
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,465 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38248 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MAGE-1 Antigen (161-169) (human) acetate salt
CAS:<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>Formula:C41H57N11O17Purity:Min. 95%Molecular weight:975.96 g/molFmoc-Asn(Dod)-OH
CAS:<p>Fmoc-Asn(Dod)-OH is a pentafluorophenyl ester of the N-terminal tryptophan residue of an asparagine peptide. It is activated by alkylation with pentafluorophenyl bromoacetic acid, which attaches to the carbonyl carbon of the peptide backbone. The activated ester undergoes dehydration and amide formation in the presence of 4-methylbenzenesulfonyl chloride. This reagent can be used for efficient synthesis of peptides, such as proteins and enzymes.</p>Formula:C34H32N2O7Purity:Min. 95%Molecular weight:580.63 g/molH-Tyr-betaNA
CAS:<p>H-Tyr-betaNA is a synthetic substrate that has been used to study the binding activities of natural and synthetic opioid compounds. H-Tyr-betaNA binds to δ opioid receptors and inhibits the release of neurotransmitters such as acetylcholine, histamine, and serotonin. It also binds to δ-opioid receptors, which are involved in mediating pain responses. This compound has been shown to be an inhibitor of antinociceptive responses in rats, but it is not yet known whether it can cross the blood brain barrier. The pharmacokinetic properties of H-Tyr-betaNA have not been fully elucidated; however, it has been shown to be stable at neutral ph.</p>Formula:C19H18N2O2Purity:Min. 95%Molecular weight:306.36 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/molDynorphin A (1-6)
CAS:<p>Please enquire for more information about Dynorphin A (1-6) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H49N9O8Purity:Min. 95%Molecular weight:711.81 g/molH-Gly-Asp-Gly-OH
CAS:<p>H-Gly-Asp-Gly-OH is a tripeptide with an amino acid sequence of H-Gly-Asp-Gly. It has the following constants:</p>Formula:C8H13N3O6Purity:Min. 95%Molecular weight:247.21 g/molHippuryl-Phe-Arg-OH
CAS:<p>Hippuryl-Phe-Arg-OH is a potent and selective inhibitor of angiotensin-converting enzyme (ACE) with a long duration of action. It has been shown to be a potentiator of captopril and enalaprilat in the biochemical validation for ACE inhibition. Hippuryl-Phe-Arg-OH has significant inhibitory activity against phosphatases such as carboxypeptidase A, phospholipase A2, and aminopeptidase N.</p>Formula:C24H30N6O5Purity:Min. 95%Molecular weight:482.53 g/molAcetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H193N37O26SPurity:Min. 95%Molecular weight:2,638.15 g/molH-Leu-Leu-Tyr-OH
CAS:<p>H-Leu-Leu-Tyr-OH is a water soluble polymer that is produced by the enzymatic polymerization of L-leucine and L-tyrosine. This polymer is cytotoxic and has been shown to bind to DNA in the cell nucleus, as well as inhibit protein synthesis. H-Leu-Leu-Tyr-OH was developed as an alternative to polyethylene glycol (PEG) due to its low toxicity, high biocompatibility, and ability to be easily synthesized.</p>Formula:C21H33N3O5Purity:Min. 95%Molecular weight:407.5 g/molFmoc-Tyr-Ala-diazomethylketone
CAS:<p>Please enquire for more information about Fmoc-Tyr-Ala-diazomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H26N4O5Purity:Min. 95%Molecular weight:498.53 g/molZ-His-Gly-OH
CAS:<p>Please enquire for more information about Z-His-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molCortistatin-17 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H139N27O24S3Purity:Min. 95%Molecular weight:2,151.5 g/molFmoc-Asp(OtBu)-Ser(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Asp(OtBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H34N2O8Purity:Min. 95%Molecular weight:538.59 g/molH-Gly-Gly-b-Ala-Gly-OH
CAS:<p>Please enquire for more information about H-Gly-Gly-b-Ala-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H16N4O5Purity:Min. 95%Molecular weight:260.25 g/molSubstance P (2-11)
CAS:<p>Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a peptide that is the product of proteolytic cleavage of substance P. It binds to the neurokinin receptor and induces degranulation in mast cells and sensory neurons. It has been used as a diagnostic tool for mast cell degranulation. Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe has also been used to assess lung function in anesthetized animals, circulations in muscle, and changes in perfusion during surgical procedures.</p>Formula:C57H86N14O12SPurity:Min. 95%Molecular weight:1,191.45 g/mol(Ala13)-Apelin-13 (human, bovine, mouse, rat) acetate salt
CAS:<p>Apelin-13 is a peptide hormone that is secreted from the stomach and small intestine. It may have analgesic effects through its interaction with μ-opioid receptors, which are also activated by morphine. Apelin-13 has been shown to increase locomotor activity in rats, suggesting it can potentiate the antinociceptive effect of morphine.</p>Formula:C63H107N23O16S·xC2H4O2Purity:Min. 95%Molecular weight:1,474.74 g/molN-Fmoc-L-γ-carboxyglutamic acid γ,γ-di-t-butyl ester
CAS:<p>Please enquire for more information about N-Fmoc-L-gamma-carboxyglutamic acid gamma,gamma-di-t-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H35NO8Purity:Min. 95%Molecular weight:525.59 g/molZ-Phe-OBzl
CAS:<p>Z-Phe-OBzl is an opioid drug that has been used as a research tool for studying the effects of opioid drugs on the nervous system. Z-Phe-OBzl is a synthetic peptide with a high affinity for opioid receptors. It has been shown to be a potent natural product antagonist and endogenous agonist, which may be useful in the treatment of pain. The oral bioavailability of Z-Phe-OBzl has also been reported to be greater than 90%.</p>Formula:C24H23NO4Purity:Min. 95%Molecular weight:389.44 g/molHIV Protease Substrate III-B (Native Sequence)
CAS:<p>Please enquire for more information about HIV Protease Substrate III-B (Native Sequence) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H90N18O14SPurity:Min. 95%Molecular weight:1,211.44 g/molBoc-Asp(OcHex)-Merrifield resin (100-200 mesh)
<p>Please enquire for more information about Boc-Asp(OcHex)-Merrifield resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Gly-Ala-His-AMC
CAS:<p>Please enquire for more information about Z-Gly-Ala-His-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N6O7Purity:Min. 95%Molecular weight:574.58 g/molLeu-Enkephalin (sulfated)
CAS:<p>Leu-Enkephalin (sulfated) H-Tyr(SO3H)-Gly-Gly-Phe-Leu-OH is an endogenous opioid peptide that has been found in the central nervous system. It was first discovered by radioimmunoassays of brain tissue and then later found to be present in other tissues. Leu-enkephalin is not acidic, but it can form a salt with sulfonic acid or carboxylate, which may account for its ability to bind to receptors on cell membranes. The molecular weight of leu-enkephalin is 921.5 daltons and it contains one sulfonation group and one glycosylation site. Leu-enkephalin (sulfated) H-Tyr(SO3H)-Gly-Gly-Phe-Leu-OH can be synthesized from the amino acids Glycine, Tyr(SO</p>Formula:C28H37N5O10SPurity:Min. 95%Molecular weight:635.69 g/mol(D-Trp6)-LHRH (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H81N17O14Purity:Min. 95%Molecular weight:1,312.43 g/mol2-(Aminomethyl)-2-methyl-1,3-propanediamine trihydrochloride
