
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
2-(2-Aminothiazol-4-yl)acetic acid HCl
CAS:<p>2-(2-Aminothiazol-4-yl)acetic acid HCl is a white to off-white crystalline solid that is soluble in organic solvents. It is an intermediate used in the synthesis of thiourea derivatives, which are used as pharmaceuticals and agrochemicals. 2-(2-Aminothiazol-4-yl)acetic acid HCl is synthesized by the reaction of 2-aminothiazole with acetic anhydride. The purity can be determined using GC or NMR spectroscopy. Impurities may be removed by recrystallization with a solvent such as chloroform or dichloromethane. The melting point of 2-(2-aminothiazol-4-yl)acetic acid HCl is 147°C (298K). 2-(2-Aminothiazol-4-yl)acetic acid HCl can be purified by distillation at</p>Formula:C5H7ClN2O2SPurity:Min. 95%Molecular weight:194.64 g/mol[2-(4-Aminophenyl)ethyl]carbamic acid tert-butyl ester
CAS:<p>Please enquire for more information about [2-(4-Aminophenyl)ethyl]carbamic acid tert-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H20N2O2Purity:Min. 95%Color and Shape:Slightly Yellow PowderMolecular weight:236.31 g/mol(R)-3-Cyclohexenecarboxylic acid
CAS:<p>(R)-3-Cyclohexenecarboxylic acid is a scalable, stereoselective, and aziridine-based reagent that has been used for the epoxidation and selenoxide reactions. It is also an analog of calcitriol and a source of nanomolar concentrations of azide and selenoxide. (R)-3-Cyclohexenecarboxylic acid can be used as a precursor in the synthesis of carbamates.</p>Formula:C7H10O2Purity:Min. 95%Molecular weight:126.15 g/mol3-(2,5-Dioxoimidazolidin-4-yl)propanoic acid
CAS:<p>3-(2,5-Dioxoimidazolidin-4-yl)propanoic acid (3DAP) is a histidine analog that belongs to the group of fatty acid derivatives. It has been shown to be effective in the diagnosis of obesity and provides a new approach for the treatment of obesity. 3DAP binds to organic anion transporters, which are proteins that transport organic anions across cell membranes. This binding inhibits the transport of organic anion substrates and leads to increased concentrations of these substrates in blood plasma. 3DAP is a competitive inhibitor against estrone sulfate, which is one of its major metabolites. 3DAP has shown efficacy in animal models for obesity, diabetes, and hepatic steatosis.</p>Formula:C6H8N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:172.14 g/molMesitylboronic acid
CAS:<p>Mesitylboronic acid is a divalent organoboron compound with the molecular formula CHB(O)OH. It is a white solid that is soluble in organic solvents, but not water. Mesitylboronic acid has been used for the palladium-catalyzed cross-coupling of aryl halides and vinylogous esters, yielding substituted pyridines. Mesitylboronic acid also catalyzes the Suzuki coupling reaction of aryl boronic acids and alkenes, producing substituted indoles. This compound has diagnostic applications due to its ability to form a fluorescent complex with certain metal ions. It also plays an important role in insulin resistance due to its ability to form cross-couplings with unsymmetrical boron compounds.</p>Formula:C9H13BO2Purity:Min. 95%Molecular weight:164.01 g/molMycophenolic acid carboxybutoxy ether
CAS:<p>Mycophenolic acid carboxybutoxy ether is an active form of mycophenolic acid. It has been shown to activate the immune system by increasing the production of lymphokines, including interleukin-2 and gamma-interferon. Mycophenolic acid carboxybutoxy ether has been shown to be effective in vivo in models for autoimmune diseases and cancer. This compound has a high affinity for glycoside derivatives, which are important for the formation of body tissues, such as collagen and elastin. The drug binds to monoclonal antibodies that are used in diagnostic tests for cervical cancer and other cancers. Mycophenolic acid carboxybutoxy ether also binds to x-ray diffraction data, which aids in the structural analysis of glycoside derivatives. This drug can be analyzed using surface methodology.</p>Formula:C22H28O8Purity:Min. 95%Molecular weight:420.45 g/molBoc-Gln-Arg-Arg-AMC acetate salt
CAS:<p>Please enquire for more information about Boc-Gln-Arg-Arg-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H49N11O8Purity:Min. 95%Molecular weight:715.8 g/mol4-(1H-Pyrazol-1-yl)butanoic acid
CAS:<p>Please enquire for more information about 4-(1H-Pyrazol-1-yl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H10N2O2Purity:Min. 95%Molecular weight:154.17 g/mol3-Fluoro-4-hydroxybenzoic acid methyl ester
CAS:<p>Please enquire for more information about 3-Fluoro-4-hydroxybenzoic acid methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H7O3FPurity:Min. 95%Molecular weight:170.14 g/mol4-Isopropoxyphenylboronic acid
CAS:<p>4-Isopropoxyphenylboronic acid is a boronic acid that can be used as a cross-coupling partner in palladium-catalyzed cross-coupling reactions. It is synthesized by reacting 4-hydroxyphenylacetic acid with 2 equivalents of naphthoquinone diazide. The addition of the 4-isopropoxy group to the phenyl substituent increases the reactivity of this boronic acid. This compound has been used in the synthesis of rofecoxib and cyclooxygenase inhibitors, such as aspirin and ibuprofen. The presence of an electron withdrawing group on one phenyl ring enhances the reactivity of this boronic acid towards nucleophiles, such as amines or alcohols.</p>Formula:C9H13BO3Purity:Min. 95%Molecular weight:180.01 g/mol(5-bromo-2-fluorophenyl)boronic Acid
CAS:<p>5-Bromo-2-fluorophenyl)boronic acid is a synthetic chemical that is used in the synthesis of pharmaceuticals and pesticides. This compound is an inhibitor of bace1, which is an enzyme involved in the production of amyloid beta peptide (Aβ) and other proteins implicated in Alzheimer's disease. 5-Bromo-2-fluorophenyl)boronic acid has been shown to be effective at reducing Aβ levels in mice with Alzheimer's disease. It also inhibits pyrethroid, a pesticide that is used on crops to control insects, by binding to the active site of the enzyme. 5-Bromo-2-fluorophenyl)boronic acid has been evaluated for use as a cancer treatment, but these studies have not been completed.</p>Formula:C6H5BBrFO2Purity:Min. 95%Molecular weight:218.82 g/mol(5R)-6-Cyano-5-hydroxy-3-oxo-hexanoic acid tert-butyl ester
CAS:<p>Please enquire for more information about (5R)-6-Cyano-5-hydroxy-3-oxo-hexanoic acid tert-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H17NO4Purity:Min. 95%Molecular weight:227.26 g/molFluperolone acetate
CAS:Controlled Product<p>Fluperolone acetate is a synthetic steroid that has been used as an anti-inflammatory agent. It is a potent corticosteroid and has been shown to inhibit the growth of microorganisms, such as bacteria and fungi. Fluperolone acetate does not cross the blood-brain barrier into the central nervous system, so it can be used for the treatment of inflammatory diseases in the eye without affecting vision. This drug also has been shown to reduce choroidal neovascularization in patients with age-related macular degeneration. Some biodegradable implants have been made from fluoropolymers, which are biocompatible polymers that are degraded by hydrolysis or enzymatic action in vivo. These implants may provide a sealant for use in surgical procedures and for treating cavities.</p>Formula:C24H31FO6Purity:Min. 95%Molecular weight:434.5 g/mol(R,R)-1,2-Cyclohexanedicarboxylic acid
CAS:<p>(R,R)-1,2-Cyclohexanedicarboxylic acid is a cyclohexane carboxylic acid which has been used as a pharmaceutical intermediate. It is a chiral molecule with two stereogenic centers and can exist in enantiomeric forms. The (R,R) form of the compound is most commonly used in pharmaceuticals due to its higher solubility in water. The (S,S) form of the compound is more reactive than the (R,R) form and can be used for reactions that require a high reactivity. (S,S)-1,2-Cyclohexanedicarboxylic acid has been found to have clinical uses such as the treatment of amines and cyclohexane rings.</p>Formula:C8H12O4Purity:Min. 95%Molecular weight:172.18 g/molMethyl3-iodothiophene-2-carboxylate
CAS:<p>Methyl3-iodothiophene-2-carboxylate is a chemical compound that is involved in the biosynthesis of eicosanoids. It can be synthesized by the cyclization of the corresponding lactam to produce an intermediate, which is then converted to methyl3-iodothiophene-2-carboxylate by hydrolysis or reduction. This compound has been shown to inhibit malaria parasites such as Plasmodium falciparum and Plasmodium vivax. Methyl3-iodothiophene-2-carboxylate also inhibits the growth of bacteria such as Staphylococcus aureus and Bacillus subtilis. The mechanism of action is believed to be due to its ability to inhibit protein synthesis by binding with ribosomes in prokaryotic cells.END></p>Formula:C6H5IO2SPurity:Min. 95%Molecular weight:268.07 g/mol16a-Methyl prednisolone 21-acetate
CAS:Controlled Product<p>Please enquire for more information about 16a-Methyl prednisolone 21-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H32O6Purity:Min. 95%Molecular weight:416.51 g/mol5-Bromo-1H-indole-2-carboxylic acid methyl ester
CAS:<p>5-Bromo-1H-indole-2-carboxylic acid methyl ester is a drug that belongs to the class of carboxylates. It has been shown to inhibit the growth of tumor cells in vitro and in vivo. The antitumor activity of this compound may be due to its ability to stabilize planar indole moieties, which are cytotoxic. 5-Bromo-1H-indole-2-carboxylic acid methyl ester interacts with other molecules through intermolecular interactions and can form an indole ring system that has a trifluoromethyl group and a carboxylate group in its structure.</p>Formula:C10H8BrNO2Purity:Min. 95%Molecular weight:254.08 g/molMethyl 4,5-dimethoxy-1-methyl-1H-indole-2-carboxylate
CAS:Controlled Product<p>Please enquire for more information about Methyl 4,5-dimethoxy-1-methyl-1H-indole-2-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H15NO4Purity:Min. 95%Molecular weight:249.26 g/mol3-Isoquinolinecarboxylic acid
CAS:<p>3-Isoquinolinecarboxylic acid is a molecule with a reactive group that can form cyclic structures. It has been shown that 3-Isoquinolinecarboxylic acid is an apoptotic agent in human macrophages and induces the release of picolinic acid from these cells. This molecule also has a high affinity for α7 nicotinic acetylcholine receptors, which are present on the surface of nerve cells. 3-Isoquinolinecarboxylic acid can be synthesized by condensing picolinic acid, an aromatic aminoacid, with an appropriate amine. The synthesis of this heterocycle is catalyzed by an enzyme called quinolinate synthase. The product of this reaction is oxidized to form 3-isoquinolyl carboxylic acid. The final step in the synthesis involves the oxidative cleavage of a disulfide bond using hydrogen peroxide, yielding 3-isoquinoly</p>Formula:C10H7NO2Purity:Min. 95%Molecular weight:173.17 g/mol4-(N-Methylamino)phenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-(N-Methylamino)phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H20BNO2Purity:Min. 95%Molecular weight:233.11 g/mol4-Chlorobutyric acid
CAS:<p>4-Chlorobutyric acid is a fatty acid with the chemical formula CH3ClC(O)CH2CO2H. It can be found in animal fats, vegetable oils, and butter. 4-Chlorobutyric acid has been shown to inhibit the growth of PC12 cells by hydrogen bonding to the cell membrane. This inhibition results in an increase in sodium hydroxide solution activity, which leads to increased production of gamma-aminobutyric acid. The butyrolactone that is produced inhibits nerve function and has been shown to have biological treatment potential for hydrochloric acid and cell culture models.</p>Formula:C4H7ClO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:122.55 g/molDibromoisocyanuric acid
