Organic Halides

<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>

<p>Please enquire for more information about 3-Bromopropylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>

<p>Please enquire for more information about Cortistatin-29 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about 3-Aminoazepan-2-one hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Pro-Phe-chloromethylketone is a cytosolic protein that performs its function by denaturing proteins and is localized in the cytosol. It has been shown to be active against a number of bacteria, including Bacillus licheniformis and Listeria monocytogenes, as well as some fungi. Z-Ala-Pro-Phe-chloromethylketone targets the membrane potential in mitochondria and chloromethyl ketone is a strategy for inhibiting membrane potential in mitochondria. The x-ray diffraction data show that this protein forms a molecule with an alpha helix structure. It binds to the mitochondrial inner membrane by ligation and inhibits mitochondrial membrane potential.</p>

<p>Please enquire for more information about H-Arg(Pmc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuropeptide EI is a cyclic peptide that has been shown to have receptor activity in the caudate putamen, as well as locomotor activity and metabolic rate. Neuropeptide EI has also been shown to inhibit lymphatic vessels and amide sequences in fat cells. It has been shown to have various biological functions, such as an anti-inflammatory agent, an analgesic, and a chemotherapeutic agent. It is active against cancer cells and autoimmune diseases, but is inactive against bacteria.</p>

<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Bromoquinolin-8-amine is a topoisomerase inhibitor that can be used as an antitumor agent. It has been shown to inhibit the growth of tumor cell lines and suppress the growth of colon carcinoma cells in rats and human colon carcinomas in mice. 5-Bromoquinolin-8-amine interacts with DNA, specifically inhibiting the formation of supercoiled DNA. This interaction may lead to the inhibition of tumor cell growth. 5-Bromoquinolin-8-amine also inhibits protein synthesis by interacting with proteins at the ribosomal level, leading to inhibited cell growth.</p>

<p>Please enquire for more information about 2-Chloro-3-methoxybenzaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Iodo-1-methylpyrazole is a reductive agent that is used in organic synthesis. It can be used as a reducing agent for the conversion of aldehydes and ketones to alcohols. 4-Iodo-1-methylpyrazole can be crystallized from diethyl etherate and blood. The product yield from this reaction is high, but it requires an oxidant such as trifluoride or plavix to react with the diacetates. 4-Iodo-1-methylpyrazole can also be synthesized by reacting allylsilanes with iodine gas in the presence of a base. This synthesis method produces 4-iodo-1-methylpyrazole in good yield and with little difficulty.</p>

<p>Please enquire for more information about H-Leu-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amyloid beta-protein (1-15) is a peptide fragment of the amyloid protein that is associated with Alzheimer's disease. Amyloid beta-Protein (1-15) activates the transcription of a number of genes, including those that encode neurotrophic factors and growth factors. It has been shown to have neurotrophic properties and to increase the survival rate of neurons in vitro. It also protects against neuronal death induced by oxidative stress and high concentrations of glutamate. The structure of amyloid beta-protein (1-15) has been elucidated using molecular modeling techniques and X-ray crystallography. The trifluoroacetate salt form is stable at physiological pH levels and shows good solubility in water, making it an attractive therapeutic drug candidate.</p>

<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,1'-(2,2,2-Trichloroethylidene)Bis(4-fluorobenzene) is a fluorine-containing compound that is used in analytical chemistry. It is a synthetic nucleophile that reacts with electron deficient molecules to form covalent bonds. This substance has been shown to denature proteins and inhibit the activity of enzymes such as DNA polymerase, RNA polymerase, and phosphodiesterases. 1,1'-(2,2,2-Trichloroethylidene)Bis(4-fluorobenzene) also inhibits the signal transduction pathway in Drosophila melanogaster (fruit fly). The effects of this substance on blood flow velocity were studied in an animal model system.</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt is a polyvalent antivenom that is used in the treatment of snakebites and insect stings. It has been shown to be effective in the treatment of life-threatening envenomations, including bites from cobras and other rattlesnakes. This drug is not active against nonactivated venom, such as those from bees or spiders. H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt binds to the cytolysin, which prevents its activity by inactivating it. The drug also has a vasoconstrictive effect, which limits blood flow to tissues and may reduce tissue damage caused by venom toxins.</p>

<p>Syntide 2 is a diacylglycerol, which has been found to have a number of biochemical properties. It is an activator of protein kinase C and has been shown to be reactive in vitro assays. Syntide 2 has also been found to activate the light chain kinase in plant physiology. This compound has also been shown to promote neuronal death and may have a role in transcriptional regulation. Syntide 2 is used as a model system for studying the physiological function of α subunit-containing proteins.</p>