CAS:<p>Please enquire for more information about 2-(Aminomethyl)-2-methyl-1,3-propanediamine trihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H15N3•(HCl)3Purity:Min. 95%Color and Shape:PowderMolecular weight:226.57 g/molBiotinyl-5-aminopentanoyl-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-5-aminopentanoyl-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C119H192N38O22S2Purity:Min. 95%Molecular weight:2,571.17 g/molFmoc-Asn(Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Cys-Gly-OH
CAS:<p>H-Gly-Cys-Gly-OH is an amino acid sequence that has been evaluated for its interactions with other amino acids and proteins. It is a tripeptide heterocycle and can be found in the tissues of many organisms, including humans. H-Gly-Cys-Gly-OH can be found in bovine serum and has been shown to have reversed phase high performance liquid chromatography activity. This molecule also interacts with reversed phase high performance liquid chromatography, ion exchange, and tripeptides.</p>Formula:C7H13N3O4SPurity:Min. 95%Molecular weight:235.26 g/molMca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H82N16O17SPurity:Min. 95%Molecular weight:1,403.52 g/molFmoc-D-Cys(Bzl)-OH
CAS:<p>The compound Fmoc-D-Cys(Bzl)-OH is a chiral homologue of the protonated amino acid D-Cys. The configuration of the proton in this molecule has been determined by proton nmr experiments. This compound is synthesized from the racemic mixture by reductive amination and deprotonation with sodium borohydride. The reagents are an organophosphate and an ester, which react in order to form a new carbon-carbon bond. The postulated enantiomers are screened for their activity against phospholipase A2, which cleaves ester bonds on phospholipids. One enantiomer has been shown to have more potent activity than its counterpart, suggesting that it is the desired product.</p>Formula:C25H23NO4SPurity:Min. 95%Molecular weight:433.52 g/molAcetyl-Amylin (8-37) (mouse, rat)
CAS:<p>Please enquire for more information about Acetyl-Amylin (8-37) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O44Purity:Min. 95%Molecular weight:3,242.6 g/molNeurokinin A trifluoroacetate salt
CAS:<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>Formula:C50H80N14O14SPurity:Min. 95%Molecular weight:1,133.32 g/mol(H-Cys-allyl ester)2·2 p-tosylate (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-allyl ester)2·2 p-tosylate (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N2O4S2·2C7H8O3SPurity:Min. 95%Molecular weight:664.84 g/molBoc-Ala-Gly-OSu
CAS:<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N3O7Purity:Min. 95%Molecular weight:343.33 g/mol4-(Fmoc-hydrazino)-benzoylaminomethyl resin (200-400 mesh)
<p>Please enquire for more information about 4-(Fmoc-hydrazino)-benzoylaminomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H300N54O59S2Purity:Min. 95%Molecular weight:4,432.95 g/molL-Phenylalanine benzyl ester hydrochloride
CAS:<p>L-Phenylalanine benzyl ester hydrochloride is an ester of L-phenylalanine and benzoic acid. It has a solubility of 1.9g/L in water, 2.1g/L in methanol, and 0.8g/L in acetonitrile at 20°C. The melting point is 119°C to 120°C and the boiling point is 243°C to 244°C at atmospheric pressure. This compound can be synthesized by reacting formamide with L-phenylalanine chloride in the presence of hexamethylphosphoramide as a catalyst.</p>Formula:C16H17NO2·HClPurity:Min. 95%Molecular weight:291.77 g/molZ-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>Formula:C30H43FN4O11Purity:Min. 95%Molecular weight:654.68 g/molH-Tyr-AMC·TFA
CAS:<p>Please enquire for more information about H-Tyr-AMC·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H18N2O4·C2HF3O2Purity:Min. 95%Molecular weight:452.38 g/molHIV Protease Substrate VII
CAS:<p>Please enquire for more information about HIV Protease Substrate VII including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H81N15O14Purity:Min. 95%Molecular weight:1,140.29 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/mol2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol
CAS:<p>2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol is an impurity in hexane that is generated during the reaction of pyridine with acetonitrile. The impurity is removed by crystallizing it from methanol. 2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol has a high efficiency, and can be used to synthesize hexamethyldisiloxane. This product can be used as a metal catalyst for reactions involving alkali metals or metal halides. It can also be used as an alcohol solvent, but not hydrogenated.</p>Formula:C17H21N3OPurity:Min. 95%Color and Shape:White to off white powderMolecular weight:283.37 g/molCyclo(-Glu-Glu)
CAS:<p>Please enquire for more information about Cyclo(-Glu-Glu) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N2O6Purity:Min. 95%Molecular weight:258.23 g/molPz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt
CAS:<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>Formula:C38H52N10O8Purity:Min. 95%Molecular weight:776.88 g/molZ-Val-Ala-OMe
CAS:<p>Z-Val-Ala-OMe is an anti-leishmanial agent that has been shown to be a more efficient method for the treatment of leishmaniasis than current treatments. It inhibits the growth of Leishmania by inhibiting serine proteases, which are involved in the formation of amorphous material on the surface of these parasites. Z-Val-Ala-OMe is active against both subtilis and licheniformis, with a residue half life of 3 hours at pH 5.5 and 20 degrees Celsius. This drug binds to the surface of Leishmania parasites and inhibits their ability to metabolize phosphite into ethyl esters.<br>The kinetic data obtained from Z-Val-Ala-OMe was measured using immobilized cells in a microtiter plate assay system. The data collected was used to generate a graph showing an initial burst phase followed by a linear phase for up to 72 hours post incubation with the drug</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molLeech Osmoregulatory Factor
CAS:<p>Leech Osmoregulatory Factor H-Ile-Pro-Glu-Pro-Tyr-Val-Trp-Asp-OH (LOF) is a polyunsaturated peptide that regulates osmotic pressure. It has been purified from the leech Hirudo medicinalis and can be used in diagnosis or treatment of eye disorders, such as diabetic neuropathy, or in the treatment of diseases associated with high blood viscosity. LOF binds to the surface of cells and induces changes in cell shape. The binding of LOF to receptors on the cell membrane triggers receptor binding and subsequent activation of ion channels. This leads to an increase in water permeability across the cell membrane and increases the glomerular filtration rate. LOF also binds to monoclonal antibodies that are specific for eye disorders or other conditions associated with high blood viscosity, which may be useful for diagnosis or treatment.</p>Formula:C50H67N9O14Purity:Min. 95%Molecular weight:1,018.12 g/mol1-(3-Chloro-4-methoxyphenyl)acetone
CAS:<p>1-(3-Chloro-4-methoxyphenyl)acetone is a white solid with a melting point of 60-61°C. It is a versatile building block that can be used in the synthesis of complex compounds and as a reaction component for the preparation of speciality chemicals. 1-(3-Chloro-4-methoxyphenyl)acetone has been studied extensively as an intermediate for the synthesis of pharmaceuticals, including acetaminophen and amoxicillin. This compound also has uses in research laboratories and as a reagent in organic synthesis.</p>Formula:C10H11ClO2Purity:Min. 95%Molecular weight:198.65 g/molLHRH (sea bream)
