
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
17-Hydroxy-19-nor-17alpha-pregna-4,6-dien-20-yn-3-one acetate
CAS:<p>Please enquire for more information about 17-Hydroxy-19-nor-17alpha-pregna-4,6-dien-20-yn-3-one acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H26O3Purity:Min. 95%Color and Shape:Off-white to pale yellowsolid.Molecular weight:338.44 g/molBromoacetic acid
CAS:<p>Bromoacetic acid is a brominated carboxylic acid that has been shown to bind to response elements and inhibit the synthesis of proteins. It has been shown to inhibit the growth of bacteria in human serum at concentrations of 1-5 mM. Bromoacetic acid also binds to metals, such as copper and zinc, and inhibits their activity. This compound has also been shown to have anti-inflammatory properties in experimental models. Bromoacetic acid is not toxic in rats, but it may cause myocardial infarction in humans.</p>Formula:C2H3BrO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:138.95 g/molH-Gly-Phe-Gly-aldehyde semicarbazone acetate salt
CAS:<p>Please enquire for more information about H-Gly-Phe-Gly-aldehyde semicarbazone acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N6O3Purity:Min. 95%Molecular weight:320.35 g/molHydantoin-5-acetic acid
CAS:<p>Hydantoin-5-acetic acid is a molecule that has been studied for its potential use in the stabilization of polymers and plastics. It has shown antibacterial activity against certain bacterial strains including Escherichia coli and Staphylococcus aureus. The molecule has the ability to coordinate with metal ions such as copper, zinc, and iron. The protonation state of the molecule is dependent on the pH of the environment. Hydantoin-5-acetic acid can exist in two tautomeric forms: hydantoin or 5-hydantoin. Hydantoin-5-acetic acid can be used to determine the concentration of hydrogen in proteins through chromatographic methods. This molecule also has Langmuir adsorption isotherm properties, which give it potential for use in supramolecular structures.</p>Formula:C5H6N2O4Purity:Min. 95%Molecular weight:158.11 g/mol3-Methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-4-carboxylic acid
CAS:<p>Please enquire for more information about 3-Methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H8N2O3Purity:Min. 95%Molecular weight:192.17 g/molEthyl 2-amino-thiazole-4-carboxylate
CAS:<p>Ethyl 2-amino-thiazole-4-carboxylate (ETAC) is an inhibitor of protein synthesis. It binds to the dna and inhibits transcription, leading to cell death by inhibiting the production of proteins vital for cell division. ETAC has been shown to have cytotoxic activity against cancer cells and hemolytic activity. It also has a strong fluorescence probe property, which may be used in cancer diagnosis. ETAC can inhibit protein synthesis in cells that are resistant to other antimicrobial agents and platinum-based chemotherapy, making it a potential treatment for these infections. The pharmacokinetic properties of ETAC are not well studied but it is excreted through urine, suggesting that it is hydrophilic and may be metabolized with glucuronidation or sulfation. The molecular modeling study suggests that the hydrogen bond between ETAC and the dna phosphate group may explain its inhibitory effects on DNA synthesis.</p>Formula:C6H8N2O2SPurity:Min. 99.0 Area-%Molecular weight:172.21 g/mol3-(4-Chlorophenyl)-1-phenyl-1H-pyrazole-5-carboxylic acid
CAS:Controlled Product<p>Please enquire for more information about 3-(4-Chlorophenyl)-1-phenyl-1H-pyrazole-5-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H11ClN2O2Purity:Min. 95%Molecular weight:298.72 g/mol3-Cyanopropionic acid methyl ester