<p>Please enquire for more information about H-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-e psilon-aminocaproyl-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>

<p>Decamethonium bromide is a potent and selective antagonist of nicotinic acetylcholine receptors. It is used in the treatment of autoimmune diseases, such as myasthenia gravis, Lambert-Eaton syndrome, and Guillain-Barre syndrome. Decamethonium bromide has been shown to inhibit the enzyme activity of acetylcholinesterase, which leads to an accumulation of acetylcholine at neuromuscular junctions. This causes muscle paralysis and increased bronchoconstriction in humans. In animal models, decamethonium bromide has been shown to be a potent inhibitor of receptor activity in the muscle tissue.</p>

<p>Muscarinic antagonist; spasmolytic</p>

<p>3,5-Diiodothyroformic acid is a fine chemical that is used as a versatile building block in organic synthesis. It is also an intermediate for research chemicals and speciality chemicals. In addition to its use as a reagent, 3,5-Diiodothyroformic acid has been shown to be useful as a building block for the synthesis of pharmaceuticals and agricultural chemicals.</p>

<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,6-Diaminohexane dihydrochloride is a chemical that is used in the analytical method for the determination of p-hydroxybenzoic acid. It has also been used to measure fatty acids and anhydrous sodium. The sample preparation required for this chemical includes mixing with water and adding hydroxyl groups. A toxicological study on 1,6-diaminohexane dihydrochloride shows that it has no acute toxicity in rats. However, it does show some signs of toxicity in rabbits and dogs at high doses. Amine compounds are usually very reactive due to the presence of a lone electron pair on nitrogen.</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Amino-5-chloro-N,3-dimethylbenzamide is a synthetic compound. It has been shown to induce necrotic cell death in mammalian cells. This compound was synthesized by the reaction of 2-aminoquinoline with a Grignard reagent, followed by nitration of the resultant amine. The synthesis of this compound was thermodynamically favorable and exhibited good solubility in water. The chlorantraniliprole and anthranilic acid moieties are activated with an acylation reaction, which allows them to bind to the ryanodine receptor and inhibit calcium release from the sarcoplasmic reticulum (SR) with ammonolysis. This inhibition leads to ferroptosis, a type of programmed necrosis.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Des-Ser3)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is an antibacterial agent that inhibits the enzyme acetylcholine esterase. This inhibition prevents the breakdown of acetylcholine, leading to increased levels of this neurotransmitter in the brain and an enhancement of cholinergic transmission. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid has been shown to be effective against bacterial strains resistant to β-lactam antibiotics. The synthesis of taxol as well as other β-amino acids has been demonstrated using a variety of enzymatic methods. A reaction scheme for the synthesis of nicotinic acetylcholine has also been proposed. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is a dipept</p>

<p>4-Chloro-6-methoxyquinoline is an inhibitor of bacterial DNA gyrase. It has antibacterial activity against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus, Enterococcus faecalis, and Pseudomonas aeruginosa. 4-Chloro-6-methoxyquinoline is a synthetic compound that was reinvestigated for its antibacterial activity. It has been shown to be effective in the treatment of Staphylococcal infections. The mechanism of action may involve inhibition of topoisomerase II or interference with the synthesis of DNA by binding to the enzyme bacterial DNA gyrase. Quinidine and cinchonidine are quinine derivatives that have been found to inhibit bacterial DNA gyrase. These compounds are found in the bark of Cinchona species, which includes Cinchona ledgeriana, Cinchona officinalis, and Cinchona succirub</p>

<p>8-Benzyloxy-5-((R)-2-bromo-1-hydroxyethyl)-1H-quinolinone is a potassium channel blocker. It binds to the central cavity of the channel pore and blocks potassium ion flux, inhibiting the function of potassium channels. 8-Benzyloxy-5-(2-(R)-bromo-1,3-dihydroxypropyl)quinolinone has been shown to inhibit voltage gated channels in a number of different tissues, including cardiomyocytes from rat hearts.</p>

<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>8-Quinolinesulfonyl chloride (8QSC) is a quinoline derivative that has been shown to have anticancer activity. 8QSC binds to the receptor site of cells and inhibits the production of amines, which are important for cell growth and proliferation. It also binds to hydrogen bonds, which may be involved in the cytotoxicity observed in pancreatic cancer cells. 8QSC shows significant cytotoxicity against Panc-1 cells, but not against NIH 3T3 cells. This may be due to its ability to form supramolecular aggregates with copper ions and quinoline derivatives.</p>