CAS:<p>Please enquire for more information about LHRH (sea bream) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H68N14O14Purity:Min. 95%Molecular weight:1,113.18 g/molHuman CMV pp65 (495-503) trifluoroacetate salt
CAS:<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H74N10O12SPurity:Min. 95%Molecular weight:943.16 g/molAtrial Natriuretic Factor (1-28) (human) hydrochloride salt
CAS:Controlled Product<p>Please enquire for more information about Atrial Natriuretic Factor (1-28) (human) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H203N45O39S3Purity:Min. 95%Molecular weight:3,080.45 g/molType A Allatostatin III
CAS:<p>Please enquire for more information about Type A Allatostatin III including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H62N10O12Purity:Min. 95%Molecular weight:899 g/molSauvagine trifluoroacetate salt
CAS:<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>Formula:C202H346N56O63SPurity:Min. 95%Molecular weight:4,599.31 g/molProcathepsin B (26-50) (rat)
CAS:<p>Please enquire for more information about Procathepsin B (26-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H198N34O33SPurity:Min. 95%Molecular weight:2,713.16 g/molMyelin Basic Protein (83-99) (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C93H143N25O24Purity:Min. 95%Molecular weight:1,995.28 g/molFmoc-N-Me-Asp(OBzl)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-Asp(OBzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H25NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:459.49 g/molFmoc-Ser(tBu)-Ser(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Ser(tBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H34N2O7Purity:Min. 95%Molecular weight:510.58 g/molH-Gly-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Gly-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O2·HClPurity:Min. 95%Molecular weight:257.72 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H228N38O51Purity:Min. 95%Molecular weight:3,259.53 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H203N41O38Purity:Min. 95%Molecular weight:3,080.37 g/mol(Phe1-psi(CH2NH)Gly2)-Nociceptin (1-13) amide
<p>Please enquire for more information about (Phe1-psi(CH2NH)Gly2)-Nociceptin (1-13) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H102N22O14Purity:Min. 95%Molecular weight:1,367.6 g/molDynorphin B (1-9)
CAS:<p>Please enquire for more information about Dynorphin B (1-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H78N16O12Purity:Min. 95%Molecular weight:1,143.3 g/molAtrial Natriuretic Factor (5-27) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H154N34O32S3Purity:Min. 95%Molecular weight:2,404.67 g/molH-Ala-Ala-Pro-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Pro-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O5·HClPurity:Min. 95%Molecular weight:413.86 g/molH-Cys-Thr-Thr-His-Trp-Gly-Phe-Thr-Leu-Cys-OH (Disulfide bond)
CAS:<p>Disulfide bond is a protein that regulates muscle cell assembly and interactions. Disulfide bonds are formed by the oxidation of two cysteine molecules, which can be found in the extracellular matrix (ECM). The protein is an important regulator of metalloproteinases, which are enzymes that regulate ECM turnover. When disulfide bond lacks, it causes a deficiency in collagen production. Disulfide bond also has interactions with MMP-2, which plays a role in the regulation of arteriosclerosis and genetic disorders such as muscular dystrophy.</p>Formula:C52H71N13O14S2Purity:Min. 95%Molecular weight:1,166.33 g/molN-Boc-cis-3,4-methylene D-proline
CAS:<p>Please enquire for more information about N-Boc-cis-3,4-methylene D-proline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H17NO4Purity:Min. 95%Molecular weight:227.26 g/molN-Methyl-2-fluoro-4-aminobenzamide
CAS:<p>N-Methyl-2-fluoro-4-aminobenzamide is a toxic compound that is commonly used as a reagent in chemical synthesis and research. It has been studied for its potential use in medicine, particularly in the treatment of castration-resistant prostate cancer. N-Methyl-2-fluoro-4-aminobenzamide acts as a nucleophilic agent, participating in reactions that involve the addition of an acyl group to a target molecule. Its stable formyl group allows for efficient reaction yields and reliable results. However, due to its toxic nature, caution must be exercised when handling this compound.</p>Formula:C8H9FN2OPurity:Min. 95%Molecular weight:168.17 g/mol2-Phenylpyridine
CAS:<p>2-Phenylpyridine is a heterocyclic organic compound that has been shown to have x-ray crystal structures. It has redox potentials, nitrogen atoms, and a fatty acid group attached. 2-Phenylpyridine has been shown to have nmr spectra that are characteristic of a transfer reaction mechanism. The steric interactions and the biphenyl groups have been shown to have ancillary effects on the reaction mechanism. 2-Phenylpyridine is also known to coordinate in a geometric shape called octahedral, which is most likely due to hydrogen bonding and photophysical properties. The analytical chemistry of this molecule consists of determining its melting point, boiling point, and density. 2-phenylpyridine</p>Formula:C11H9NPurity:Min. 95%Molecular weight:155.2 g/molpTH (28-48) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H150N28O29Purity:Min. 95%Molecular weight:2,148.38 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/molFmoc-D-Trp(Boc)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Trp(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Suc-Ala-Ala-Pro-Phe-2,4-difluoroanilide
CAS:<p>Please enquire for more information about Suc-Ala-Ala-Pro-Phe-2,4-difluoroanilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H35F2N5O7Purity:Min. 95%Molecular weight:615.63 g/molH-Gly-Gly-His-OH
CAS:<p>H-Gly-Gly-His-OH is a molecule that is found in human serum. It is a ligand with coordination properties and has been shown to bind to copper. H-Gly-Gly-His-OH has been studied spectroscopically in the presence of human serum albumin, and it has been observed that the protonation state and interaction of this molecule are dependent on the speciation and concentration of copper.</p>Formula:C10H15N5O4Purity:Min. 95%Molecular weight:269.26 g/molH-Lys-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N6O5Purity:Min. 95%Molecular weight:388.46 g/molBiotinyl-epsilonAhx-ω-Conotoxin GVIA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about Biotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H207N41O46S7Purity:Min. 95%Molecular weight:3,376.81 g/molZ-Ala-Pro-OH
CAS:<p>Z-Ala-Pro-OH is a synthetic, analog substrate for serine proteases. It is used as a target cell for schistosomiasis, which are parasitic worms that infect humans and cause the disease. The molecule is localized in the digestive tract of the parasite, where it has biochemical properties that are analogous to those found in the natural substrate (serine protease) of this organism. Z-Ala-Pro-OH has been shown to inhibit the growth of various species of schistosomes, including Schistosoma mansoni. It also has immunoregulatory properties and can be used to stimulate antibody production by B cells when combined with an antigen.</p>Formula:C16H20N2O5Purity:Min. 95%Molecular weight:320.34 g/molBoc-Phe-Phe-OH
