl-Tyr(PO3H2)-Glu-Glu-Ile-OH
CAS:<p>Please enquire for more information about Biotinyl-epsilon-aminocaproyl-Tyr(PO3H2)-Glu-Glu-Ile-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H62N7O16PSPurity:Min. 95%Molecular weight:972.01 g/mol(R)-N-Glycidylphthalimide
CAS:<p>R-N-Glycidylphthalimide is an enantioselective chiral reagent that is used to produce optically pure alcohols. It has been shown to have antibacterial activity in a number of carboxylic acid derivatives. R-N-Glycidylphthalimide was shown to be a good solvating agent, with the ability to form hydrogen bonds with water molecules and hydroxyl groups on proteins. R-N-Glycidylphthalimide is also useful for the synthesis of chiral amines, including ethylamine and amino acids, which are important in the pharmaceutical industry.</p>Formula:C11H9NO3Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:203.19 g/molH-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-e psilon-aminocaproyl-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-e psilon-aminocaproyl-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H152N34O14Purity:Min. 95%Molecular weight:1,790.26 g/molAc-Phe-Lys-OH
CAS:<p>Ac-Phe-Lys-OH is a synthetic peptide that mimics the lysine side chain of L-lysine. It has been shown to be cytotoxic to cancer cells and cardiac cells, with the formation rate of Ac-Phe-Lys-OH being dependent on the concentration of glycolaldehyde. The reaction yield for Ac-Phe-Lys-OH is also dependent on creatine kinase activity. Acetylation of Ac-Phe-Lys-OH reduces its cytotoxicity and increases its solubility in water.</p>Formula:C17H25N3O4Purity:Min. 95%Molecular weight:335.4 g/mol4-Bromo-2-fluoro-N-methylbenzamide
CAS:<p>4-Bromo-2-fluoro-N-methylbenzamide is an impurity in the pharmaceutical drug nilutamide. It is a ligand that binds to the androgen receptor and inhibits the binding of dihydrotestosterone, reducing its effect on prostate cells. 4-Bromo-2-fluoro-N-methylbenzamide has been shown to have pharmacokinetic properties similar to nilutamide, which is a drug used for treating prostate cancer. This impurity is also found in small quantities in other drugs including cyclobutanone, 2-aminoisobutyric acid, and chloral hydrate. The elucidation of these impurities can help regulate the quality of pharmaceutical drugs.</p>Formula:C8H7BrFNOPurity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:232.05 g/mol