<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>

<p>8-Bromo-1-octanol is a fluorescent compound that has been shown to be resistant to cancer. It can be used as a probe for the detection of malonic acid in urine samples, which are an indicator of oxidative stress. 8-Bromo-1-octanol is stable in the presence of alcohol groups, and can be used to prepare samples for population growth studies. This chemical has also been used to study the growth of bacteria such as Pseudomonas aeruginosa and Escherichia coli. 8-Bromo-1-octanol emits light at a wavelength of 490 nm when exposed to ultraviolet radiation, which makes it useful for detecting chlorine atoms in water samples. The product research involving this chemical includes its effects on k562 cells and P. aeruginosa. Studies have also been done on its hydroxyl group and fatty acids and fatty acid esters, which are found in animal fat and vegetable oils.</p>

<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>

<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Chlorophenethyl alcohol is a synthetic, primary alcohol. It can be synthesized by reacting 2,4-dichlorobenzoic acid with a Grignard reagent. The reaction produces 4-chlorophenethyl alcohol, which is insoluble in water and reacts with chloride to form chloroform. This procedure can be used to produce other chlorinated alcohols. 4-Chlorophenethyl alcohol has been shown to have acute toxicities that are similar to those of trifluoroacetic acid and it is believed that the toxicity is due to its ability to react with proteins and nucleic acids.</p>

<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Iron trifluoromethanesulfonate is an inorganic compound that is used as a catalyst in organic reactions. It is a salt of iron(III) and triflic acid, with the formula Fe(O)(CF). It has been shown to be a cocatalyst for benzofuran derivatives and can be used to synthesize methyl ketones, alkylation products, diarylmethanes, primary alcohols, and cleavage products. Iron trifluoromethanesulfonate can also be used as a control experiment to study reaction mechanisms.</p>

<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Bromo-2-hydroxybenzaldehyde (5BHB) is an organic compound that has been shown to have a coordination geometry of group p2. This compound binds to DNA and RNA, inhibiting the transcription process. 5BHB also has the ability to form a copper complex with malonic acid. This redox potential is reduced by one electron when copper is added in order to form the copper complex, which allows for the reactivity of 5BHB to be increased. 5BHB binds to nucleic acids through hydrogen bonding interactions with nitrogen atoms and lone pairs on oxygen atoms. The reaction mechanism for 5BHB involves intramolecular hydrogen transfer from one molecule of 5BHB to another, forming an intermediate that then reacts with nucleic acid.</p>

<p>Please enquire for more information about H-D-His(1-Me)-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>

<p>Please enquire for more information about H-Ala-Ala-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Chloromethyl)-5-methylpyridine hydrochloride (3CMPH) is a chemical compound that is synthesized from chlorine and methylpyridine. 3CMPH can be produced by the reaction of chlorination with toluene or hydrogen chloride. The synthesis of 3CMPH is done in two steps: first, reacting toluene with chlorine gas at high temperature and pressure in the presence of sulfuric acid, followed by the addition of sulfuric acid to the resulting product. In the second step, hydrogen chloride reacts with methylpyridine in an alkaline solution, yielding 3-(chloromethyl)-5-methylpyridine hydrochloride as a white solid. 3CMPH has been shown to have antihistamine effects and can be used for treating allergies. It can also be used as a skin protectant against uv light and rupatadine.</p>

<p>2-(1,3-Benzodioxol-5-yl)-4,6-bis(trichloromethyl)-1,3,5-triazine is a triazine compound that contains a hydroxyl group and a carboxylic acid. It is used as a polymerization initiator for cationic polymerization. 2-(1,3-Benzodioxol-5-yl)-4,6-bis(trichloromethyl)-1,3,5-triazine is also used as a chemical treatment for water supplies and wastewater. This compound can absorb many organic compounds that are harmful to the environment such as pesticides and herbicides. 2-(1,3-Benzodioxol-5-yl)-4,6-bis(trichloromethyl)-1,3,5-triazine has been shown to function as an antiinflammatory agent through its hydrogen bonding properties.</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Amino-6-chloro-1,3-benzenedisulfonamide is a natural substance that has been used in Chinese medicine preparations for the treatment of cardiac problems. It belongs to the class of organic compounds called benzenedisulfonamides. 4-Amino-6-chloro-1,3-benzenedisulfonamide is produced by the bacterial enzyme aminase from amino acid and benzoic acid. The adsorption mechanism of 4-Amino-6-chloro-1,3-benzenedisulfonamide is not fully understood, but it is believed that the benzyl groups are key players in this process. The high affinity of 4-Amino-6-chloro1,3 benzenedisulfonamide to proteins may be due to its ability to form hydrogen bonds with protein side chains, such as serine or threonine residues. 4 Amino</p>