CAS:<p>3-Cyanopropionic acid methyl ester is a compound that belongs to the class of aliphatic carboxylic acids. It is an intermediate in the production of adiponitrile and acrylonitrile. This compound is used as a feedstock for the manufacture of vinylene, which can be used to produce c1-6 alkyl. 3-Cyanopropionic acid methyl ester can be produced from propylene and hydrogen cyanide in a high salt, activated reaction system. It has been shown that this compound may have metabolic disorders due to its ability to inhibit fatty acid oxidation and increase viscosity. 3-Cyanopropionic acid methyl ester is a colorless liquid at room temperature with a boiling point of 154°C and a molecular weight of 98.14 g/mol.</p>Formula:C5H7NO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:113.11 g/mol[2-(4-Chlorophenyl)-1,3-thiazol-4-yl]acetic acid
CAS:<p>[2-(4-Chlorophenyl)-1,3-thiazol-4-yl]acetic acid is a potent antimicrobial agent that inhibits the growth of bacteria by binding to the 50S ribosomal subunit. It has shown antiinflammatory properties in animal models of bowel disease, skin cancer, and autoimmune diseases. This drug has also been shown to have no observable toxicity in humans at doses up to 5000 mg/day for 28 days. The drug binds to a number of enzymes including reactive oxygen species (ROS) scavengers and metabolic enzymes. There are no known drug interactions with this drug and it can be used safely with other nonsteroidal antiinflammatory drugs (NSAIDs).</p>Formula:C11H8ClNO2SPurity:Min. 95%Molecular weight:253.71 g/molL-Menthyl 2,2-dihydroxyacetate
CAS:<p>L-Menthyl 2,2-dihydroxyacetate is a synthetic compound that belongs to the group of salicylic acid derivatives. It is an intermediate in the synthesis of other compounds and can be recycled. L-Menthyl 2,2-dihydroxyacetate reacts with primary amines to form iminoacetic esters and glyoxylates by acidic hydrolysis. The reaction time depends on the type of amine and the acidity of the solution. This compound has been used as a reagent to synthesize maleic anhydride from maleic acid. L-Menthyl 2,2-dihydroxyacetate is also used in methodologies for oxidizing aromatic compounds to produce benzoic acids or phenols.</p>Formula:C12H22O4Purity:Min. 95%Color and Shape:PowderMolecular weight:230.3 g/mol[1-(2-Methoxyethyl)-1H-indol-3-yl]acetic acid
CAS:Controlled Product<p>Please enquire for more information about [1-(2-Methoxyethyl)-1H-indol-3-yl]acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H15NO3Purity:Min. 95%Molecular weight:233.26 g/molFluorometholone acetate
CAS:Controlled Product<p>Fluorometholone acetate is a fluorinated corticosteroid that is used in ophthalmology to treat eye disorders. It has been shown to reduce intraocular pressure in patients with glaucoma and other eye diseases. Fluorometholone acetate inhibits the activity of the glucocorticoid receptor, which prevents it from binding to DNA and altering gene expression. This leads to a decrease in inflammatory responses by decreasing the production of cytokines and chemokines that are involved in inflammation. Fluorometholone acetate also binds to other receptors, such as the mineralocorticoid receptor, which may lead to its use as a potential biomarker for infectious diseases.</p>Formula:C24H31FO5Purity:Min. 95%Molecular weight:418.5 g/mol2-Methyl-3-(4-methyl-1H-pyrazol-1-yl)propanoic acid
CAS:Controlled Product<p>Please enquire for more information about 2-Methyl-3-(4-methyl-1H-pyrazol-1-yl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12N2O2Purity:Min. 95%Molecular weight:168.19 g/mol(-)-trans-1,2-Cyclohexanedicarboxylic Anhydride
CAS:Controlled Product<p>(-)-trans-1,2-Cyclohexanedicarboxylic Anhydride is a macrocyclic molecule that can be used to synthesize glutaric anhydride. This compound is an analogue of the succinic anhydride and 1,2-cyclohexanedicarboxylic anhydride. (-)-trans-1,2-Cyclohexanedicarboxylic Anhydride has been shown to catalyze the hydrogenation of epoxides. It also has been shown to be a potential precursor for the synthesis of pyrrolizidine alkaloids.</p>Formula:C8H10O3Purity:Min. 95%Molecular weight:154.16 g/mol4-Chloro-3,5-difluorobenzoic acid