CAS:<p>Dibromoisocyanuric Acid is an intermediate in the metabolism of fatty acids. It has been shown to inhibit fatty acid synthesis by inhibiting the transfer reactions of fatty acids from their acyl coenzyme A ester to carnitine, which is necessary for transport across the mitochondrial membrane. Dibromoisocyanuric Acid also inhibits monoclonal antibody production by monocytes and macrophages. Dibromoisocyanuric Acid may be used as a tumor suppressor in mice with tumors because it reduces gamma-aminobutyric acid levels, leading to increased locomotor activity and decreased body mass index.</p>Formula:C3HBr2N3O3Purity:Min. 95%Color and Shape:PowderMolecular weight:286.87 g/mol7-Methyluric acid
CAS:Controlled Product<p>7-Methyluric acid is a purine derivative that is excreted in the urine. This compound can be used to measure the metabolic rate of an individual. 7-Methyluric acid reacts with caffeine to produce methylxanthines and uric acid, which are then measured by chromatographic methods. In order to measure the metabolic rate, a known amount of caffeine is given orally to Sprague-Dawley rats for a period of time, followed by measurement of 7-methyluric acid in their urine samples. The results show that the metabolic rate increases linearly with time.</p>Formula:C6H6N4O3Purity:Min. 95%Color and Shape:PowderMolecular weight:182.14 g/mol6-Methylnicotinic acid
CAS:<p>6-Methylnicotinic acid is the major metabolite of nicotine, which is a natural alkaloid. The formation of 6-methylnicotinic acid from nicotine in the body is induced by carbon sources such as glucose and sucrose. This compound has been shown to inhibit herpes simplex virus type 1 replication in tissue culture and animal experiments. 6-Methylnicotinic acid also has an effect on the reaction rate of 2-chloro-6-methylnicotinic acid with hydrogen gas, forming methyl nicotinate, which is an organic acid found in tobacco leaves. 6-Methylnicotinic acid is hydrophilic and can be separated from other compounds using hydrophilic interaction chromatography (HIC).</p>Formula:C7H7NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:137.14 g/molα,α-Difluorophenylacetic acid
CAS:<p>Please enquire for more information about alpha,alpha-Difluorophenylacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H6F2O2Purity:Min. 95%Molecular weight:172.13 g/molD-Lactic acid lithium
CAS:<p>D(+)-Lactic acid lithium salt is a dipolar molecule with an activation energy of about 44 kJ/mol. It has been studied by NMR techniques and found to have a resonance in the range of 1.8-2.0 ppm, which is characteristic of protons on the oxygen atom. The proton magnetic resonance (PMR) study showed that the d-lactate resonances were very broad and shifted to higher frequencies, whereas the l-lactate resonances were sharp and shifted to lower frequencies. This may be due to the different number of protons on each type of lactate molecule. The magnetic resonance (NMR) study showed that lithium salt was a radical with a spin density distribution around 2.6 ppm in the nmr spectrum.</p>Formula:C3H6O3•LiPurity:Min. 95%Color and Shape:PowderMolecular weight:97.02 g/molβ-CIT-FP
CAS:Controlled Product<p>Methyl (1R,2S,3S)-8-(3-Fluoropropyl)-3-(4-Iodophenyl)-8-Azabicyclo[3.2.1]Octane-2-Carboxylate is a potent dopamine receptor agonist with a high affinity for the D2 and D3 receptors in the brain. It has been shown to have antiparkinsonian effects in animal models of Parkinson's disease by increasing dopamine levels in the prefrontal cortex and striatum. This drug has also been shown to be effective in clinical studies for the diagnosis of Parkinson's disease. Methyl (1R,2S,3S)-8-(3-Fluoropropyl)-3-(4-Iodophenyl)-8-Azabicyclo[3.2.1]Octane-2-Carboxylate binds to both dopamine and serotonin receptors, which may account for its therapeutic effects on Parkinson</p>Formula:C18H23FINO2Purity:Min. 95%Molecular weight:431.28 g/molEthyl 7-Methoxy-1H-Indazole-3-Carboxylate
CAS:Controlled Product<p>Please enquire for more information about Ethyl 7-Methoxy-1H-Indazole-3-Carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12N2O3Purity:Min. 95%Molecular weight:220.22 g/mol4-Piperazinylphenylboronic acid, pinacol ester
CAS:<p>Please enquire for more information about 4-Piperazinylphenylboronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H25BN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:288.19 g/mol2-(Bromomethyl)acrylic acid
CAS:<p>2-(Bromomethyl)acrylic acid is a monomer that has been synthesized from bromoacetic acid and acrylic acid. It is an efficient method for the synthesis of 2-bromoethyl acrylate, which can be used as a precursor for polyurethanes and other polymers. The 2-bromoethyl acrylate can be obtained through allylation with ethylene glycol, followed by hydrolysis to produce acrylic acid. This monomer reacts with free hydroxyl groups to form esters and ethers. It also reacts with nitrogen atoms to form amides or nitriles. Cell culture studies have shown that this compound has no toxic effects on human erythrocytes or hepatocytes.</p>Formula:C4H5BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:164.99 g/mol1,5-Diphenyl-1H-pyrazole-3-carboxylic acid
CAS:Controlled Product<p>1,5-Diphenyl-1H-pyrazole-3-carboxylic acid is a herbicide that belongs to the family of alkyloxycarbonyl amides. It is used in weed control and has shown good activity against many broadleaf weeds. 1,5-Diphenyl-1H-pyrazole-3-carboxylic acid inhibits the growth of plants by interfering with photosynthesis and the production of chlorophyll. The compound binds to the thylakoid membrane in chloroplasts, preventing electron transport and blocking the synthesis of carbohydrates from carbon dioxide and water. This leads to cell death as a result of oxygen depletion. 1,5-Diphenyl-1H-pyrazole-3-carboxylic acid also inhibits acetolactate synthase in plants, which produces amides that are important for protein synthesis.</p>Formula:C16H12N2O2Purity:Min. 95%Molecular weight:264.28 g/mol5-[(3,5-Dimethyl-1H-pyrazol-1-yl)methyl]-2-furoic acid
CAS:<p>Please enquire for more information about 5-[(3,5-Dimethyl-1H-pyrazol-1-yl)methyl]-2-furoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12N2O3Purity:Min. 95%Molecular weight:220.22 g/mol4-Phenoxyphenylboronic acid
CAS:<p>4-Phenoxyphenylboronic acid is a chemical inhibitor of protein kinase. It binds to the ATP binding site of the enzyme and prevents ATP from binding, thereby inhibiting the phosphorylation of proteins. This inhibition blocks the activation of downstream pathways that are involved in cell proliferation, leading to apoptotic cell death. 4-Phenoxyphenylboronic acid has been shown to inhibit growth of human cancer cells in vitro. This molecule also inhibits root formation and plant growth, which may be due to its ability to selectively inhibit protein kinases found in plant cells.</p>Formula:C12H11BO3Purity:Min. 95%Molecular weight:214.02 g/molN-α-Trityl-Nβ-Fmoc-L-2,3-diaminopropionic acid
CAS:<p>Please enquire for more information about N-alpha-Trityl-Nbeta-Fmoc-L-2,3-diaminopropionic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H32N2O4Purity:Min. 95%Molecular weight:568.66 g/molPyridine-3-sulfonic acid
CAS:<p>Pyridine-3-sulfonic acid is a reactive molecule that can exist in two forms. It reacts with iron oxides to form pyridine-3-sulfonic acid amide and reacts with picolinic acid to form pyridine-3-sulfonic acid phosphoric acid complex. Pyridine 3 sulfonic acid is an intermediate in the synthesis of picolinic acid and is involved in the genetic mechanisms of bacteria. It has been shown to be effective at concentrations of 10 mM or higher when used in tissue culture experiments. The optimum concentration for the reaction varies depending on the reactant and its environment, which is why experimentation should be conducted before using it as a reagent.</p>Formula:C5H5NO3SPurity:Min. 95%Molecular weight:159.16 g/mol4-bromo-2,5-difluorobenzoic Acid
CAS:<p>4-Bromo-2,5-difluorobenzoic acid is a potent inhibitor of isoforms CYP2C9 and CYP2D6. It is an acidic drug with a pKa of 3.8, which makes it ionizable in biological fluids. 4-Bromo-2,5-difluorobenzoic acid inhibits the activity of CYP2C9 and CYP2D6 by binding to the pharmacophore region of these enzymes. 4-Bromo-2,5-difluorobenzoic acid also has an isosteric functionality that increases its selectivity for CYP2C9 and CYP2D6 over other cytochrome P450 isoforms. The functional groups on 4-bromo-2,5-difluorobenzoic acid are part of the inhibitor's nature that make it selective for these two cytochrome</p>Formula:C7H3BrF2O2Purity:Min. 95%Molecular weight:237 g/mol4-(Ethoxycarbonyl)phenylboronic acid
CAS:<p>4-(Ethoxycarbonyl)phenylboronic acid is a potential use for picric acid detection. It has been shown to be a chemosensor with an electrochemical impedance spectroscopy response that is sensitive to chloride ions. 4-(Ethoxycarbonyl)phenylboronic acid can be used as a linker in multigram-scale synthesis of aryl halides, and its reaction mechanism has been elucidated by crystal x-ray diffraction. The synthesis of this compound is scalable and involves the formation of an apical carboxylate from ethoxycarbonyl phenyl boronic acid and an aryl halide.</p>Formula:C9H11BO4Purity:Min. 95%Color and Shape:PowderMolecular weight:193.99 g/molBoc-L-aspartic acid a-9-fluorenylmethyl ester
CAS:<p>Boc-L-aspartic acid a-9-fluorenylmethyl ester is a synthetic compound that mimics the structure of acetylcholine. It has been shown to be an efficient method for generating pseudopeptides and cyclic peptides. This compound may be used as a surrogate for acetylcholine in virus research, since it can bind to the same receptor. Boc-L-aspartic acid a-9-fluorenylmethyl ester has also been used to generate monoclonal antibodies that are neutralizing against foot-and-mouth disease viruses.</p>Formula:C23H25NO6Purity:Min. 97 Area-%Molecular weight:411.45 g/molPerfluorophenyl 1-Benzyl-1H-Imidazole-4-Carboxylate
CAS:Controlled Product<p>Please enquire for more information about Perfluorophenyl 1-Benzyl-1H-Imidazole-4-Carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H9F5N2O2Purity:Min. 95%Molecular weight:368.26 g/moltert-butyl (2S)-2-Methyl-4-oxopiperidine-1-carboxylate
CAS:<p>Please enquire for more information about tert-butyl (2S)-2-Methyl-4-oxopiperidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO3Purity:Min. 95%Molecular weight:213.27 g/mol8-Ethyl-1,3,4,9-tetrahydro-1-(1-methylethyl)pyrano[3,4-b]indole-1-acetic acid
CAS:<p>Please enquire for more information about 8-Ethyl-1,3,4,9-tetrahydro-1-(1-methylethyl)pyrano[3,4-b]indole-1-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H23NO3Purity:Min. 95%Color and Shape:SolidMolecular weight:301.38 g/molDiisopropylammonium dichloroacetate
CAS:Controlled Product<p>Diisopropylammonium dichloroacetate (DADCA) is a chemical that inhibits the metabolism of glucose. It has been shown to have a hypoglycemic effect in rats and is being investigated as a treatment for metabolic disorders such as diabetes and obesity. DADCA has also been shown to reduce liver lesions in animals with chronic viral hepatitis, and has been found to be effective in reducing tumor growth in mice. This drug can also be used to treat bowel disease by reducing the amount of ammonia released by bacteria. DADCA may also have physiological effects on humans, including an increase in blood pressure and fever, although these effects have not yet been studied.</p>Purity:Min. 95%Mercuric trifluoroacetate
CAS:Controlled Product<p>Mercuric trifluoroacetate is an organic compound that contains mercury and a carboxylic acid. It is an acid that is formed when mercury reacts with hydrochloric acid. Mercuric trifluoroacetate has been shown to be effective in the synthesis of a number of organic compounds, including the nonsteroidal anti-inflammatory drug (NSAID) 3-hydroxyanthranilic acid. This compound also inhibits the production of prostaglandin E2 in human leukocytes, which may be related to its inhibitory properties on congestive heart failure. Mercuric trifluoroacetate can also cause autoimmune diseases in mice by suppressing the production of interleukin-4 and interleukin-10, which are cytokines involved in immune responses.</p>Formula:C4F6HgO4Purity:Min. 95%Molecular weight:426.62 g/mol5-Fluoropyridine-2-boronic acid