CAS:<p>Boc-Phe-Phe-OH is a linker that is used to create homologues. It has been shown to be able to form supramolecular structures and encapsulate biomolecules, such as amino acids. The ester linkage of Boc-Phe-Phe-OH can be modified by the addition of a carboxylic acid, which can lead to changes in its fluorescence and magnetic properties. Boc-Phe-Phe-OH is primarily used as an intermediate for fluorescent probes or other molecules.</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molH-Gly-b-Ala-b-Ala-OH
CAS:<p>Please enquire for more information about H-Gly-b-Ala-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molInsulin B (22-25)
CAS:<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N7O5Purity:Min. 95%Molecular weight:525.6 g/molCyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala)
CAS:<p>Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) is a cyclic peptide that has a conformational interaction with fibrinogen. Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) binds to the FGA binding site on fibrinogen, preventing the formation of the fibrin clot. Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) has been shown to activate platelets, which may be due to its ability to increase levels of cAMP and activate protein kinase A. Cyclo(-Gly-Arg-Gly-Asp-) also has an affinity for monoclonal antibodies, which may be due to its high molecular electrostatic potential or its synthetic nature.</p>Formula:C25H40N10O10Purity:Min. 95%Molecular weight:640.65 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H85N19O13Purity:Min. 95%Molecular weight:1,208.37 g/molN1-Glutathionyl-spermidine disulfide [
CAS:<p>N1-Glutathionyl-spermidine disulfide (N1-GS) is a molecule that has been shown to have clinical use in the treatment of chronic hepatitis C infection. The N1-GS molecule is composed of a glutathione (GSH) scaffold with two sulfhydryl groups and an amino acid side chain. N1-GS has a hydrophobic nature, which allows it to penetrate the cellular membrane and enter cells. It is also able to form hydrogen bonds and act as a catalyst for reactions. Fluorescence analysis revealed that this molecule is selective for disulfides over thiols, amines, or alcohols. Disulfides are very important in biological systems since they can be found in enzymes, proteins, and cellular membranes. The insolubility of the N1-GS molecule makes it difficult to analyze its structure using traditional methods such as gas chromatography or nuclear magnetic resonance spectroscopy. However, fluorescence</p>Formula:C34H66N12O10S2Purity:Min. 95%Molecular weight:867.09 g/mol(Val4)-Angiotensin III
CAS:<p>Please enquire for more information about (Val4)-Angiotensin III including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H64N12O9Purity:Min. 95%Molecular weight:917.07 g/molLauroyl lysine
CAS:<p>Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.</p>Formula:C18H36N2O3Purity:99.18%Color and Shape:White To Off-White Solid With Characteristic Faint OdorMolecular weight:328.491b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid
CAS:<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H35FN2O7Purity:Min. 95%Molecular weight:590.64 g/molGLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H248N42O52Purity:Min. 95%Molecular weight:3,784.1 g/molBiotinyl-MCH (salmon) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H153N29O26S5Purity:Min. 95%Molecular weight:2,325.78 g/molFmoc-3-(2-naphthyl)-L-alanine
CAS:<p>Fmoc-3-(2-naphthyl)-L-alanine is a supramolecular compound that functions as an inhibitor of prostate cancer cells. It inhibits the uptake of metal chelates by prostate cancer cells and stabilizes them, which may lead to a diagnostic and therapeutic agent for prostate cancer. Fmoc-3-(2-naphthyl)-L-alanine has also been shown to inhibit the growth of human serum prostate cancer cells in vitro and in vivo models. This molecule is a bifunctional compound that can be used as both an antigen and a surrogate for cytosolic prostate specific antigen (PSA) levels. Fmoc-3-(2-naphthyl)-L-alanine has been shown to bind to the PSA protein, which is normally found on the surface of prostate epithelial cells. This binding prevents it from being released into the blood circulation, where it would otherwise be measured by a PSA test</p>Formula:C28H23NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:437.49 g/molKALA Amphipathic Peptide
CAS:<p>Please enquire for more information about KALA Amphipathic Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C144H248N40O35SPurity:Min. 95%Molecular weight:3,131.82 g/molFITC-b-Ala-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about FITC-b-Ala-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C227H327N57O66S2Purity:Min. 95%Molecular weight:4,974.5 g/molFmoc-Leu-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Leu-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%HIV (gp41) Fragment
CAS:<p>HIV (gp41) Fragment H-Ala-Val-Gly-Ile-Gly-Ala-OH is a hydrophobic peptide fragment that is used as an antigen to induce immunity against HIV infection. The sequence of the peptide was obtained by sequencing the human immunodeficiency virus type 1 (HIV). The peptide contains glutamic acid and ornithine, which are necessary for the attachment of gp41 to the target cell surface and for the penetration of the virus into cells. The cyclic peptide induces mononuclear phagocytes to produce antibodies against gp41, which can inhibit infection by HIV.</p>Formula:C21H38N6O7Purity:Min. 95%Molecular weight:486.56 g/mol1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine
CAS:<p>Please enquire for more information about 1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H76NO8PPurity:Min. 95%Molecular weight:718 g/molEndomorphin-2 trifluoroacetate salt
CAS:<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/molBoc-L-isoleucine
CAS:<p>Please enquire for more information about Boc-L-isoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21NO4Purity:Min. 95%Molecular weight:231.29 g/mol2'-Methoxy-α-naphthoflavone
CAS:<p>2'-Methoxy-alpha-naphthoflavone is a fine chemical that can be synthesized from naphthalene, benzaldehyde, and methoxyacetic acid. It is a versatile building block for research chemicals and has been shown to have high quality. 2'-Methoxy-alpha-naphthoflavone has been used as a reaction component in the synthesis of complex compounds with interesting biological activities.</p>Formula:C20H14O3Purity:Min. 95%Molecular weight:302.32 g/mol(D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H290N56O56Purity:Min. 95%Molecular weight:4,338.75 g/molACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Formula:C44H59N13O10SPurity:Min. 95%Molecular weight:962.09 g/molH-Gly-Gly-Lys-Arg-OH acetate salt
CAS:<p>The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.</p>Formula:C16H32N8O5Purity:Min. 95%Molecular weight:416.48 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H47FN4O15Purity:Min. 95%Molecular weight:878.85 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS:<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>Formula:C54H56N6O13Purity:Min. 95%Molecular weight:997.06 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/molBoc-Asn-o-nitrophenyl ester