CAS:<p>Please enquire for more information about 4-Chloro-3,5-difluorobenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H3ClF2O2Purity:Min. 95%Molecular weight:192.55 g/molTauroursodeoxycholic acid, sodium salt
CAS:<p>Tauroursodeoxycholic acid, sodium salt is a taurine-conjugated bile acid derivative, which is synthesized in the liver from ursodeoxycholic acid. It functions through its role in stabilizing the mitochondria and inhibiting apoptosis by modulating the unfolded protein response. This molecular action involves reducing endoplasmic reticulum stress, thereby providing cytoprotective effects in various cellular environments.</p>Formula:C26H44NNaO6SPurity:Min. 95%Molecular weight:521.69 g/mol1,2,3,4-Tetrahydro-1-naphthoic acid
CAS:<p>Tetrahydro-1-naphthoic acid is a toxic chemical that is used in the synthesis of various organic compounds. It is an organic acid that has a pungent odor and can cause irritation of the nose and throat. When heated, it evolves toxic fumes of hydrogen chloride gas and phosgene. Tetrahydro-1-naphthoic acid reacts with metal hydroxides to form metal tetrahydro-1-naphthoates, which have useful properties as catalysts in organic reactions. Tetrahydro-1-naphthoic acid has been used as a growth regulator in plants and animals. It binds to DNA at the C–H site, preventing protein synthesis and cell division by inhibiting RNA synthesis.</p>Formula:C11H12O2Purity:Min. 95%Molecular weight:176.21 g/mol[3-(Trifluoromethyl)-4,5,6,7-tetrahydro-1H-indazol-1-yl]acetic acid
CAS:<p>Please enquire for more information about [3-(Trifluoromethyl)-4,5,6,7-tetrahydro-1H-indazol-1-yl]acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H11F3N2O2Purity:Min. 95%Molecular weight:248.2 g/molBetamethasone 21-acetate
CAS:<p>Betamethasone 21-acetate is a potent corticosteroid that is effective in the treatment of inflammatory conditions, such as asthma and arthritis. It also helps to reduce the symptoms of inflammatory skin diseases, including atopic dermatitis, contact dermatitis, and psoriasis. Betamethasone 21-acetate is used to treat perinatal complications such as preterm labor and neonatal respiratory distress syndrome. This drug has been shown to have a low cardiac effect when administered at a low dose (1 mg/kg). The stability of betamethasone 21-acetate in blood samples is increased by adding benzalkonium chloride or trifluoroacetic acid. Betamethasone 21-acetate has been shown to be absorbed rapidly from the gastrointestinal tract and distributed widely throughout the body. It binds to plasma proteins and has a short elimination half-life of 1.5 hours.</p>Formula:C24H31FO6Purity:Min. 95%Color and Shape:PowderMolecular weight:434.5 g/molN-α-Trityl-Nβ-Fmoc-L-2,3-diaminopropionic acid
CAS:<p>Please enquire for more information about N-alpha-Trityl-Nbeta-Fmoc-L-2,3-diaminopropionic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H32N2O4Purity:Min. 95%Molecular weight:568.66 g/mol3,6-Dichlorobenzo[b]thiophene-2-carboxylic acid
CAS:<p>3,6-Dichlorobenzo[b]thiophene-2-carboxylic acid is an extracellular metabolite that is involved in the metabolism of muscle. It is produced as a byproduct of the reaction catalyzed by dehydrogenase, which converts 3,6-dichlorobenzo[b]thiophene to 2-carboxybenzothiophene. This compound has been shown to inhibit the enzyme histidine carboxylate synthetase, which is involved in branched-chain amino acid synthesis. The enzyme can be inhibited by either a wild type or an analog of 3,6-dichlorobenzo[b]thiophene-2-carboxylic acid.</p>Formula:C9H4Cl2O2SPurity:Min. 95%Molecular weight:247.1 g/mol5-(Aminomethyl)-2-furoic acid hydrochloride