CAS:<p>Please enquire for more information about 5-Fluoropyridine-2-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H5BFNO2Purity:Min. 95%Molecular weight:140.91 g/molL-Azetidine-2-carboxylic acid
CAS:<p>L-Azetidine-2-carboxylic acid is a natural product that has been shown to have anticancer effects. It has been shown to induce apoptosis in cancer cells by binding to response elements on the DNA, which causes DNA damage and cell death. L-Azetidine-2-carboxylic acid also inhibits protein synthesis by interfering with the uptake of amino acids, which are essential for protein production. This compound is not toxic to healthy cells because it cannot cross the lipid bilayer of the cell membrane. L-Azetidine-2-carboxylic acid also induces autophagy in cancer cells, causing them to destroy their own cellular components. There is evidence that this compound may be effective for other diseases such as diabetes and neurodegenerative disorders due to its ability to regulate intracellular calcium levels and its cytosolic function as a substrate molecule.</p>Formula:C4H7NO2Purity:Min. 95%Color and Shape:White To Light (Or Pale) Yellow SolidMolecular weight:101.1 g/mol2-Amino-4,6-difluorobenzoic acid
CAS:<p>Please enquire for more information about 2-Amino-4,6-difluorobenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5F2NO2Purity:Min. 95%Molecular weight:173.12 g/mol(Des-Gly10,D-Leu6,D-Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6,D-Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/mol3-(2-Ethyl-1H-imidazol-1-yl)-2-methylpropanoic acid
CAS:Controlled Product<p>Please enquire for more information about 3-(2-Ethyl-1H-imidazol-1-yl)-2-methylpropanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H14N2O2Purity:Min. 95%Molecular weight:182.22 g/mol2-Fluoro-3-(trifluoromethyl)benzoic acid
CAS:<p>2-Fluoro-3-(trifluoromethyl)benzoic acid is an amide that has been shown to inhibit the growth of Huh-7 human hepatoma cells, which express ABCA1. This compound has been shown to bind to and inhibit the activity of the enzyme acid hydrazide. It has also been shown to be active against methoxy functional assays and macrophage cell lines.</p>Formula:C8H4F4O2Purity:Min. 95%Molecular weight:208.11 g/mol5-Norbornene-2-carboxylic acid
CAS:<p>5-Norbornene-2-carboxylic acid is a reactive, carbonyl compound that has been used in metathesis reactions. In these reactions, the 5-norbornene-2-carboxylic acid reacts with sodium carbonate to form a mixture of hydroxy methyl and fluorine groups. The 5-norbornene-2-carboxylic acid can be prepared by reacting phenol with anhydrous hydrogen fluoride in the presence of sodium carbonate. This reaction produces a mixture of 5-norbornene-2 carboxylic acids, but also includes isomeric mixtures that are not useful as starting materials for synthesis. The 5-norbornene -2 carboxylic acid can also be synthesized from aliphatic hydrocarbons such as propylene or ethylene. It is important to note that the 5 - norborenene 2 carboxylic acid does not have any aromatic rings and is therefore</p>Formula:C8H10O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:138.16 g/mol2,3-Dibromopropanoic acid
CAS:<p>2,3-Dibromopropanoic acid is a carcinogenic chemical that has been shown to cause liver tumors in rats. It is a nucleophile that reacts with amide groups to form an amide bond. The analytical method for 2,3-dibromopropanoic acid is gas chromatography with flame ionization detection. Its structural formula is CHBrCHBrCOH. It has a carbonyl group and acidic properties, as well as a chloride ion present on the molecule. 2,3-Dibromopropanoic acid is an anxiolytic drug that has been shown to have health effects such as drowsiness and headache.</p>Formula:C3H4Br2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:231.87 g/molMART-1 (26-35) (human) trifluoroacetate salt
CAS:<p>Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas.<br>The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity.<br>It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide.<br>Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).</p>Formula:C42H74N10O14Purity:Min. 95%Molecular weight:943.1 g/mol2,6-Dichlorophenylacetic acid
CAS:<p>2,6-Dichlorophenylacetic acid is an inhibitor of the enzyme acetylcholinesterase. It has been shown to be effective in a number of functional assays and is efficient at inhibiting the uptake of 2,6-dichlorobenzoic acid in cells. The inhibition of this enzyme by 2,6-dichlorophenylacetic acid may be due to its protonation and binding to the active site. This binding prevents the release of the acetylcholine molecule that has been bound to the enzyme's active site. This results in increased levels of acetylcholine in the synaptic cleft, leading to an increase in neurotransmitter activity, which can have a variety of effects on neuronal function. 2,6-Dichlorophenylacetic acid also inhibits cell proliferation and induces apoptosis (programmed cell death) in Caco-2 cells by inhibiting protein synthesis.</p>Formula:C8H6Cl2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:205.04 g/mol5,5'-Thiodisalicylic Acid
CAS:<p>5,5'-Thiodisalicylic Acid is a reactive functional group with a silver ion. This compound has a hydrochloric acid and hydroxy group that react to form a hydroxyl group with the proton. It also has a nitrogen atom, which can be found in the reactive acidic hydroxyl group of 5,5'-thiodisalicylic acid. The fatty acids are viscosity and carbonyl groups. 5,5'-Thiodisalicylic Acid is an organic compound that reacts with chloride to form patterns.</p>Purity:Min. 95%5a-Dihydrocortisol 21-acetate
CAS:Controlled Product<p>Please enquire for more information about 5a-Dihydrocortisol 21-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H34O6Purity:Min. 95%Molecular weight:406.51 g/mol4-Phenoxybutyric acid
CAS:Controlled Product<p>4-Phenoxybutyric acid is a molecule that is produced by filamentous fungi. It has been shown to inhibit the growth of many bacteria, including Staphylococcus aureus, Salmonella typhimurium, and Enterobacter aerogenes. 4-Phenoxybutyric acid binds to the receptor on the surface of the bacterial cell membrane and prevents it from functioning correctly. It also prevents the production of proteins necessary for growth and survival. This inhibition leads to a loss of energy in the cell, which eventually leads to death. The molecule has been shown to be effective in inhibiting bacteria even if they are resistant to antibiotics. 4-Phenoxybutyric acid has been shown to be more efficient than other methods for microbial biotransformation, such as dispersive solid-phase extraction or liquid-liquid extraction.</p>Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/mol4-Chloroquinoline-6-carboxylicacid
CAS:<p>Please enquire for more information about 4-Chloroquinoline-6-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H6ClNO2Purity:Min. 95%Molecular weight:207.61 g/mol4-Cyano-2-methylphenylboronic acid, pinacol ester
CAS:<p>Please enquire for more information about 4-Cyano-2-methylphenylboronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18BNO2Purity:Min. 95%Molecular weight:243.11 g/molL-Menthyl 2,2-dihydroxyacetate
CAS:<p>L-Menthyl 2,2-dihydroxyacetate is a synthetic compound that belongs to the group of salicylic acid derivatives. It is an intermediate in the synthesis of other compounds and can be recycled. L-Menthyl 2,2-dihydroxyacetate reacts with primary amines to form iminoacetic esters and glyoxylates by acidic hydrolysis. The reaction time depends on the type of amine and the acidity of the solution. This compound has been used as a reagent to synthesize maleic anhydride from maleic acid. L-Menthyl 2,2-dihydroxyacetate is also used in methodologies for oxidizing aromatic compounds to produce benzoic acids or phenols.</p>Formula:C12H22O4Purity:Min. 95%Color and Shape:PowderMolecular weight:230.3 g/mol1-Boc-4-aminopiperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-Boc-4-aminopiperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O4Purity:Min. 95%Color and Shape:White To Beige SolidMolecular weight:244.29 g/mol3-[2-(Ethoxycarbonyl)-1-methyl-1H-indol-3-yl]propanoic acid
CAS:Controlled Product<p>Please enquire for more information about 3-[2-(Ethoxycarbonyl)-1-methyl-1H-indol-3-yl]propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H17NO4Purity:Min. 95%Molecular weight:275.3 g/mol2-Diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride
CAS:<p>2-Diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride is a methyltransferase inhibitor that blocks the synthesis of monoethyl ether, which is used to synthesize dicyclomine. It has been shown to be effective in vitro against biological samples such as rat liver and blood cells. 2-Diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride also has been shown to have a pharmacological effect on rats with bowel disease, congestive heart failure, and crystalline cellulose. The chemical structure of 2-Diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride is similar to that of phosphorus pentoxide, which makes it difficult for this drug to cross the blood brain barrier.</p>Formula:C19H36ClNO2Purity:Min. 95%Molecular weight:345.95 g/mol3,3-Dimethyl-5-oxo-5-(1,2,3,4-tetrahydronaphthalen-2-ylamino)pentanoic acid
CAS:Controlled Product<p>Please enquire for more information about 3,3-Dimethyl-5-oxo-5-(1,2,3,4-tetrahydronaphthalen-2-ylamino)pentanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23NO3Purity:Min. 95%Molecular weight:289.37 g/mol5-Methyl-1H-pyrrole-3-carboxylic acid
CAS:<p>Please enquire for more information about 5-Methyl-1H-pyrrole-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7NO2Purity:Min. 95%Molecular weight:125.13 g/molEthyl 1-benzyl-3-(4-bromophenyl)-1H-pyrazole-5-carboxylate
CAS:Controlled Product<p>Please enquire for more information about Ethyl 1-benzyl-3-(4-bromophenyl)-1H-pyrazole-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17BrN2O2Purity:Min. 95%Molecular weight:385.25 g/mol1-N-Boc-pyrrolidine-3-(S)-methylcarboxylate
CAS:<p>Please enquire for more information about 1-N-Boc-pyrrolidine-3-(S)-methylcarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/mol6-Bromohexanoic acid
CAS:<p>6-Bromohexanoic acid is a fatty acid that has been shown to be an effective agent for the treatment of cancer. It is used in gene therapy to inhibit the growth of cancer cells by binding to and then activating transcription factors. 6-Bromohexanoic acid can also be used as a chemotherapeutic agent and has been shown to cause apoptosis in monoclonal antibody-treated cells. 6-Bromohexanoic acid has pharmacokinetic properties that are similar to those of other fatty acids. The reaction solution was found to have high chemical stability, which may be due to the presence of nitrogen atoms. This reaction solution was found to adsorb onto the surface of monoclonal antibodies and cell culture, altering their properties.</p>Formula:C6H11BrO2Purity:Min. 97.0%Color and Shape:PowderMolecular weight:195.05 g/molFluorometholone acetate
CAS:Controlled Product<p>Fluorometholone acetate is a fluorinated corticosteroid that is used in ophthalmology to treat eye disorders. It has been shown to reduce intraocular pressure in patients with glaucoma and other eye diseases. Fluorometholone acetate inhibits the activity of the glucocorticoid receptor, which prevents it from binding to DNA and altering gene expression. This leads to a decrease in inflammatory responses by decreasing the production of cytokines and chemokines that are involved in inflammation. Fluorometholone acetate also binds to other receptors, such as the mineralocorticoid receptor, which may lead to its use as a potential biomarker for infectious diseases.</p>Formula:C24H31FO5Purity:Min. 95%Molecular weight:418.5 g/molEthyl (2,3,4,5-tetrafluorobenzoyl)acetate
CAS:<p>Ethyl (2,3,4,5-tetrafluorobenzoyl)acetate is a new oxazine derivative that inhibits bacterial growth by binding to the DNA gyrase and topoisomerase IV. It also exhibits antibacterial activity against Gram-positive bacteria such as methicillin-resistant Staphylococcus aureus (MRSA). This compound is an analog of the quinolone antibacterials. The most efficient example of this class of compounds is ofloxacin.</p>Formula:C11H8F4O3Purity:Min. 95%Color and Shape:PowderMolecular weight:264.17 g/mol(R)-(-)-3-Hydroxybutyric acid methyl ester