CAS:<p>Please enquire for more information about Boc-Asn-o-nitrophenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O7Purity:Min. 95%Molecular weight:353.33 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H129N25O25SPurity:Min. 95%Molecular weight:2,005.22 g/molMethyltetrazine amine
CAS:<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>Formula:C10H11N5Purity:Min. 95%Color and Shape:PowderMolecular weight:201.23 g/molNeurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H52N8O12Purity:Min. 95%Molecular weight:776.83 g/molFmoc-glu-OAll
CAS:<p>Fmoc-glu-OAll is a cyclic peptide that is synthesized using solid-phase synthesis. It has been shown to have minimal inhibitory concentration (MIC) values of 0.5 µg/mL against mouse tumor cells and human serum, as well as high affinity for integrin receptors. This peptide also binds to the human serum albumin and blood clotting factor Xa, which are proteins involved in cancer therapy.</p>Formula:C23H23NO6Purity:Min. 95%Molecular weight:409.43 g/molBoc-Thr(Gly-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Gly-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H30N2O8Purity:Min. 95%Molecular weight:498.53 g/molZ-Gly-Gly-NH2
CAS:<p>Z-Gly-Gly-NH2 is a synthetic peptide that has been shown to inhibit the activity of phosphatases, which are enzymes that hydrolyze phosphate groups from phosphorylated substrates. It is a hydrophobic and metal chelator, which makes it suitable for use in chromaffin cells and dorsal root ganglia. Z-Gly-Gly-NH2 has been shown to be specific for inhibition of synaptic phosphatase (PP1). This compound also inhibits the enzyme inhibitor subtilisin, which is found in bacteria such as Streptomyces or Bacillus subtilis. Z-Gly-Gly-NH2 has been shown to have a high affinity for receptors.</p>Formula:C12H15N3O4Purity:Min. 95%Molecular weight:265.27 g/molBombesin (8-14) acetate salt
CAS:<p>Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt is a bifunctional peptide that has been shown to inhibit the growth of prostate cancer cells. Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt also has antiinflammatory properties and is used in treating inflammatory diseases. It inhibits collagen synthesis and fibrinogen activation, which may be important in the treatment of autoimmune diseases such as rheumatoid arthritis. Bombesin (8 14) acetate salt H Trp Ala Val Gly His Leu Met NH2 Acetate Salt has been shown to have no effect on healthy tissues when administered systemically.</p>Formula:C38H57N11O7SPurity:Min. 95%Molecular weight:812 g/molL-Threonine derivative-1
CAS:<p>L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.</p>Formula:C13H15NO6Purity:97.03% - 98.91%Color and Shape:SolidMolecular weight:281.26(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/mol(Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H295N53O59SPurity:Min. 95%Molecular weight:4,345.81 g/molAc-Glu-Glu-Val-Val-Ala-Cys-pNA
CAS:<p>Please enquire for more information about Ac-Glu-Glu-Val-Val-Ala-Cys-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H50N8O13SPurity:Min. 95%Molecular weight:810.87 g/molBradykinin (1-3) sulfate salt
CAS:<p>Bradykinin (BK) is a peptide hormone that is released by the endothelium of blood vessels in response to injury. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is a synthetic version of the BK sequence with sulfate groups on the amino acids and an additional acid substitution. This molecule has been shown to be fully functional as a copolymer in thrombin activation, oligopeptide, and angiotensin production. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is stable at pH 3 and above, which makes it suitable for use in nutrient media, such as media for growing bacteria or yeast. It also has been shown to have platelet aggregation properties similar to those found in natural BK.</p>Formula:C16H28N6O4Purity:Min. 95%Molecular weight:368.43 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H78N14O11Purity:Min. 95%Molecular weight:1,111.3 g/molAloc-Ser-OMe
CAS:<p>Aloc-Ser-OMe is an enzyme that catalyzes the cleavage of 1,4-linked alpha-D-galactosides. It has been shown to be a useful reagent for the synthesis of alkyl glycosides. Aloc-Ser-OMe can be used in enzymatic synthesis or chemoenzymatic synthesis. This enzyme has excellent stereospecificity and is quantitatively active at pH 4.5 to 5.0 and at temperatures ranging from 20°C to 40°C. The enzyme can also catalyze transglycosylation reactions with beta-glucosidase, producing galactoarabinan oligosaccharides with various degrees of polymerization.</p>Formula:C8H13NO5Purity:Min. 95%Molecular weight:203.19 g/molNe-Fmoc-L-lysine
CAS:<p>Ne-Fmoc-L-lysine is an amine with a homopolypeptide backbone. It is insoluble in water and has a low profile. Ne-Fmoc-L-lysine is synthesized using solid phase chemistry, which can be used for the synthesis of nanocarriers. It has been shown to interact with other molecules such as polymers and proteins. Ne-Fmoc-L-lysine can also be used in supramolecular architectures and oriented microscopy techniques.</p>Formula:C21H24N2O4Purity:Min. 95%Molecular weight:368.43 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/mol(Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H231N45O41Purity:Min. 95%Molecular weight:3,188.6 g/mol(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.</p>Formula:C121H190N34O35Purity:Min. 95%Molecular weight:2,681.01 g/mol(Sar 9,Met(O2)11)-Substance P
CAS:<p>Substance P is a neuropeptide that is found in the brain and throughout the peripheral nervous system. It has been found to be involved in numerous physiological processes, including pain transmission, vasodilation, and inflammation. Substance P binds to neurokinin-1 receptor (NK-1R) with high affinity. NK-1R has been shown to be localized on cells of the submandibular gland and salivary gland. Techniques such as binding experiments have shown that substance P binds to NK-1R with high affinity and is therefore likely involved in salivation and other functions of these glands.</p>Formula:C64H100N18O15SPurity:Min. 95%Molecular weight:1,393.66 g/molZ-Tyr-Leu-NH2
CAS:<p>The compound Z-Tyr-Leu-NH2 is a synthetic molecule that inhibits the activity of metalloproteases. It binds to the active site of these enzymes, preventing them from cleaving their substrates. The enzyme's activity is inhibited by binding to uncharged amino acid residues in the active site, which prevents attack by the metal ion and therefore prevents cleavage of substrate proteins. Z-Tyr-Leu-NH2 has been shown to be effective against proteases that are involved in Alzheimer's disease and other neurodegenerative diseases. The optimal pH for this compound is 7.5, with a reaction time of 1 hour at 37 degrees Celsius. The transition temperature for this compound is -10 degrees Celsius, with a phase transition at -4 degrees Celsius.</p>Formula:C23H29N3O5Purity:Min. 95%Molecular weight:427.49 g/molH-Val-Met-OH
CAS:<p>H-Val-Met-OH is a synthetic compound that was created to have a structure similar to the natural amino acid histidine. The synthesis of H-Val-Met-OH was achieved by reacting 2,5-diaminopentane with formaldehyde in the presence of cellulose acetate as a reaction medium. This process produced a white solid material that was then purified using chromatography. The purity and yield were confirmed by high performance liquid chromatography (HPLC) analysis and nuclear magnetic resonance (NMR). In vitro studies showed that H-Val-Met-OH promotes brain derived neurotrophic factor (BDNF) production in healthy Chinese adults. Clinical data also suggest that H-Val-Met-OH has beneficial effects on cognitive function in patients with mild cognitive impairment or Alzheimer's disease. Additionally, this compound has been shown to promote BDNF production in cultured mouse hippocampal neurons and enhance spatial memory retention in CD1 mice.</p>Formula:C10H20N2O3SPurity:Min. 95%Molecular weight:248.34 g/mol(p-Amino-Phe6)-Angiotensin II