CAS:<p>5-(Aminomethyl)-2-furoic acid hydrochloride is a molecule that belongs to the group of carboxylates. It has a molecular weight of 191.2 g/mol and a chemical formula of CHNO. The structure of 5-(aminomethyl)-2-furoic acid hydrochloride is similar to that of hexamethylenetetramine, a common organic compound with the formula (CH)N(H)CH. 5-(Aminomethyl)-2-furoic acid hydrochloride can be used as an acceptor in hydrogen chloride gas generation reactions, which are used in the synthesis of some pharmaceutical drugs and other organic compounds. The molecule also has potential use in telomerase research because it is structurally similar to natural telomeres. In addition, this molecule has been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis.</p>Formula:C6H7NO3Purity:Min. 95%Molecular weight:141.12 g/mol3,3-Difluoro-1-methylcyclobutanecarboxylic acid
CAS:<p>Please enquire for more information about 3,3-Difluoro-1-methylcyclobutanecarboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H8F2O2Purity:Min. 95%Molecular weight:150.12 g/molL-Azetidine-2-carboxylic acid
CAS:<p>L-Azetidine-2-carboxylic acid is a natural product that has been shown to have anticancer effects. It has been shown to induce apoptosis in cancer cells by binding to response elements on the DNA, which causes DNA damage and cell death. L-Azetidine-2-carboxylic acid also inhibits protein synthesis by interfering with the uptake of amino acids, which are essential for protein production. This compound is not toxic to healthy cells because it cannot cross the lipid bilayer of the cell membrane. L-Azetidine-2-carboxylic acid also induces autophagy in cancer cells, causing them to destroy their own cellular components. There is evidence that this compound may be effective for other diseases such as diabetes and neurodegenerative disorders due to its ability to regulate intracellular calcium levels and its cytosolic function as a substrate molecule.</p>Formula:C4H7NO2Purity:Min. 95%Color and Shape:White To Light (Or Pale) Yellow SolidMolecular weight:101.1 g/molRibonucleic acid free acid
CAS:<p>Ribonucleic acid free acid (ribo-FAA) is a derivative of the immunosuppressive drug rapamycin. It is an immunosuppressant that inhibits the immune system by binding to a protein called FKBP12, which is involved in the activation of T cells and other immune system cells. Ribo-FAA has been shown to be effective in treating HIV patients undergoing active antiretroviral therapy, as well as for treatment of other infectious diseases such as tuberculosis or leishmaniasis. Ribo-FAA binds to FKBP12 and prevents it from activating T cells or other immune system cells, which leads to suppression of the immune response.</p>Purity:Min. 95%Color and Shape:Yellow PowderMethyl 1,5-diphenyl-1H-pyrazole-3-carboxylate
CAS:Controlled Product<p>Please enquire for more information about Methyl 1,5-diphenyl-1H-pyrazole-3-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H14N2O2Purity:Min. 95%Molecular weight:278.31 g/mol4-(tert-Butoxycarbonyl)thiomorpholine-3-carboxylic acid
CAS:<p>Please enquire for more information about 4-(tert-Butoxycarbonyl)thiomorpholine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17NO4SPurity:95%NmrMolecular weight:247.31 g/mol3-{[(3,4-Dichlorophenyl)amino]carbonyl}bicyclo[2.2.1]hept-5-ene-2-carboxylic acid
CAS:<p>Please enquire for more information about 3-{[(3,4-Dichlorophenyl)amino]carbonyl}bicyclo[2.2.1]hept-5-ene-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H13Cl2NO3Purity:Min. 95%Molecular weight:326.17 g/mol5-(4-Fluorophenyl)-3-isoxazolecarboxylic acid
CAS:<p>5-(4-Fluorophenyl)-3-isoxazolecarboxylic acid is a high quality reagent with CAS No. 33282-24-5. It is a complex compound that is useful as an intermediate for the synthesis of various fine chemicals. 5-(4-Fluorophenyl)-3-isoxazolecarboxylic acid also has a number of uses in the synthesis of speciality chemicals, research chemicals, and versatile building blocks for organic chemistry. As a reaction component, it can be used to synthesize compounds with different functional groups on their molecules.</p>Formula:C10H6FNO3Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:207.16 g/mol5a-Dihydrocortisol 21-acetate