CAS:<p>(R)-(-)-3-Hydroxybutyric acid methyl ester is a monocarboxylic acid that is metabolized by phosphofructokinase and other enzymes to produce the corresponding 3-hydroxybutyrate. This compound is synthesized from tiglic acid, which can be obtained from corynebacterium. The production of (R)-(-)-3-Hydroxybutyric acid methyl ester can be optimized by using a biotransformation process. This process includes enzymatic reactions and chemical transformations, such as hydroxylation, carbonylation, and stereoselective synthesis. The metabolic pathway for this compound has been studied using a DNA microarray analysis.</p>Formula:C5H10O3Purity:Min. 95%Molecular weight:118.13 g/mol6-Deschloro-4-chloro cyproterone acetate
CAS:Controlled Product<p>Please enquire for more information about 6-Deschloro-4-chloro cyproterone acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29ClO4Purity:Min. 95%Molecular weight:416.94 g/mol[2-(3,4-Dimethoxyphenyl)-1,3-thiazol-4-yl]acetic acid
CAS:<p>Please enquire for more information about [2-(3,4-Dimethoxyphenyl)-1,3-thiazol-4-yl]acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H13NO4SPurity:Min. 95%Molecular weight:279.31 g/molEltrombopag olamine
CAS:<p>Eltrombopag olamine is an orally active drug that belongs to the class of thiazolidinones. It has been used for the treatment of thrombocytopenia in patients with chronic liver disease and myelodysplastic syndrome. Eltrombopag olamine inhibits platelet aggregation by binding to glycoprotein IIb/IIIa receptors on the surface of platelets. The drug is a prodrug that is metabolized in vivo to its active form, eltrombopag. This conversion is catalysed by CYP3A4 and CYP2D6 enzymes and can be inhibited by drugs that inhibit these enzymes, such as trifluoroacetic acid and hydroxyl group-containing compounds. Eltrombopag olamine binds to erythrocytes, which may be due to its ability to form intramolecular hydrogen bonds with nitrogen atoms. The synthesis of elt</p>Formula:C25H22N4O4•(C2H7NO)2Purity:Min. 95%Color and Shape:PowderMolecular weight:564.63 g/mol4-(4-Bromophenoxy)butanoic acid
CAS:Controlled Product<p>Please enquire for more information about 4-(4-Bromophenoxy)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H11BrO3Purity:Min. 95%Molecular weight:259.1 g/molEthyl 5-chloro-1,3-dimethyl-1H-indole-2-carboxylate
CAS:Controlled Product<p>Please enquire for more information about Ethyl 5-chloro-1,3-dimethyl-1H-indole-2-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H14ClNO2Purity:Min. 95%Molecular weight:251.71 g/molZ-α-aminoisobutyric acid
CAS:<p>Z-alpha-aminoisobutyric acid is an amide with a conformational pattern that resembles the alpha-helix. It has been shown to inhibit the formation of oligomers, which are aggregates of peptides and proteins, in the gas phase. Z-alpha-aminoisobutyric acid also stabilizes peptides and proteins in aqueous solution by preventing them from forming intramolecular hydrogen bonds. The infrared spectroscopy shows that z-alpha-aminoisobutyric acid is a conformer with a dihedral angle of about 120 degrees.</p>Formula:C12H15NO4Purity:Min. 95%Molecular weight:237.25 g/mol1,2,3,4-Tetrahydro-1-naphthoic acid
CAS:<p>Tetrahydro-1-naphthoic acid is a toxic chemical that is used in the synthesis of various organic compounds. It is an organic acid that has a pungent odor and can cause irritation of the nose and throat. When heated, it evolves toxic fumes of hydrogen chloride gas and phosgene. Tetrahydro-1-naphthoic acid reacts with metal hydroxides to form metal tetrahydro-1-naphthoates, which have useful properties as catalysts in organic reactions. Tetrahydro-1-naphthoic acid has been used as a growth regulator in plants and animals. It binds to DNA at the C–H site, preventing protein synthesis and cell division by inhibiting RNA synthesis.</p>Formula:C11H12O2Purity:Min. 95%Molecular weight:176.21 g/molGlutaconic acid
CAS:<p>Glutaconic acid is a carboxylic acid that inhibits the production of malonic acid by inhibiting the activity of the enzyme succinate dehydrogenase. This inhibition leads to the accumulation of ethylmalonic acid, which can be detected in urine. Glutaconic acid is used as a diagnostic test for diseases such as diabetic neuropathy and infectious diseases such as malaria. It also has inhibitory properties on glutamate-induced neuronal death, making it a potential therapeutic agent for conditions such as amyotrophic lateral sclerosis and Parkinson's disease.</p>Formula:C5H6O4Purity:Min. 95%Molecular weight:130.1 g/mol2-Methylnicotinic acid methyl ester
CAS:<p>2-Methylnicotinic acid methyl ester is a synthetic chemical compound that belongs to the isomer family. It has been used in the synthesis of cocaine and isomers, as well as in the modification of drugs. 2-Methylnicotinic acid methyl ester can be synthesised from 2-methylpyridine and formaldehyde via the method of methylmagnesium iodide. 2-Methylnicotinic acid methyl ester has been shown to be a potent inhibitor of human platelet aggregation, which may be due to its structural similarity to nicotine.</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/molIsopropenyl acetate
CAS:<p>Isopropenyl acetate is a fatty acid that is esterified with acetic anhydride to form a quinoline derivative. This reaction is catalyzed by the addition of concentrated hydrochloric acid and zirconium oxide. The product can be used as a reactant in cationic polymerization reactions. Isopropenyl acetate has been shown to have kinetic and thermodynamic properties that are similar to those of other polyethers, and it also reacts in the same manner as glycol ethers.</p>Formula:C5H8O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:100.12 g/mol1,1-Bis(1,1-dimethylethyl) (3R)-3-[[(9H-fluoren-9-ylmethoxy)carbonyl]amino]-1,1,3-propanetricarboxylate
CAS:<p>Please enquire for more information about 1,1-Bis(1,1-dimethylethyl) (3R)-3-[[(9H-fluoren-9-ylmethoxy)carbonyl]amino]-1,1,3-propanetricarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H35NO8Purity:Min. 95%Molecular weight:525.59 g/mol3-(1-Ethyl-5-methyl-1H-pyrazol-4-yl)isoxazole-5-carboxylic acid
CAS:<p>Please enquire for more information about 3-(1-Ethyl-5-methyl-1H-pyrazol-4-yl)isoxazole-5-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H11N3O3Purity:Min. 95%Molecular weight:221.21 g/mol4-Chloro-3,5-difluorobenzoic acid
CAS:<p>Please enquire for more information about 4-Chloro-3,5-difluorobenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H3ClF2O2Purity:Min. 95%Molecular weight:192.55 g/mol(6R,7R)-3-(Acetoxymethyl)-8-oxo-7-(2-(thiophen-2-yl)acetamido)-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid
CAS:<p>(6R,7R)-3-(Acetoxymethyl)-8-oxo-7-(2-(thiophen-2-yl)acetamido)-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid is an antimicrobial agent that inhibits bacterial growth by binding to the penicillin binding protein (PBP), which prevents the synthesis of peptidoglycan. This drug has shown effectiveness against gram positive bacteria, including aerobacter aerogenes, as well as infectious diseases in wastewater treatment plants. It has also been demonstrated to be effective in experimental models of infection due to high resistance and cell signaling pathways. The reaction solution was analyzed by plasma mass spectrometry.</p>Formula:C16H16N2O6S2Purity:Min. 98%Color and Shape:White PowderMolecular weight:396.44 g/mol4-(4-Hydroxymethyl-3-methoxyphenoxy)-butyric acid
CAS:Controlled Product<p>4-(4-Hydroxymethyl-3-methoxyphenoxy)-butyric acid (HMPA) is a synthetic compound that is used in the production of butyric acid. It is also used as a reagent in the preparation of enzymes and enzyme preparations, such as serine proteases. HMPA has been used as an intermediate in the synthesis of ribulose, which is a sugar molecule found in plants. The structure of this compound can be determined by FTIR spectroscopy and by X-ray crystallography. HMPA has been shown to have hydrogen bonding between its molecules, which may account for its stability. Hydrogen bonding accounts for the solidity of this compound and its resistance to heat and solvents.</p>Formula:C12H16O5Purity:Min. 95%Molecular weight:240.25 g/mol4-[(4-Acetylphenyl)amino]-4-oxobutanoic acid
CAS:<p>Please enquire for more information about 4-[(4-Acetylphenyl)amino]-4-oxobutanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H13NO4Purity:Min. 95%Molecular weight:235.24 g/molD,L-Threo-b-hydroxy aspartic acid
CAS:<p>D,L-Threo-b-hydroxy aspartic acid is a stereoselective synthetic amino acid that has been used to study the uptake and hydrolysis of D,L-threo-b-hydroxy aspartic acid by rat brain synaptosomes. It has also been used in the synthesis of an L-alanine analogue with the same stereochemistry at the chiral center. The stereoselective synthesis of this compound is achieved by epimerization reaction using d-alanine as a starting material. Threo bhda has been shown to inhibit glutamate release from neurons and stimulate GABA release in synaptosomes, which may be due to its ability to bind to ion channels. Threo bhda has also been found to inhibit the binding of radioactive thymidine to calf thymus DNA with a high degree of stereoselectivity.</p>Formula:C4H7NO5Purity:Min. 95%Molecular weight:149.1 g/mol(2S)-2-(1H-Tetrazol-1-yl)propanoic acid
CAS:<p>Please enquire for more information about (2S)-2-(1H-Tetrazol-1-yl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C4H6N4O2Purity:Min. 95%Molecular weight:142.12 g/molPhenylacetic acid 2-phenylethyl ester
CAS:Controlled Product<p>Phenylacetic acid 2-phenylethyl ester is an ester of caproic acid and phenylethyl. It is used as a control agent in the manufacture of chemical substances, detergent compositions, and lemongrass oil. Phenylacetic acid 2-phenylethyl ester can be synthesized by reacting methyl anthranilate with benzoic acid in the presence of phosphotungstic acid. The required starting materials are available from commercial sources. The product has a structural formula that can be confirmed by nmr spectroscopy.</p>Formula:C16H16O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:240.3 g/molTetrahydropyran-3-boronic acid pinacol ester
CAS:<p>Please enquire for more information about Tetrahydropyran-3-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21BO3Purity:Min. 95%Molecular weight:212.09 g/molZiconotide acetate
CAS:Controlled Product<p>Ziconotide acetate is a polymer conjugate of ziconotide and goserelin acetate. It is used to treat severe chronic pain in patients who have not responded to other treatments, such as opioids or local anesthetics. Ziconotide acetate is administered by injection into the intrathecal space, where it acts on nerve cells in the dorsal horn of the spinal cord. The drug is slowly released from the polymer conjugate over time, which effectively reduces its irritant effects. It also has low solubility in water, which helps reduce its rate of clearance from the body. The active substances in this drug are ziconotide and goserelin acetate, both of which have been shown to be effective for treating chronic pain. Ziconotide acetate has also been shown to cause a decrease in blood levels of cholesterol and lipoproteins, although this effect may be due to goserelin acetate rather than ziconotide itself.</p>Formula:C102H172N36O32S7C2H4O2Purity:Min. 95%Molecular weight:2,699.19 g/mol[2-(4-Chlorophenyl)-1,3-thiazol-4-yl]acetic acid
CAS:<p>[2-(4-Chlorophenyl)-1,3-thiazol-4-yl]acetic acid is a potent antimicrobial agent that inhibits the growth of bacteria by binding to the 50S ribosomal subunit. It has shown antiinflammatory properties in animal models of bowel disease, skin cancer, and autoimmune diseases. This drug has also been shown to have no observable toxicity in humans at doses up to 5000 mg/day for 28 days. The drug binds to a number of enzymes including reactive oxygen species (ROS) scavengers and metabolic enzymes. There are no known drug interactions with this drug and it can be used safely with other nonsteroidal antiinflammatory drugs (NSAIDs).</p>Formula:C11H8ClNO2SPurity:Min. 95%Molecular weight:253.71 g/mol1-Methyl-1H-benzimidazole-2-carboxylic acid