CAS:<p>Please enquire for more information about (p-Amino-Phe6)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H74N12O12Purity:Min. 95%Molecular weight:1,071.23 g/molH-Gly-Arg-Gly-Asp-OH
CAS:<p>H-Gly-Arg-Gly-Asp-OH is a cyclic peptide with the amino acid sequence of Gly-Arg-Gly-Asp. It has been shown to promote bone formation and inhibit bone resorption in vitro by stimulating the release of growth factors. This peptide can be used as a diagnostic agent for monitoring cell culture, which may be due to its ability to bind monoclonal antibodies. H-Gly-Arg-Gly-Asp-OH also has the ability to form conjugates with polymerase chain reaction (PCR) probes or other biomolecules. These conjugates can be used for detecting specific DNA sequences, such as those found in mammalian cells.</p>Formula:C14H25N7O7Purity:Min. 95%Molecular weight:403.39 g/molZ-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>Formula:C18H23N3O6Purity:Min. 95%Molecular weight:377.39 g/molBand 3 Protein (824-829) (human)
CAS:<p>Please enquire for more information about Band 3 Protein (824-829) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H65N11O8Purity:Min. 95%Molecular weight:791.98 g/mol(Tyr65,Phe67)-C5a (65-74) (human)
CAS:<p>Please enquire for more information about (Tyr65,Phe67)-C5a (65-74) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H85N15O16SPurity:Min. 95%Molecular weight:1,244.42 g/molZ-Lys-Pro-4MbNA formiate salt
CAS:<p>Please enquire for more information about Z-Lys-Pro-4MbNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H36N4O5Purity:Min. 95%Molecular weight:532.63 g/molProinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H239N47O46Purity:Min. 95%Molecular weight:3,340.71 g/molH-D-Ile-OBzl·p-tosylate
CAS:<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>Formula:C13H19NO2·C7H8O3SPurity:Min. 95%Molecular weight:393.5 g/mol4-Chloro-6-methyl-2-trifluoromethylpyrimidine
CAS:<p>Please enquire for more information about 4-Chloro-6-methyl-2-trifluoromethylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4ClF3N2Purity:Min. 95%Molecular weight:196.56 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/molCyclo(-Pro-Gly)3
CAS:<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O6Purity:Min. 95%Molecular weight:462.5 g/molH-Gly-Arg-Asp-Gly-Ser-OH
CAS:<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molTyr-Leptin (26-39) (human)
CAS:<p>Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H137N19O25Purity:Min. 95%Molecular weight:1,765.06 g/molFmoc-L-α-aminobutyric acid
CAS:<p>Fmoc-L-alpha-aminobutyric acid is a synthetic amino acid that is used as a linker in solid-phase peptide synthesis. It is also used to synthesize analogs of the serine protease NS3, which are postulated to inhibit hepatitis C virus replication by preventing the release of viral RNA from infected cells. Fmoc-L-alpha-aminobutyric acid has been shown to have anti-viral activity against the influenza virus and HIV.</p>Formula:C19H19NO4Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:325.36 g/molHexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt
<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H250N44O43SPurity:Min. 95%Molecular weight:3,425.96 g/molH-Lys-Ala-AMC hydrochloride salt
CAS:<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N4O4Purity:Min. 95%Molecular weight:374.43 g/molH-Tyr-Val-OH
CAS:<p>H-Tyr-Val-OH is a model system for the study of monoclonal antibodies that are unable to bind to antigen. It has been shown to inhibit the production of signal protein, which is involved in cell proliferation and differentiation. H-Tyr-Val-OH also inhibits cell factor, which is a key component in the immune system. H-Tyr-Val-OH has been used as an oxidation catalyst to destroy the human immunodeficiency virus (HIV). The drug binds to human macrophages and blocks the activity of ATP binding cassette transporter. This leads to inhibition of HIV infection by preventing HIV from entering cells, thus inhibiting its replication.</p>Formula:C14H20N2O4Purity:Min. 95%Molecular weight:280.32 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molHirudin (54-65) (sulfated)
CAS:<p>Hirudin is a protein that functions as an anticoagulant by binding to the active site of thrombin, preventing it from converting fibrinogen into fibrin. It has a high affinity for the thrombin receptor and can be modified in various ways. Hirudin's most common modification is sulfation, which enhances its anticoagulant activity. Hirudin is a proteolytic enzyme that can be synthesized using solid-phase chemistry. Its biological function is to inhibit blood coagulation by inhibiting the conversion of fibrinogen to fibrin. Hirudin binds to thrombin, preventing it from converting fibrinogen into fibrin and thus inhibits coagulation. It also prevents clot formation by inhibiting platelet aggregation, which may result from interactions with other proteins such as prothrombin and factor VIII.</p>Formula:C66H93N13O28SPurity:Min. 95%Molecular weight:1,548.58 g/molFmoc-Tyr(SO2(ONeopentyl))-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(SO2(ONeopentyl))-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H31NO8SPurity:Min. 95%Molecular weight:553.62 g/mol5-FAM-Woodtide trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H133N21O26SPurity:Min. 95%Molecular weight:1,945.2 g/molBig Endothelin-1 (human)
CAS:<p>Please enquire for more information about Big Endothelin-1 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H282N48O56S5Purity:Min. 95%Molecular weight:4,282.88 g/molL-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine
CAS:<p>L-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine (LLLLLL) is an antibacterial agent that belongs to the class of pharmacological agents. LLLLLL has been shown to have antibacterial efficacy against oral pathogens, such as Streptococcus mutans and Porphyromonas gingivalis. LLLLLL binds to the bacterial cell wall by forming a covalent disulfide bond with cysteine residues on the peptidoglycan layer. This prevents cell wall synthesis, leading to cell death by inhibiting protein synthesis. LLLLLL has also been shown to have low toxicity in animal models for long periods of time, with high values in human serum.</p>Formula:C30H62N10O6Purity:Min. 95%Molecular weight:658.88 g/molNeurotensin (1-8) Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-OH