CAS:Controlled Product<p>Please enquire for more information about 5a-Dihydrocortisol 21-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H34O6Purity:Min. 95%Molecular weight:406.51 g/mol5-Bromo-3-methylthiophene-2-carboxylic acid
CAS:<p>5-bromo-3-methylthiophene-2-carboxylic acid (5BmtCA) is a potential therapeutic that has been shown to have the same estrogenic activity as estradiol. It may be used for the treatment of osteoporosis and other conditions associated with estrogen deficiency, including resorption and bone loss. 5BmtCA is an amide with two phenyl groups at the C3 position, which are bioisosteres of the sulfur in estradiol. The substitutions on these phenyl groups can be changed to produce analogs with different properties. For example, 5BmtCA may be substituted with a ketone group at position C3 to produce the corresponding ketone analog 5BmtCK. This compound would be expected to have reduced bone resorption activity relative to 5BmtCA.</p>Formula:C6H5BrO2SPurity:Min. 95%Color and Shape:PowderMolecular weight:221.07 g/mol1-Fluoro-5a-androst-2-en-17b-ol acetate
CAS:Controlled Product<p>Please enquire for more information about 1-Fluoro-5a-androst-2-en-17b-ol acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H28FO2Purity:Min. 95%Molecular weight:319.43 g/mol3-Chloro-4-cyanophenylboronic acid
CAS:Controlled Product<p>Please enquire for more information about 3-Chloro-4-cyanophenylboronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5BClNO2Purity:Min. 95%Molecular weight:181.38 g/mol1-N-Boc-pyrrolidine-3-(S)-methylcarboxylate
CAS:<p>Please enquire for more information about 1-N-Boc-pyrrolidine-3-(S)-methylcarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/mol1-Benzylindole-3-Carboxylic Acid
CAS:Controlled Product<p>1-Benzylindole-3-carboxylic acid is a bioactive molecule that has been shown to inhibit the activity of histamine, which is a neurotransmitter involved in inflammatory reactions. 1-Benzylindole-3-carboxylic acid has an affinity ligand for binding to the H1 receptor and can be used as an antihistaminic agent. It also has antihistaminic effects by inhibiting the release of histamine from mast cells and basophils, which are two types of white blood cells that are involved in allergic reactions. The pharmacophore model for 1-benzylindole-3-carboxylic acid suggests that it could be used as an antihistamine or anticholinergic.</p>Formula:C16H13NO2Purity:Min. 95%Molecular weight:251.28 g/molN10-Methyl pteroic acid
CAS:<p>N10-Methyl pteroic acid is a novel immunosuppressant that inhibits T-cell proliferation and promotes regression of inflammatory bowel disease. It has been shown to be effective in treating cancer patients, with the terminal half-life being approximately 20 hours. N10-Methyl pteroic acid is a potent inhibitor of human acute lymphoblastic leukemia cells. It can also be used as an immunosuppressant for organ transplantation, with desorption from gels using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI TOF MS) and bioanalytical methods such as high performance liquid chromatography (HPLC).</p>Formula:C15H14N6O3Purity:Min. 95%Molecular weight:326.31 g/molEthyl 1,2-dimethyl-5-hydroxyindole-3-carboxylate
CAS:Controlled Product<p>Ethyl 1,2-dimethyl-5-hydroxyindole-3-carboxylate (EDMC) is an implantable drug that is used to treat hypertension. It is a diuretic that can be taken orally or injected. EDMC works by reducing the amount of urea nitrogen in the blood and increasing the amount of chlorine atom in the urine. This leads to an increase in active substances such as malonic acid and a decrease in arthropoda. EDMC has been shown to have antihypertensive activity due to its ability to lower diastolic and systolic pressure. The molecule also contains hydroxyl group and aldehyde groups that are analyzed by analytical chemistry.</p>Formula:C13H15NO3Purity:Min. 95%Molecular weight:233.26 g/molHemokinin 1 (mouse, rat) trifluoroacetate salt