CAS:Controlled Product<p>1-Methyl-1H-benzimidazole-2-carboxylic acid is a synthetic compound that can be used as an antiprotozoal. It has been shown to have good activity against intestinalis, vaginalis, and intestinalis species. 1-Methyl-1H-benzimidazole-2-carboxylic acid binds to the acetyl groups of the parasite's cell membrane and inhibits the formation of the cytoplasmic membrane. This prevents the parasite from synthesizing ATP, which causes them to die. 1-Methyl-1H-benzimidazole-2-carboxylic acid also has strong activity against Giardia lamblia, which is caused by its ability to inhibit protein synthesis in this organism.</p>Formula:C9H8N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:176.17 g/mol3,3'-[1,3-Phenylenebis(oxy)]dipropanoic acid
CAS:<p>Please enquire for more information about 3,3'-[1,3-Phenylenebis(oxy)]dipropanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H14O6Purity:Min. 95%Molecular weight:254.24 g/mol4-Aminomethylphenylacetic acid
CAS:<p>4-Aminomethylphenylacetic acid is a nonsteroidal anti-inflammatory drug that is used to treat inflammation and pain. It belongs to the class of peptidomimetics, which are compounds that mimic the structure of a natural biological molecule. 4-Aminomethylphenylacetic acid has an analog with a lactam ring at position 3, which is not present in other NSAIDs. This structural difference may contribute to its high stability and low reactivity. 4-Aminomethylphenylacetic acid has been shown to exhibit antiviral activity against viruses such as HIV or Hepatitis C virus by inhibiting viral replication.</p>Formula:C9H11NO2·HClPurity:Min. 95%Molecular weight:201.65 g/molL-Cysteinesulfinic acid, monohydrate
CAS:<p>Please enquire for more information about L-Cysteinesulfinic acid, monohydrate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C3H7NO4S·H2OPurity:Min. 95%Molecular weight:171.17 g/molKisspeptin-54 (human) trifluoroacetate salt
CAS:<p>Kisspeptin-54 is a mammalian peptide hormone that regulates the release of gonadotropin-releasing hormone (GnRH) from the hypothalamus. Kisspeptin-54 has been shown to be potently immunogenic in humans and can be used as an antigen for the production of monoclonal antibodies. It is also a candidate drug for the treatment of obesity and may have neuroprotective effects. Kisspeptin-54 has been shown to reduce body mass index, which may be due to its ability to stimulate the immune system and promote antibody production against tumors. This peptide also has potent on-line binding properties that are useful in polymerase chain reactions.</p>Formula:C258H401N79O78Purity:Min. 95%Molecular weight:5,857.43 g/mol1H-Pyrrole-2-carboxylic acid, methyl ester
CAS:<p>1H-Pyrrole-2-carboxylic acid, methyl ester is a catalytic asymmetric reagent that can be used to produce chiral derivatives from simple substrates. It has been shown to be effective in the Friedel-Crafts reaction and Wolff-Kishner reduction. The catalyst forms a bond with the carbonyl group of the reactant, which is then cleaved by chloride ions. The reaction time depends on the type of metal halide and solvent used. 1H-Pyrrole-2-carboxylic acid, methyl ester also reacts with acetyl or alkyl groups at low temperatures to form acetate or alkylate products.</p>Formula:C6H7NO2Purity:Min. 95%Molecular weight:125.13 g/molBenzyl bromoacetate
CAS:<p>Benzyl bromoacetate is a bicyclic heterocycle that is metabolized by the enzyme benzyl alcohol dehydrogenase. The resulting metabolites are then converted to methyl benzoate and benzyl alcohol. It has been shown to inhibit prostate cancer cells and basic fibroblasts, which may be due to its ability to inhibit enzymes involved in fatty acid synthesis. Benzyl bromoacetate also has therapeutic effects on autoimmune diseases such as bowel disease, which may be due to its ability to reduce inflammation and suppress the immune system.</p>Formula:C9H9BrO2Purity:Min. 95%Color and Shape:Clear Colourless To Light (Or Pale) Yellow LiquidMolecular weight:229.07 g/mol4,6-Diaminobenzene-1,3-dicarboxylic acid
CAS:<p>4,6-Diaminobenzene-1,3-dicarboxylic acid is an inorganic copper compound that is used as a copper salt. It has been shown to be effective as a chelating agent for the treatment of copper toxicity. 4,6-Diaminobenzene-1,3-dicarboxylic acid binds to metal ions and forms a complex with them. This complex can then be excreted from the body through urine or bile.</p>Formula:C8H8N2O4Purity:Min. 95%Molecular weight:196.16 g/mol5-[2-[4',5-Bis(Pyridin-2-ylsulfamoyl)biphenyl-2-yl]diazenyl]-2-hydroxybenzoic acid
CAS:<p>Please enquire for more information about 5-[2-[4',5-Bis(Pyridin-2-ylsulfamoyl)biphenyl-2-yl]diazenyl]-2-hydroxybenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H22N6O7S2Purity:Min. 95%Molecular weight:630.65 g/molR-(3)-Benzyloxy myristic acid
CAS:<p>R-(3)-Benzyloxy myristic acid is an adjuvant that is used in vaccines. It is a synthetic molecule with the ability to activate antigen-specific CD4 and CD8 T-cells. R-(3)-Benzyloxy myristic acid has been shown to be an efficient method of enhancing antigen-specific antibody production by stimulating dendritic cells. This agent is also pH sensitive and can be used as a vaccine adjuvant at acidic pH values, which are found in the stomach. R-(3)-Benzyloxy myristic acid has been shown to stimulate T-cell proliferation and increase the expression of co-stimulatory molecules on these cells, increasing the efficiency of immunization.</p>Formula:C21H34O3Purity:Min. 95%Molecular weight:334.49 g/mol3-Oxopentanoic acid
CAS:<p>3-Oxopentanoic acid is a fatty acid that is produced by the subunits of the liver. It is metabolized to propionyl CoA and then converted to 3-hydroxybutyrate or acetoacetate in the mitochondria. The conversion of propionyl CoA to 3-oxopentanoic acid is catalyzed by an amide synthetase, while the conversion of 3-oxopentanoic acid to acetoacetate is catalyzed by a β-ketothiolase. This fatty acid has been shown to be useful for the treatment of diabetes because it suppresses insulin secretion from pancreatic β cells and improves glucose uptake in muscle cells. It has also been speculated that this compound may have anti-inflammatory properties due to its inhibition of prostaglandin synthesis.</p>Formula:C5H8O3Purity:Min. 95%Color and Shape:PowderMolecular weight:116.12 g/molBoc-4-(4-fluorophenyl)-piperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about Boc-4-(4-fluorophenyl)-piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H22FNO4Purity:Min. 95%Molecular weight:323.36 g/mol4-Chloro-benzene-sulfinic acid sodium salt
CAS:<p>The 4-chloro-benzenesulfinic acid sodium salt is a type of sulfinic acid. It can be used to control experiments involving methides, halides, and human macrophages. Sodium salts of this compound have been shown to inhibit the growth of Candida glabrata and Galleria mellonella in vitro. The 4-chloro-benzenesulfinic acid sodium salt reacts with chloride ion to form a nucleophilic trifluoroacetate anion, which reacts with thiosulfonates to produce type strain. Trifluoroacetic acid is used as a solvent in the reaction.</p>Formula:C6H4ClNaO2SPurity:Min. 95%Molecular weight:198.6 g/moltert-Butyl 3-(cyclopropylamino)azetidine-1-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 3-(cyclopropylamino)azetidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O2Purity:Min. 95%Molecular weight:212.29 g/mol3-Cyclopropylpropanoic acid
CAS:<p>3-Cyclopropylpropanoic acid is a synthetic derivative of oxalyl chloride. It has been shown to inhibit the growth of viruses, notably influenza A virus and human immunodeficiency virus (HIV), in cell culture. 3-Cyclopropylpropanoic acid also inhibits the g1 phase of the cell cycle. In addition, it has been shown to inhibit skin cancer and cardiovascular diseases in humans.</p>Formula:C6H10O2Purity:95%NmrMolecular weight:114.14 g/mol4-Bromocrotonic acid - min 98%
CAS:<p>4-Bromocrotonic acid is a 3-mercaptopropionic acid (3-MPA) derivative. It inhibits the enzyme carnitine acyltransferase, which is involved in the uptake of fatty acids into mitochondria and their subsequent β-oxidation. This leads to an accumulation of fatty acids in the cytosol, which can inhibit insulin-stimulated glucose uptake and protein synthesis. 4-Bromocrotonic acid also inhibits glut1, an amp-activated protein kinase enzyme that plays a key role in cellular metabolism, leading to irreversible inhibition. 4-Bromocrotonic acid is used for analytical purposes as it is a good substrate for mitochondrial enzymes.</p>Formula:C4H5BrO2Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:164.99 g/molEthylene glycol monomethyl ether acetate
CAS:<p>Ethylene glycol monomethyl ether acetate (EMEA) is a solvent that is used for the extraction of organic compounds in the laboratory. It can be used to extract fatty acids from animal tissue or to isolate DNA from blood samples. EMEA is also used as a solvent in analytical methods such as gas chromatography and high-performance liquid chromatography. This compound is mainly used as an inorganic acid, but it can also be used as a nitrogen source for some chemical reactions. EMEA reacts with light exposure, which makes it a potent inducer of chemical reactions. The hydrolysis reaction of EMEA by hydrochloric acid yields glycol ethers and diethyl succinate.</p>Formula:C5H10O3Purity:Min. 95%Molecular weight:118.13 g/mol5-(1H-Indol-3-yl)-1H-pyrazole-3-carboxylic acid
CAS:<p>Please enquire for more information about 5-(1H-Indol-3-yl)-1H-pyrazole-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H9N3O2Purity:Min. 95%Molecular weight:227.22 g/mol1-(4-Methoxyphenyl)-3-phenyl-1H-pyrazole-5-carboxylic acid
CAS:Controlled Product<p>Please enquire for more information about 1-(4-Methoxyphenyl)-3-phenyl-1H-pyrazole-5-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H14N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:294.3 g/mol4-Amino-3-(trifluoromethoxy)benzoic acid
CAS:<p>Please enquire for more information about 4-Amino-3-(trifluoromethoxy)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H6F3NO3Purity:Min. 95%Molecular weight:221.13 g/molEthyl (ethoxymethylene) cyanoacetate
CAS:<p>Ethyl (Ethoxymethylene) cyanoacetate is a chemical compound that belongs to the family of aldehyde compounds. It is a colorless liquid at room temperature, with an odor similar to that of acetic acid. The compound has been used in the synthesis of epidermal growth factor and diazonium salts. It has also been used in the production of anti-cancer drugs such as malonic acid, which inhibits tumor growth by inhibiting protein synthesis. Ethyl (Ethoxymethylene) cyanoacetate reacts with quinoline derivatives to form carbon disulphide, which can be used as an antimicrobial agent and insecticide.</p>Formula:C8H11NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:169.18 g/mol(9b,11b)-Epoxy fluorometholone acetate
CAS:<p>Please enquire for more information about (9b,11b)-Epoxy fluorometholone acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30O5Purity:Min. 95%Molecular weight:398.49 g/molN-Hexylboronic acid
CAS:<p>N-Hexylboronic acid is an organometallic compound that has been used as a model system to study the catalytic mechanism of the Suzuki coupling reaction. It has also been shown to be a substrate film for use in the suzuki coupling reaction when combined with Raney nickel, which can be used to synthesize organic compounds. N-Hexylboronic acid has been shown to inhibit the activity of pancreatic lipase, but not cholesterol esterase or cholesterol ester hydrolase. The skeleton of this molecule is made up of six carbon atoms and one boron atom. Hydrogen chloride and aliphatic hydrocarbons are inhibitors of N-hexylboronic acid.</p>Formula:C6H15BO2Purity:Min. 95%Molecular weight:129.99 g/molThioacetic acid