CAS:<p>Neurotensin (NT) is a peptide that has been implicated in the regulation of feeding behavior, cardiovascular function, and pain perception. The neurotensin receptor is a G-protein coupled receptor with seven transmembrane domains. Neurotensin binds to the receptor and activates it by inducing intracellular calcium mobilization and neurotransmitter release. This activation can be dose-dependent, as seen in experiments using rat brain slices incubated with different concentrations of NT. Neurotensin also induces maximal activation at low concentrations, which may be due to its ability to bind to both extracellular and intracellular receptors. NT binds selectively to ventral tegmental area neurons from rats, leading to increased spontaneous firing rates. Cancer cells have been shown to express high levels of neurotensin receptors on their surface membrane, which may contribute to tumorigenesis and metastasis. Neurodegenerative diseases such as Alzheimer’s disease are thought to involve alterations in the expression or</p>Formula:C46H71N13O14Purity:Min. 95%Molecular weight:1,030.14 g/mol1,2-Dipalmitoyl-sn-glycero-3-phosphocholine
CAS:<p>1,2-Dipalmitoyl-sn-glycero-3-phosphocholine (DPPC) is a sodium salt that has the ability to form surfactant bilayers. DPPC is a model system for studying biochemical reactions and the phase transition of lipid bilayers. This compound has been used to study the effects of various drugs on cell membranes in biochemical research. In addition, DPPC has been shown to have hypoglycemic effects in animal models as well as having an anti-inflammatory effect.</p>Formula:C40H80NO8PPurity:Min. 95 Area-%Color and Shape:PowderMolecular weight:734.04 g/molZ-Pro-Leu-OH
CAS:<p>The compound Z-Pro-Leu-OH is a peptidomimetic that has been shown to be an effective inhibitor of the enzyme l-amino acid oxidase, which catalyzes the oxidation of l-amino acids. This inhibition may be due to the protonation of the substrate and/or solvents in the enzyme active site. The molecule is hydrophobic, making it suitable for use in simulations and theoretical studies. Furthermore, this compound is identifiable by its retention time on high performance liquid chromatography (HPLC) and can be rationalized by its amide group.</p>Formula:C19H26N2O5Purity:Min. 95%Molecular weight:362.42 g/mol(Pyr 6,Pro9)-Substance P (6-11)
CAS:<p>(Pyr 6,Pro 9)-Substance P (6-11) Pyr-Phe-Phe-Pro-Leu-Met-NH2 is a peptide that has been shown to have locomotor activity in rats, receptor activity, and physiological effects. This peptide binds to the κ opioid receptor and the neurokinin 1 receptor. It was found to have antimicrobial properties against gram positive bacteria and gram negative bacteria. In addition, it has been shown to be an inhibitor of fatty acid synthesis. This molecule also has been studied for its ability to treat metabolic disorders by inhibiting malonic acid production in animals.</p>Formula:C39H53N7O7SPurity:Min. 95%Molecular weight:763.95 g/molBoc-Ser(Ala-Fmoc)-OH
CAS:<p>Boc-Ser(Ala-Fmoc)-OH is a synthetic amino acid that is used in peptide synthesis. It is typically prepared by the condensation of Serine with diethyl Fmoc-amino acid and hydrochloric acid. This molecule has an efficient epimerization process, which allows for the synthesis of the other enantiomer, L-Ser(Ala-Fmoc)-OH. The synthetic method for Boc-Ser(Ala-Fmoc)-OH can be used to synthesize peptides from amino acids.</p>Formula:C26H30N2O8Purity:Min. 95%Molecular weight:498.53 g/mol(Fmoc-Glu70,Ala71·72,Lys74)-C3a (70-77)
CAS:<p>Please enquire for more information about (Fmoc-Glu70,Ala71·72,Lys74)-C3a (70-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H80N12O13Purity:Min. 95%Molecular weight:1,093.28 g/molSapecin
CAS:<p>Sapecin is an antimicrobial peptide, which is derived from the hemolymph of the silk moth (Bombyx mori) with potent bactericidal action. The source of Sapecin is the immune system of the silk moth, where it acts as a natural defense mechanism against microbial infections. Its mode of action involves disrupting bacterial cell membranes, leading to cell lysis and death. The peptide achieves this by inserting itself into the lipid bilayer, creating pores that compromise the structural integrity of the membrane.</p>Formula:C164H266N58O52S6Purity:Min. 95%Molecular weight:4,074.62 g/molα-Phellandrene
CAS:<p>Alpha-Phellandrene is a type of monoterpene that has been shown to have antioxidant properties. Alpha-Phellandrene is also known to inhibit the herpes simplex virus. In addition, alpha-Phellandrene has been shown to be a lipid and fatty acid oxidation inhibitor. Alpha-Phellandrene has been studied as an analgesic and anticonvulsant drug in animal models for pain relief and epilepsy treatment. Alpha-Phellandrene has also been studied for its ability to inhibit the production of prostaglandins by human liver cells. This terpene can be found in many plants, including thyme, lemon balm, peppermint, lavender and basil. The main chemical structure of alpha-Phellandrene is a bicyclic monoterpene with two isoprenyl units linked to a cyclohexane ring. It belongs to the group of monoterpenes which are derived from geranylgeranyl py</p>Formula:C10H16Purity:Min. 75%Color and Shape:Clear LiquidMolecular weight:136.23 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/molH-Ala-Ala-OtBu·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3·HClPurity:Min. 95%Molecular weight:252.74 g/mol1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine
CAS:<p>1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine (DLPE) is a lipid molecule that can induce phase transition in aqueous solutions. DLPE is an active ingredient in nonsteroidal anti-inflammatory drugs and has been shown to inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase. DLPE also inhibits the growth of infectious organisms such as Escherichia coli and HIV by inhibiting receptor activity. DLPE binds to receptors on the surface of cells, which prevents these cells from releasing inflammatory cytokines.</p>Formula:C29H58NO8PPurity:Min. 95%Color and Shape:PowderMolecular weight:579.75 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/molH-Trp-Val-OH
CAS:<p>H-Trp-Val-OH is a human protein that has been shown to be involved in the uptake of glucose into cells. H-Trp-Val-OH is also known as colony stimulating factor 1, which stimulates the growth and differentiation of hematopoietic cells. It has been shown to play a role in weight gain, insulin resistance, and type 2 diabetes. This monoclonal antibody has not been found to have any long term toxicity or genotoxicity in animal studies.</p>Formula:C16H21N3O3Purity:Min. 95%Molecular weight:303.36 g/molBoc-Asp(OcHex)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Asp(OcHex)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Gly-Phe-Gly-Lys-OH
CAS:<p>Boc-Gly-Phe-Gly-Lys-OH is an allergen that belongs to the group of flavonoids. It is a reaction product of cinnamates and methoxycinnamate, which are found in sunscreens. Boc-Gly-Phe-Gly-Lys-OH is used as a model for chemical carcinogens in studies on cancer. Boc-Gly-Phe-Gly-Lys-OH has been shown to be a potent skin cancer and radiation sensitizer. There are no known effects on humans, but it is possible that this compound may react with UV irradiation from sunlight, causing DNA damage and skin cancer.</p>Formula:C24H37N5O7Purity:Min. 95%Molecular weight:507.58 g/molH-Thr-Tyr-Ser-OH
CAS:<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/mol([15N]Gly)-Glutathione (reduced)
CAS:<p>Please enquire for more information about ([15N]Gly)-Glutathione (reduced) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%PAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/molTyr-Somatostatin-28
CAS:<p>Please enquire for more information about Tyr-Somatostatin-28 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C146H216N42O41S3Purity:Min. 95%Molecular weight:3,311.73 g/molZ-Ala-Asp-OH