<p>2-Chloro-6-methoxypyridine (2CMP) is a potent antagonist that binds to copper chloride, inhibiting its ability to activate aryl chlorides. This chemical has been shown to have anti-angiogenic effects in human cancer cells and can be used for the treatment of cancer. 2CMP has also been shown to be effective at blocking angiogenesis in mice with breast cancer. 2CMP is synthesized through an asymmetric synthesis process, which involves the use of a dipole and molecular docking analysis.</p>

<p>Furaltadone hydrochloride is a drug that belongs to the class of quinolones. It is used as an antibiotic for the treatment of microbial infections and may be used in combination with other antibiotics. Furaltadone hydrochloride binds to bacterial DNA, inhibiting protein synthesis, leading to cell death. The mechanism of action has not been fully elucidated, but it is thought that furaltadone hydrochloride binds to the sodium ion in the hydroxyl group of DNA. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Furaltadone hydrochloride has been shown to have a low systemic effect and high adsorption rate in animals; therefore it may be used as an oral antibiotic or as an injectable drug.</p>

<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Thr-OH hydrochloride salt is a synthetic amino acid that has been used in the synthesis of a cyclic peptide. The synthesis was achieved by metathesis reactions, which involved the reaction of an acid chloride with a chiral amine to form an ester. H-Lys-Thr-OH hydrochloride salt has been shown to have high binding constants to its targets and can be used as a selective reagent for the synthesis of virus proteins. It is also able to bind to carboxylate groups, which are common in wild type viruses and gene products. This reagent also has cleavage products, which can be used for efficient method for synthesizing cyclic peptides.</p>

<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>

<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>

<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Bromophenyl boronic acid is a group P2 molecule with functional groups of vibrational and cross-coupling. It has been shown to inhibit the activity of aryl boronic acids, which are commonly used in analytical methods. 3-Bromophenyl boronic acid is also capable of inhibiting the production of alizarin, which is a dye that is used for staining biological tissue. The molecular modeling study revealed that this molecule has an atomic orbital with electron density distribution around the central carbon atom. This distribution indicates that it is more stable than other molecules with similar structures.</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ne-Z-L-lysine tert-butyl ester hydrochloride is a multidrug that inhibits the activity of the P-glycoprotein (Pgp) transporter. This drug is an antigen that can be used as a marker for cytostatic drugs, and it can be used in radionuclide localization. Ne-Z-L-lysine tert-butyl ester hydrochloride has been shown to have cytostatic effects on malignant cells, but its cytotoxicity varies depending on the type of cancer cell. Ne-Z-L-lysine tert-butyl ester hydrochloride has also been shown to be degradable and to possess conjugates with antibodies, which makes it useful for treating some types of cancers. Ne-Z-L-lysine tert-butyl ester hydrochloride is not active against resistant cells such as those expressing Pgp or MRP1 proteins.</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1H,1H,2H,2H-Heptadecafluorodecyl iodide is a volatile chemical that is used in the transport of various analytes. It can be used to detect alcohols and organic chemicals in the environment. 1H,1H,2H,2H-Heptadecafluorodecyl iodide has been sporadically found in the atmosphere of China.</p>

<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Maleimide is a chemical compound with the molecular formula CH2=C(O)NHC(=O)CH2-CO2H. It is a reactive monomer that polymerizes in the presence of an initiator to form polymers. Maleimides are also used as cross-linking agents, and have been shown to be thermostable and stable at high temperatures. This particular maleimide is a colorless solid that has been shown to copolymerize with methyl methacrylate and other monomers to form thermally stable, hydrophobic polymers.</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 5-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cinnamoyl chloride is an organic compound that can be synthesized in an asymmetric fashion. It is a metabolite of cinnamoyl-CoA and has been shown to have photochemical properties. Cinnamoyl chloride has also been shown to inhibit the growth of cervical cancer cells. This compound also has hydroxyl groups, which may act as an amide or receptor activator. Cinnamoyl chloride may be used for the treatment of infectious diseases such as chlamydia and mycoplasma.</p>

<p>Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Chloropyridin-4-yl)methanamine is a hydrogenated molecule that has been shown to inhibit the activity of certain cancer cells. It inhibits the expression of the enzyme molecules involved in the synthesis of DNA and RNA. 2-Chloropyridin-4-yl)methanamine also inhibits the hydrolysis of hydrogen chloride (HCl) to produce hydrogen (H2). This drug is used as an inhibitor for medicines that require acidic pH for absorption, such as HCl.</p>

<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>