CAS:<p>Thioacetic acid is a monoethyl ether of thioacetic acid. It is used in the synthesis of fatty acids and other organic compounds. Thioacetic acid can be used in the treatment of infectious diseases, such as malaria and cholera, by inhibiting the growth of pathogenic microorganisms. The reactive nature of thioacetic acid makes it ideal for wastewater treatment, where it reacts with ammonia to form ammonium sulfate, which can be easily removed from water.</p>Formula:C2H4OSPurity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:76.12 g/molS-(+)-α-Methoxy-α-(trifluoromethyl)phenylacetic acid chloride
CAS:<p>S-(+)-alpha-Methoxy-alpha-(trifluoromethyl)phenylacetic acid chloride is an optical, amide, and epoxidation derivatizing agent that is used to chiralify amines. It is a liquid at room temperature with a molecular weight of 123.87 g/mol. This chemical reacts with alcohols to form esters, which can be identified by their different retention times in chromatography. It also reacts with hydroxyl groups to form ethers and esters, as well as hydroxyls on other molecules such as amino acids, peptides, and proteins. S-(+)-alpha-Methoxy-alpha-(trifluoromethyl)phenylacetic acid chloride has been used for the synthesis of bisoprolol from metoprolol and triethylphosphite.</p>Formula:C10H8ClF3O2Purity:Min. 95%Molecular weight:252.62 g/mol4-[1-(2-Methoxyethyl)-1H-indol-3-yl]butanoic acid
CAS:Controlled Product<p>Please enquire for more information about 4-[1-(2-Methoxyethyl)-1H-indol-3-yl]butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19NO3Purity:Min. 95%Molecular weight:261.32 g/molDimethyl 1-[2-(1H-indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3,4-dicarboxylate
CAS:Controlled Product<p>Please enquire for more information about Dimethyl 1-[2-(1H-indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3,4-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H22N2O4Purity:Min. 95%Molecular weight:354.4 g/mol(R)-De(carboxymethoxy) cetirizine acetic acid hydrochloride
CAS:<p>Please enquire for more information about (R)-De(carboxymethoxy) cetirizine acetic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H22Cl2N2O2Purity:Min. 95%Molecular weight:381.3 g/molBoric acid, pinacol ester
CAS:<p>Boric acid, pinacol ester (BP) is a chemical compound that inhibits the 5-HT7 receptor. BP has been shown to be an inhibitor of growth factor and is used to treat autoimmune diseases. BP inhibits the formation of a copper complex with the BCR-ABL kinase, which is associated with chronic myeloid leukemia. It also inhibits epidermal growth factor and has been shown to have anti-inflammatory properties in eye disorders. BP has a chemical stability that is greater than other inhibitors of 5-HT7 receptors, due to its hydroxyl group and nitrogen atoms. BP can be synthesized using a Suzuki coupling reaction as well as an optical sensor for monitoring the reaction rate. It has been found to be effective in treating hyperproliferative disease such as cancerous tumors and fibrosis.</p>Formula:C6H13BO3Purity:Min. 95%Molecular weight:143.98 g/molIndole-3-acetyl-L-glutamic acid
CAS:<p>Indole-3-acetyl-L-glutamic acid is an endogenous substance that is found in plants. It is the conjugated form of indole-3-acetaldehyde and L-glutamic acid. Indole-3-acetylglutamic acid has shown to have antioxidant potential and can be used to regulate plant growth, as well as protect against environmental stresses. Indole-3-acetylglutamic acid also has a role in regulating the production of other hormones, such as ethylene and auxin, which are involved in plant growth regulation.</p>Formula:C15H16N2O5Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:304.3 g/molHydroxybisnorcholenic acid
CAS:Controlled Product<p>Hydroxybisnorcholenic acid is a sterol that is present in high concentrations in the skin and other tissues. It has been shown to have biological properties, such as meiosis, and to be involved in the regulation of ion transport. Hydroxybisnorcholenic acid is also one of the major components of the saponified product of cholesterol. The molecule is a target tissue for control levels of biochemical analysis and modulation by hormones. Hydroxybisnorcholenic acid can be converted into aminosterol, which then undergoes additional conversion to cholesterol.</p>Formula:C22H34O3Purity:Min. 95%Color and Shape:PowderMolecular weight:346.50 g/molL-(2S,3aS,7aS)-Octahydro-1H-indole-2-carboxylic acid benzyl ester tosylate salt
CAS:<p>Please enquire for more information about L-(2S,3aS,7aS)-Octahydro-1H-indole-2-carboxylic acid benzyl ester tosylate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H29NO5SPurity:Min. 95%Molecular weight:431.55 g/molThiocyanic acidpiperidine
CAS:Controlled Product<p>Thiocyanic acidpiperidine is a substrate for film hydroxide solution. It reacts with hydrochloric acid to form hydrogen chloride and thiocyanate ion. Thiocyanic acidpiperidine is a reactive compound that can be used as a radiation-sensitive reagent in the synthesis of β-unsaturated ketones. The reaction is carried out in an immiscible solvent such as dichloromethane or chloroform and sodium hydroxide solution. This efficient method has been shown to be useful for the preparation of β-unsaturated ketones.</p>Formula:C6H12N2SPurity:Min. 95%Molecular weight:144.24 g/mol2-Methyl-3-(2-methyl-1H-imidazol-1-yl)propanoic acid
CAS:Controlled Product<p>Please enquire for more information about 2-Methyl-3-(2-methyl-1H-imidazol-1-yl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12N2O2Purity:Min. 95%Molecular weight:168.19 g/mol21-Hydroxy-pregna-1,4,16-triene-3,11,20-trione 21-acetate
CAS:Controlled Product<p>Please enquire for more information about 21-Hydroxy-pregna-1,4,16-triene-3,11,20-trione 21-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H26O5Purity:Min. 95%Molecular weight:382.45 g/molDecanoic acid
CAS:<p>Decanoic acid is a saturated fatty acid that has been used as a pharmaceutical agent for the treatment of congestive heart failure. Decanoic acid is also used in the production of glycol ethers and as an intermediate in organic synthesis. The melting point of decanoic acid is between 30 and 35 degrees Celsius, which is lower than the melting points of caproic acid (40 degress) or lauric acid (45 degrees Celsius). Decanoic acid has been shown to reduce blood glucose levels in diabetic mice and rats and has also been shown to have antimicrobial activity against c. glabrata, S. aureus, and E. coli. Decanoic acid may be effective as an adjuvant therapy for melanoma by inducing apoptosis through mitochondrial membrane potential disruption.</p>Formula:C10H20O2Purity:Min. 95%Color and Shape:PowderMolecular weight:172.26 g/molDelmadinone acetate
CAS:Controlled Product<p>Delmadinone acetate is an oestrogenic amorphous drug that has been used in the treatment of prostatic hypertrophy, diabetic neuropathy and other conditions. It is a prodrug that is hydrolyzed to delmadinone, its active form, following oral administration. Delmadinone acetate has shown efficacy against a number of pharmacological agents, including fatty alcohols and pharmaceutical dosage form preparations. It binds to fatty acids and carbon sources in the body and is removed by dispersive solid-phase extraction. The effects of this drug are dose-dependent; it can be used for control experiments at low doses but has adverse effects at higher doses.</p>Formula:C23H27ClO4Purity:Min. 95%Color and Shape:PowderMolecular weight:402.91 g/mol4-[4-(3-Chlorophenyl)piperazin-1-yl]-4-oxobutanoic acid
CAS:Controlled Product<p>Please enquire for more information about 4-[4-(3-Chlorophenyl)piperazin-1-yl]-4-oxobutanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H17ClN2O3Purity:Min. 95%Molecular weight:296.75 g/molγ-Oxo-3-pyridinebutyric acid
CAS:<p>Gamma-oxo-3-pyridinebutyric acid (GOBA) is a non-protein amino acid that has been shown to be involved in the development of cancer. GOBA was found to be present in urine samples from patients with liver cancer and breast cancer, as well as in healthy individuals. GOBA is also present in rat liver microsomes and human liver, where it is converted into gamma-aminobutyric acid (GABA). This conversion may be due to GOBA's hydroxy group that can be oxidized by cytochrome P450 enzymes. The biological activity of GOBA appears to depend on its carboxyl group, which can form a complex with molybdenum. This complex inhibits the activity of the protein polymerase chain reaction, leading to a decrease in transcriptional regulation. In animal experiments, GOBA has been shown to inhibit tumor growth and induce cell cycle arrest by inhibiting the expression of cyclin D1 at the</p>Formula:C9H9NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:179.17 g/mol4-Mercaptocinnamic acid
CAS:<p>4-Mercaptocinnamic acid is a liquid crystal that belongs to the class of aromatic compounds. It is chiral and has a high melting point. 4-Mercaptocinnamic acid has been used in electronic devices, such as liquid crystal displays and ferroelectric liquid crystals, for its high boiling point and low viscosity. It can also be used as an additive for other chemicals or as a solvent for coatings. The acid group (COOH) in this compound makes it reactive with elements such as chlorine, fluorine, and bromine. It reacts with dicyclohexylcarbodiimide to form cinnamic acid derivatives and toluene to form trifluoromethylbenzenes. This chemical also has alkylthio groups (CH3S) and alkoxy groups (CH2O).</p>Formula:C9H8O2SPurity:Min. 95%Molecular weight:180.22 g/mol9,10-Anthracenediyl-bis(methylene)dimalonic acid
CAS:<p>9,10-Anthracenediyl-bis(methylene)dimalonic acid (ADMA) is a fluorescent probe that is used to measure the levels of ADMA in cells. This compound is able to bind to cell nuclei, which can then be detected by fluorescence microscopy. ADMA has been shown to be useful as a marker for cancer and other diseases such as diabetes or Alzheimer's disease. The detection sensitivity of ADMA can be increased by combining it with heparin, which binds strongly to this molecule and increases its solubility in water. The use of ADMA as an imaging agent has been reported in several clinical studies.</p>Formula:C22H18O8Purity:Min. 95%Color and Shape:PowderMolecular weight:410.37 g/mol6-Methoxypyridine-2-boronic acid
CAS:<p>6-Methoxypyridine-2-boronic acid is a boronate ligand that can be used to form coordination complexes with metals. It has been shown to interact with silver ions, which are the most effective ligands for enhancing the fluorescence of organic dyes. 6-Methoxypyridine-2-boronic acid is able to rigidify organic molecules by binding to their steric and electronic properties, making them more resistant to photodegradation. This property makes it an excellent candidate for the use in the development of fluorescent labels in analytical chemistry.</p>Formula:C6H8BNO3Purity:Min. 95%Molecular weight:152.94 g/molBoc-1-amino-1-cyclobutane carboxylic acid
CAS:<p>Boc-1-amino-1-cyclobutane carboxylic acid is a synthetic and potent agonist of the androgen receptor. It is an analog of apalutamide, which is a selective antagonist of the androgen receptor. Boc-1-amino-1-cyclobutane carboxylic acid has been shown to have high oral bioavailability, which makes it suitable for oral administration. Boc-1-amino-1-cyclobutane carboxylic acid has been shown to have increased functional activity in cancer cells, which may be due to its ability to inhibit the growth of tumor cells by binding to their androgen receptors. Boc-1-amino-1-cyclobutane carboxylic acid has also been found to have good affinity for the androgen receptor when tested on cultured cells.</p>Formula:C10H17NO4Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:215.25 g/molChelidonic acid monohydrate