CAS:<p>Methyl ester of z-alanine and aspartic acid. The methyl ester is the reaction product of z-alanine and aspartic acid, which are modified amino acids. The methyl ester is a modification of an amino acid at its carboxyl group. This active site is found in the profile of a number of enzymes, including those that catalyze the hydrolysis of amides or esters. It may also be involved in the catalytic activity of alcohols. Z-Ala-Asp-OH can act as an inhibitor to certain enzymes that break down proteins, such as peptidases and proteases. It has been shown to be resistant to hydrolysis by amide and c-terminal amidases.</p>Formula:C15H18N2O7Purity:Min. 95%Molecular weight:338.31 g/molZ-D-Arg(Z)2-OH
CAS:<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H32N4O8Purity:Min. 95%Molecular weight:576.6 g/mol3-Amino-4-methyl-thiophen-2-carboxylic acid methyl ester
CAS:<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>Purity:Min. 95%Molecular weight:171.22 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS:<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Formula:C12H19NO5Purity:Min. 95%Molecular weight:257.28 g/molFmoc-Glu(OtBu)-Thr(psi(Me,Me)pro)-OH
CAS:<p>Fmoc-glu(otbu)-thr(psi(Me,Me)pro)-OH is a c1-6 alkoxy, expressed, alkenyl, linker, c1-6 alkyl, efficiency, sequence that can be used for peptide synthesis. It is an efficient linker for the synthesis of peptides and has been shown to yield high yields with few side products. The hydroxyl group on the side chain of the amino acid residue provides an additional site for acylation. This product also contains an aralkyl and alkoxy group that can be used in further reactions.</p>Formula:C31H38N2O8Purity:Min. 95%Color and Shape:PowderMolecular weight:566.64 g/molFor-Met-Leu-Phe-OMe
CAS:<p>For-Met-Leu-Phe-OMe is a drug that has been shown to have anti-inflammatory properties in human cells. For-Met-Leu-Phe-OMe inhibits the production of inflammatory molecules, such as gamma-aminobutyric acid, and it also blocks the binding of leukotrienes to their receptors. These effects are due to its conformational properties, which allow it to bind to the receptor site and inhibit the binding of other molecules. For-Met-Leu-Phe-OMe has been shown to enhance the release of nucleotide levels and intracellular calcium concentration in vitro. It also binds to receptors on cells, which may be due to its biochemical properties or its analogues with other drugs.</p>Formula:C22H33N3O5SPurity:Min. 95%Molecular weight:451.58 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/molFibronectin Fragment (196-203)
CAS:<p>Fibronectin fragment (196-203) H-Ser-Arg-Asn-Arg-Cys-Asn-Asp-Gln, is a synthetic peptide that has been shown to have antiinflammatory properties. It can inhibit the inflammatory response by inhibiting the production of cytokines and chemokines. Fibronectin fragment (196-203) H-Ser-Arg-Asn-Arg-Cys-Asn, has also been shown to inhibit angiogenesis and tumor growth in vitro, as well as stabilize blood vessels and reduce the incidence of lymphatic vessel leakage. This peptide may be used in cancer therapy and for other diseases such as Kaposi's sarcoma, rheumatoid arthritis, autoimmune diseases, or infectious diseases.</p>Formula:C35H62N18O14SPurity:Min. 95%Molecular weight:991.05 g/molH-Pro-Val-Asp-OH
CAS:<p>Please enquire for more information about H-Pro-Val-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H23N3O6Purity:Min. 95%Molecular weight:329.35 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molH-Val-Ala-pNA acetate salt
CAS:<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/mol4-(4-Phenylbutoxy)benzoic acid
CAS:<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>Formula:C17H18O3Purity:Min. 95%Molecular weight:270.32 g/molRetrocyclin-1 trifluoroacetate salt
CAS:<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/molGlutaryl-Ala-Ala-Phe-4MbNA
CAS:<p>Please enquire for more information about Glutaryl-Ala-Ala-Phe-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H36N4O7Purity:Min. 95%Molecular weight:576.64 g/molBz-DL-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Bz-DL-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H25N5O4·HClPurity:Min. 95%Molecular weight:471.94 g/molKininogen-Based Thrombin Inhibitor
CAS:<p>Please enquire for more information about Kininogen-Based Thrombin Inhibitor including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N8O7SPurity:Min. 95%Molecular weight:650.79 g/molCatestatin (human) trifluoroacetate
CAS:<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H164N32O27SPurity:Min. 95%Molecular weight:2,326.68 g/molLys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>Formula:C47H75N13O11Purity:Min. 95%Molecular weight:998.18 g/mol(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H77N17O11Purity:Min. 95%Molecular weight:1,200.35 g/molSuc-Val-Pro-Phe-SBzl
CAS:<p>Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.</p>Formula:C30H37N3O6SPurity:Min. 95%Molecular weight:567.7 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS:<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H37N5O4•3C2H4O2Purity:Min. 95%Molecular weight:567.67 g/molBoc-Arg-SBzl·HCl
CAS:<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N4O3S·HClPurity:Min. 95%Molecular weight:416.97 g/molAc-Ser-Gly-OH
CAS:<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molCyclo(-D-Trp-Tyr)
CAS:<p>Cyclo(-D-Trp-Tyr) is a cyclic peptide that is produced by the fungus Microbispora sp. It has been shown to inhibit the growth of Staphylococcus aureus, as well as other bacteria, fungi and cancer cells. Cyclo(-D-Trp-Tyr) binds to the ribosomal RNA in these cells and inhibits protein synthesis. The peptide does not bind to subtilisin or bgc-823, but does bind to lung fibroblasts and leukemia cells.</p>Formula:C20H19N3O3Purity:Min. 95%Molecular weight:349.38 g/molBz-Tyr-4-Abz-OH·sodium salt
CAS:<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H19N2NaO5Purity:Min. 95%Molecular weight:426.4 g/molLIP2 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H288N58O58Purity:Min. 95%Molecular weight:4,240.61 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molChloroac-DL-Phe-OH
CAS:<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>Formula:C11H12ClNO3Purity:Min. 95%Molecular weight:241.67 g/mol(S)-(-)-3-Chloro-1-phenyl-1-propanol
CAS:<p>(S)-(-)-3-Chloro-1-phenyl-1-propanol is an efficient method for the synthesis of chiral propiophenone. It is synthesized by reacting a mixture of borane and tetrahydrofuran with (S)-(-)-3-chloro-1-phenylpropanol. This reaction produces the desired compound in good yield and high diastereoselectivity. The synthesis of this compound has been shown to be useful for the production of antidepressant drugs, such as κ-opioid receptor ligands, which are used to treat depression, anxiety, and chronic pain.</p>Formula:C9H11ClOPurity:Min. 95%Molecular weight:170.64 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/mol1-Methyl-4-nitro-1H-pyrazole-3-carboxamide
CAS:<p>Please enquire for more information about 1-Methyl-4-nitro-1H-pyrazole-3-carboxamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%HCV Nucleoprotein (88-96)
CAS:<p>Please enquire for more information about HCV Nucleoprotein (88-96) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H60N12O13Purity:Min. 95%Molecular weight:989.04 g/mol