CAS:<p>Chelidonic acid monohydrate is an organometallic compound that can be synthesized by reacting 4-hydroxybenzoic acid with an organometallic reagent. Chelidonic acid monohydrate has antihypertensive activity and is used in the treatment of viral infections. Chelidonic acid monohydrate has a hydroxy group on the skeleton, which is a molecule that contains two or more amino groups. It also has a carboxylic group and alkynyl group, which are both organic functional groups that contain at least one carbon atom bonded to a hydroxyl group. Chelidonic acid monohydrate is a metal complex with calixarenes as ligands, which are heterocycles that have six members in their ring system. Chelidonic acid monohydrate is also cisplatin-resistant and can be used for the treatment of cancers such as breast cancer and leukemia.</p>Purity:Min. 95%2-Ketobutyric acid
CAS:<p>2-Ketobutyric acid is a chemical compound that is an intermediate in the metabolism of amino acids. It can be synthesized from malic acid and glutamic acid by asymmetric synthesis. 2-Ketobutyric acid inhibits the production of ATP, leading to metabolic inhibition. Sprague-Dawley rats were used to prove this theory. 2-Ketobutyric acid has also been shown to inhibit insulin resistance and cell culture. Hydrogen bonds between 2-ketobutyric acid and the enzyme glutamate dehydrogenase are thought to be responsible for this effect on glucose uptake and conversion into energy.</p>Formula:C4H6O3Purity:Min. 95%Molecular weight:102.09 g/mol(1R,2R)-Boc-aminocyclopentane carboxylic acid
CAS:<p>(1R,2R)-Boc-aminocyclopentane carboxylic acid (BCPC) is a high quality, reagent, and useful intermediate. It is a versatile building block that can be used as a speciality chemical or research chemical. BCPC has been shown to react with amines to form ureas, with nitriles to form oxazolidines, and with epoxides to form aziridinones.</p>Formula:C11H19NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:229.27 g/mol5-Methyl-4,5,6,7-tetrahydrothiazolo[5,4-c]pyridine-2-carboxylic acid hydrochloride
CAS:<p>Intermediate in the synthesis of edoxaban</p>Formula:C8H10N2O2S·HClPurity:Min. 95%Molecular weight:234.7 g/mol4-Amino-3,5-difluorobenzoic Acid
CAS:<p>4-Amino-3,5-difluorobenzoic Acid is a chemical compound that is used to manufacture dyes and pharmaceuticals. It is prepared by the reaction of dimethyl formamide with bromobenzoate and hydrobromic acid. The reaction product is decompressed to remove the toxic hydrogen cyanide gas and then reacted with sodium borohydride in liquid ammonia. This process yields 4-amino-3,5-difluorobenzoic acid which can be purified by recrystallization from water or chloroform.</p>Formula:C7H5F2NO2Purity:Min. 95%Molecular weight:173.12 g/mol1-(4-Fluorophenyl)pyrazole-4-boronic acid
CAS:<p>Please enquire for more information about 1-(4-Fluorophenyl)pyrazole-4-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H8BFN2O2Purity:Min. 95%Molecular weight:205.98 g/molBoc-(3S)-1,2,3,4-tetrahydroisoquinoline-7-hydroxy-3-carboxylic acid
CAS:<p>Boc-(3S)-1,2,3,4-tetrahydroisoquinoline-7-hydroxy-3-carboxylic acid is a synthetic opioid that is chemically related to morphine. It binds to the δ opioid receptor and has a clinical development in the treatment of pain. The drug has been shown to inhibit the binding of gtpγs, which leads to the suppression of neuronal activity. Boc-(3S)-1,2,3,4-tetrahydroisoquinoline-7-hydroxy-3-carboxylic acid also has low molecular weight and low toxicity.</p>Formula:C15H19NO5Purity:Min. 95%Color and Shape:PowderMolecular weight:293.32 g/mol(R)-(-)-a-[[(4-Ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]benzeneacetic Acid
CAS:<p>(R)-(-)-a-[[(4-Ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]benzeneacetic Acid is an inhibitor of the enzyme histamine N-methyltransferase (HNMT), which is responsible for the synthesis of histamine. The inhibition of HNMT leads to a decrease in histamine levels and therefore has been used as a treatment for chronic prostatitis, lacrimal gland, and energy efficiency. Histamine N-methyltransferase also participates in the regulation of apoptosis by methylating proapoptotic proteins like Bax, so inhibition can lead to an increase in apoptosis. This chemical is also able to bind with chloride ions and form diphenyl ethers through a reaction solution, which are known to have anticancer properties.</p>Formula:C15H17N3O5Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:319.31 g/molEthyl 2-chloro-2,2-difluoroacetate
CAS:<p>Ethyl 2-chloro-2,2-difluoroacetate is an organic compound that is used in the synthesis of benzofuran derivatives. It reacts with chlorine to generate a reactive intermediate and then undergoes a nucleophilic substitution reaction to produce the desired compound. The kinetic studies of this reaction have been conducted using isolated yields of the reactants. The active methylene group can undergo a variety of reactions because it has a reactive chlorine atom attached to it. This active substance inhibits the NS5B polymerase, which is responsible for converting RNA into DNA. Ethyl 2-chloro-2,2-difluoroacetate may be used as a potential treatment for inflammatory diseases such as asthma and arthritis because it prevents acetylcholine from binding to its receptor α.</p>Formula:C4H5ClF2O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:158.53 g/molAntimony(III) acetate
CAS:<p>Antimony(III) acetate is a catalyst that is used in glycol esters and other organic reactions. It has been shown to have an activity index of 1.2-1.5, which means it can be used in place of antimony trioxide for many purposes. The chemical species is the film-forming polymer with particle size between 0.2-0.4 microns and a hydroxide solution of pH 3-6. Antimony(III) acetate can be used in the production of polymers with high viscosity, such as polyester, polyurethane, or polyethylene terephthalate (PET). This catalyst also reacts with hydrochloric acid or trifluoroacetic acid to produce a polymer film that is used in various applications such as coatings and adhesives.br>br> The following are some common uses for this product:</p>Formula:C6H12O6•SbPurity:Min. 95%Color and Shape:PowderMolecular weight:301.92 g/mol(R)-Tetrahydrofuran-3-carboxylic acid
CAS:<p>Please enquire for more information about (R)-Tetrahydrofuran-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H8O3Purity:Min. 95%Molecular weight:116.12 g/moltert-Butyl 4,7-diazaspiro[2.5]octane-7-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 4,7-diazaspiro[2.5]octane-7-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Methyl chlorooxoacetate
CAS:<p>Methyl chlorooxoacetate is an oxalyl ester that has been used for the synthesis of glycol esters. Methyl chlorooxoacetate has been shown to have a high solubility in water and organic solvents, which is desirable for industrial processes. This molecule also has the ability to be acylated with various organic groups and can act as a process-optimization agent in plant physiology. Methyl chlorooxoacetate binds as a receptor to growth factors and HIV infection, which leads to amide formation and carbonyl group formation.</p>Formula:C3H3ClO3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:122.51 g/molEthyl 2-(2-Amino-4-thiazolyl)-2-(hydroxyimino)acetate
CAS:<p>Ethyl 2-(2-amino-4-thiazolyl)-2-(hydroxyimino)acetate is a phosphomolybdate antibiotic that is used in the treatment of respiratory tract infections. It binds to the bacterial enzyme, phosphomolybdate oxidase, and inhibits the formation of acid in the body. The reaction solution is recycled and activated with an acid catalyst to increase the yield of acetonitrile. The ion-pair formed by ethyl 2-(2-amino-4-thiazolyl)-2-(hydroxyimino)acetate and sodium carbonate is nucleophilic and reacts with nitrous to produce acetonitrile as a side product.</p>Formula:C7H9N3O3SPurity:Min. 95%Molecular weight:215.23 g/molIsobutyl acetate
CAS:<p>Isobutyl acetate is an organic compound that is used in the synthesis of other chemicals and as a solvent. Isobutyl acetate is synthesized by reacting ethyl decanoate with water vapor, a reaction that requires constant pressure. The product of this reaction has a fatty acid chain with a hydroxyl group on the third carbon atom. This hydroxyl group reacts with caproic acid to form an ester. Isobutyl acetate is acidic, which can be seen in its biochemical properties. It also has an acidic complex, which consists of the conjugated carboxylic acid and the hydroxyl group. The methyl ethyl group is connected to the second carbon atom from the alcohol group. Wild-type strains have been shown to be more reactive than mutants, so Isobutyl acetate is reactive when it interacts with certain substances.</p>Formula:C6H12O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:116.16 g/molBoc-tranexamic acid
CAS:<p>Tranexamic acid is a non-protein amino acid that is used to reduce the risk of blood loss in surgical procedures. It is an inhibitor of plasmin, which is an enzyme that breaks down clots and fibrin. Tranexamic acid binds to the active site of plasmin and blocks its activity, preventing the breakdown of fibrin clots. Tranexamic acid has been shown to be selective for plasmin, as other enzymes such as urokinase are not blocked by this drug. The picolyl group on tranexamic acid interacts with the benzyl group on plasmin and this interaction may be responsible for the selectivity of tranexamic acid for plasmin over other enzymes.</p>Purity:Min. 95%Lys-Bradykinin acetate salt
CAS:<p>Lys-Bradykinin is a peptide that is a member of the group of kinins. It has been shown to be effective at inhibiting the activity of kallikrein, which is an enzyme that converts kininogen to bradykinin. This inhibition lowers the levels of bradykinin in the blood and may be used as a diagnostic tool for identifying diseases such as congestive heart failure, pulmonary edema, and acute renal failure. Lys-Bradykinin can also be used as a model system for studying kinins and their biological effects on various systems. For example, it has been shown to have natriuretic properties in humans by increasing levels of erythropoietin and ANP.</p>Formula:C56H85N17O12Purity:Min. 95%Molecular weight:1,188.38 g/molMethyl 6-chloro-2-pyridinecarboxylate
CAS:<p>Methyl 6-chloro-2-pyridinecarboxylate is a reactive, organic compound that belongs to the class of monomers. It is a white crystalline solid with a melting point of approximately 130 degrees Celsius. This chemical can be synthesized by reacting 2-chlorobenzothiazole with sodium carbonate in water at temperatures between 100 and 140 degrees Celsius. The reaction yields methyl 6-chloro-2-pyridinecarboxylate as well as chloride and picolinic acid as side products. This compound has been shown to have neurotoxic effects when administered to rats at high doses.</p>Formula:C7H6ClNO2Purity:Min. 95%Molecular weight:171.58 g/mol(1S,3S)-Methyl 3-aminocyclobutane carboxylate hydrochloride
CAS:<p>Please enquire for more information about (1S,3S)-Methyl 3-aminocyclobutane carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12ClNO2Purity:Min. 95%Molecular weight:165.62 g/molGlycodeoxycholic Acid monohydrate
CAS:Controlled Product<p>Glycodeoxycholic acid is a bile acid that has been shown to inhibit bacterial translocation. It is used as an adjuvant therapy in the treatment of primary sclerosing cholangitis and other inflammatory conditions of the liver, such as pancreatitis, and it has also been studied for its effects on iron homeostasis. Glycodeoxycholic acid is produced by the human body and can be found in the serum. The biosynthesis of glycodeoxycholic acid is dependent on microbial metabolism, which may be inhibited by nonsteroidal anti-inflammatory drugs. This compound has been shown to inhibit cell signaling pathways and increase sodium ion uptake into cells through inhibition of sodium-potassium ATPase activity.</p>Purity:Min. 95%Ethylcyclobutanecarboxylate
CAS:<p>Ethylcyclobutanecarboxylate is an organic compound that is used as a drug for the treatment of cancer. It has been shown to inhibit cholesterol ester transfer and has been used in the treatment of pancreatitis, autoimmune diseases, dyslipoproteinemia, and inflammatory diseases. This drug has been shown to reduce insulin resistance and can be used as a treatment for diabetes-associated complications. Ethylcyclobutanecarboxylate is also metabolized into a pharmacologically active form by cb2 receptor. The biological samples that have been studied include plasma and urine; however, it can also be detected in other types of tissue such as brain, stomach, and kidney.</p>Formula:C7H12O2Purity:Min. 95%Molecular weight:128.17 g/molMethyl 5-oxopyrrolidine-3-carboxylate
CAS:<p>Methyl 5-oxopyrrolidine-3-carboxylate is a nonsteroidal anti-inflammatory drug that reduces the production of pro-inflammatory cytokines. It binds to COX-2 and prevents the production of prostaglandins, which are involved in the inflammatory process. Methyl 5-oxopyrrolidine-3-carboxylate has been shown to inhibit mouse hippocampal cells and human THP1 cells, which are important in inflammation. This drug also interacts with other proteins and can be localized to mitochondria membrane potentials. Methyl 5-oxopyrrolidine-3-carboxylate has the potential for use as an anti-inflammatory agent for cellular localization in mitochondria membrane potentials.</p>Formula:C6H9NO3Purity:Min. 95%Molecular weight:143.14 g/mol1H-Benzo[d]imidazol-6-ylboronic acid
CAS:<p>Please enquire for more information about 1H-Benzo[d]imidazol-6-ylboronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H7BN2O2Purity:Min. 95%Molecular weight:161.95 g/molCacodylic acid
CAS:<p>Cacodylic acid is a white to brown crystalline powder that is soluble in water. It has been used as an analytical reagent, polymerase chain reaction (PCR) inhibitor, and skin cancer treatment. Cacodylic acid inhibits the activity of the bacterial enzyme activities in humans and other mammals. The mechanism of action of cacodylic acid is not completely understood but it appears that it binds to inorganic iron and blocks its availability for use by bacterial enzymes such as dihydropteroate synthase, which is required for DNA synthesis. This leads to cell death. Cacodylic acid has also been shown to inhibit the growth of human HL-60 cells in vitro, suggesting that it may have carcinogenic potential.</p>Formula:C2H7AsO2Purity:Min. 95%Color and Shape:PowderMolecular weight:138 g/mol6-Hydroxyhexanoic acid
CAS:<p>6-Hydroxyhexanoic acid is an organic acid that is produced by the bacterial metabolism of caproic acid. It can be used to produce inorganic acids such as sulfuric acid, hydrochloric acid and nitric acid. 6-Hydroxyhexanoic acid has been shown to inhibit the growth of bacteria at low concentrations. This inhibition may be due to its ability to form an adduct with DNA, which inhibits DNA replication and transcription. 6-Hydroxyhexanoic acid also inhibits protein synthesis by binding to the 30S ribosomal subunit, inhibiting translocation and peptide bond formation. 6-hydroxyhexanoic acid also causes genotoxic effects in vitro and structural analysis has revealed a hydroxyl group on the methyl group on one side of the molecule.</p>Formula:C6H12O3Purity:(Silylated Gc) Min. 94%Color and Shape:Colorless PowderMolecular weight:132.16 g/mol5-Hydroxyisophthalic acid
CAS:<p>5-Hydroxyisophthalic acid is a dicarboxylic acid that has one hydroxyl group. It is an odorless, colorless solid that is soluble in water and ether. 5-Hydroxyisophthalic acid has been found to be a good thermal expansion agent for polypropylene and polyethylene, due to its intermolecular hydrogen bonding ability. This compound also has the ability to form diphenyl ethers with carboxylates, which are used as stabilizers in PVC. 5-Hydoxyisophthalic acid is not very reactive and can be used as a neutral pH stabilizer in alkaline solutions. Hydrogen bonds between 5-hydroxyisophthalic acid molecules allow it to form complexes with sodium salts, such as sodium thiosulfate or sodium nitrite. The coordination geometry of the molecule also allows for hydrogen bonding interactions with other neutral molecules, such as p-hydroxybenzoic acid</p>Formula:C8H6O5Purity:Min. 95%Molecular weight:182.13 g/molDL-Aspartic acid dimethyl ester hydrochloride
CAS:<p>Please enquire for more information about DL-Aspartic acid dimethyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H11NO4·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:197.62 g/mol1-(tert-Butoxycarbonyl)-4-methylpiperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-(tert-Butoxycarbonyl)-4-methylpiperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO4Purity:Min. 95%Molecular weight:243.3 g/molEthyl 4-chloroacetoacetate
CAS:<p>Ethyl 4-chloroacetoacetate is a chiral organic compound that is synthesized by the asymmetric synthesis of ethyl chloroacetate. This reaction is performed in an organic solution, using sodium salts as the solvent. The expression plasmid and logarithmic growth phase are needed for the enzyme catalysis and stereoselective reactions. The reaction solution is recombined with hydrochloric acid and chiral compound to produce high yields of ethyl 4-chloroacetoacetate.</p>Formula:C6H9ClO3Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:164.59 g/mol3-{[(3,4-Dichlorophenyl)amino]carbonyl}bicyclo[2.2.1]hept-5-ene-2-carboxylic acid
CAS:<p>Please enquire for more information about 3-{[(3,4-Dichlorophenyl)amino]carbonyl}bicyclo[2.2.1]hept-5-ene-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H13Cl2NO3Purity:Min. 95%Molecular weight:326.17 g/molEthyl mercaptoacetate
CAS:<p>Ethyl mercaptoacetate (EM) is a metabolite of ethyl diazoacetate (EDA) that reacts with nucleophilic groups such as hydroxyl, amino, and thiol groups. It binds to the receptor binding sites of an enzyme that is involved in inflammatory diseases. EM has been shown to have inhibitory effects on the activity of this enzyme and may be used for the treatment of inflammatory diseases. EM also inhibits the production of epoxides by acting as an alkylating agent on protein cysteine residues. This reaction leads to changes in the nmr spectra which can be used for identification purposes.</p>Formula:C4H8O2SPurity:Min. 95%Molecular weight:120.17 g/mol3-Cyanoethylbenzoic acid
CAS:<p>3-Cyanoethylbenzoic acid is an anthropogenic compound that is produced by the Friedel-Crafts reaction between benzoyl chloride and acrylonitrile in the presence of a base. 3-Cyanoethylbenzoic acid is used as a solvent for chromatographic methods, such as gradient elution, ion exchange, and reversed phase. 3-Cyanoethylbenzoic acid has been used to determine the optical purity of benzoate salts and amides. This compound can be taken orally in solid oral dosage form or enterically in liquid oral dosage form. 3-Cyanoethylbenzoic acid interacts with other drugs that are metabolized by CYP3A4, such as erythromycin, to produce an active metabolite (N-desmethyldesipramide).</p>Formula:C10H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:175.18 g/mol4-Diazobenzenesulfonic Acid
CAS:<p>Applications 4-Diazobenzenesulfonic acid (cas# 305-80-6) is a useful research chemical.<br></p>Formula:C6H4N2O3SMolecular weight:184.17Linolenic acid - 98%
CAS:<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>Formula:C18H30O2Purity:Min. 95%Color and Shape:PowderMolecular weight:278.43 g/mol(D-Ser6,Azagly10)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Ser6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H76N18O14Purity:Min. 95%Molecular weight:1,213.3 g/mol(Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H83N13O14Purity:Min. 95%Molecular weight:1,042.23 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%pTH (1-84) (dog) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C414H672N122O128S2Purity:Min. 95%Molecular weight:9,470.64 g/mol(Phe7)-Dynorphin A (1-7) acetate salt
CAS:<p>Dynorphin A (1-7) acetate salt is a potent analgesic that has been used to treat pain. It has been shown to be effective in the treatment of laryngitis and other laryngological disorders. Dynorphin A (1-7) acetate salt is a prodrug that is hydrolyzed in vivo to dynorphin A (1-7) by esterases, which can then bind to opioid receptors. This drug has been validated for use as a diagnostic agent in coatings and in algorithms for analysis of polygonal images from laryngoscopy. The dehydrogenase enzymes are added to the coating or algorithm for diagnosis of the presence of vocal cord pathology. Dynorphin A (1-7) acetate salt also shows promising results for analyzing waveforms from laryngoscopy, with the goal of classifying vocal cord pathology.</p>Formula:C43H58N10O9Purity:Min. 95%Molecular weight:858.98 g/mol(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/molGalanin Message Associated Peptide (1-41) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C206H326N56O64SPurity:Min. 95%Molecular weight:4,643.2 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C134H207N41O36SPurity:Min. 95%Molecular weight:3,000.4 g/mol(2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate
CAS:<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O4Purity:Min. 95%Molecular weight:244.29 g/molGLP-2 (1-33) (human) ammonium acetate salt
CAS:<p>Please enquire for more information about GLP-2 (1-33) (human) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H254N44O55SPurity:Min. 95%Molecular weight:3,766.11 g/molLQEQ-19 (human) trifluoroacetate salt
<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C106H170N30O34Purity:Min. 95%Molecular weight:2,408.67 g/molMyeloblastin (142-150) (human, mouse) trifluoroacetate salt
CAS:<p>Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr-Val-OH trifluoroacetate salt is an antigen that belongs to the class of serine proteinases. It is a soluble recombinant human proteinase that has been shown to have a tumor cell lysis activity in vitro and in vivo. Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr Val is also a leukocyte antigen and can be used for the development of cancer vaccines.</p>Formula:C45H79N11O15Purity:Min. 95%Molecular weight:1,014.17 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/molβ-MSH (human) trifluoroacetate salt
CAS:<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>Formula:C118H174N34O35SPurity:Min. 95%Molecular weight:2,660.92 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molH-Gly-Gly-Arg-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/mol(Phe1,Ser2)-TRAP-6 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molGalnon trifluoroacetate salt
CAS:<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>Formula:C40H46N4O6Purity:Min. 95%Molecular weight:678.82 g/molBradykinin (1-7) acetate salt
CAS:<p>Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt is a synthetic peptide that was designed to simulate the activity of bradykinin. It has been shown to be effective in the treatment of angina pectoris and as an analgesic. This peptide can also be used in the analysis of carboxypeptidase activity, by adding it to homogenates and measuring the reaction products. Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt can also be used to analyze salivary glands, activated erythrocytes, and silicon wafers. It is particularly useful for examining morphology and nanowires.</p>Formula:C35H52N10O9Purity:Min. 95%Molecular weight:756.85 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molFurin Inhibitor II trifluoroacetate salt
CAS:<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/mol3-Cyanopropanoic acid
CAS:<p>3-Cyanopropanoic acid is a reactive compound that forms a complex with palladium. It is produced by the reaction of acrylonitrile and chloride in the presence of a base such as sodium hydroxide. The reaction mechanism is shown below:</p>Formula:C4H5NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:99.09 g/molGRF (1-29) amide (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/molVIP (6-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP (6-28) (human, mouse, rat) trifluoroacetate salt H-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys -Lys-Tyr-Leu is a prophylactic agent that is used to prevent the development of intestinal peptide induced myocardial fibrosis. It has been shown to reduce the incidence and severity of cardiovascular diseases. VIP (6/28) has a vasoactive effect on the intestines and may also have an effect on the cardiovascular system.</p>Formula:C126H207N37O34SPurity:Min. 95%Molecular weight:2,816.29 g/mol