CAS:<p>Hemokinin 1 is a protein that is encoded by the NK1R gene. It has been shown to be associated with insulin resistance, inflammatory diseases, and pain control. Hemokinin 1 is also a potential treatment for viral infections such as HIV and hepatitis C. Hemokinin 1 interacts with nicotinic acetylcholine receptors (nAChRs) in the brain and blood vessels, which leads to an increase in blood pressure. This protein also interacts with hematopoietic cells, which may be responsible for its function as an antinociceptive agent. Hemokinin 1 has been implicated in autoimmune diseases such as arthritis and atrial fibrillation. This protein is expressed mainly in the brain, liver, heart, kidneys and spleen.</p>Formula:C61H100N22O15SPurity:Min. 95%Molecular weight:1,413.65 g/mol[(5-Methyl-4-phenyl-4H-1,2,4-triazol-3-yl)thio]acetic acid
CAS:<p>Please enquire for more information about [(5-Methyl-4-phenyl-4H-1,2,4-triazol-3-yl)thio]acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11N3O2SPurity:Min. 95%Molecular weight:249.29 g/mol4-Chloro-benzene-sulfinic acid sodium salt
CAS:<p>The 4-chloro-benzenesulfinic acid sodium salt is a type of sulfinic acid. It can be used to control experiments involving methides, halides, and human macrophages. Sodium salts of this compound have been shown to inhibit the growth of Candida glabrata and Galleria mellonella in vitro. The 4-chloro-benzenesulfinic acid sodium salt reacts with chloride ion to form a nucleophilic trifluoroacetate anion, which reacts with thiosulfonates to produce type strain. Trifluoroacetic acid is used as a solvent in the reaction.</p>Formula:C6H4ClNaO2SPurity:Min. 95%Molecular weight:198.6 g/molCyclopiazonic acid
CAS:<p>Cyclopiazonic acid is a sesquiterpene lactone that inhibits the transcription activator-binding site in the promoter region of c-myc and c-jun. Cyclopiazonic acid also inhibits protein synthesis by preventing phosphorylation of dinucleotide phosphate, which leads to an increase in intracellular calcium levels. This compound also has a cytotoxic effect on HL60 cells, which may be due to its ability to inhibit the production of secretases. Cyclopiazonic acid's effects on pluripotent cells have not been well studied, but it is known to have pharmacological properties that are similar to other compounds that are being studied for their potential anti-cancer effects.</p>Formula:C20H20N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:336.39 g/mol5-Chloro-2-(ethylsulfonyl)pyrimidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 5-Chloro-2-(ethylsulfonyl)pyrimidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H7ClN2O4SPurity:Min. 95%Molecular weight:250.66 g/mol3-(2,5-Dioxoimidazolidin-4-yl)propanoic acid
CAS:<p>3-(2,5-Dioxoimidazolidin-4-yl)propanoic acid (3DAP) is a histidine analog that belongs to the group of fatty acid derivatives. It has been shown to be effective in the diagnosis of obesity and provides a new approach for the treatment of obesity. 3DAP binds to organic anion transporters, which are proteins that transport organic anions across cell membranes. This binding inhibits the transport of organic anion substrates and leads to increased concentrations of these substrates in blood plasma. 3DAP is a competitive inhibitor against estrone sulfate, which is one of its major metabolites. 3DAP has shown efficacy in animal models for obesity, diabetes, and hepatic steatosis.</p>Formula:C6H8N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:172.14 g/mol4β-Hydroxy cholesterol 4-acetate
CAS:Controlled Product<p>4b-Hydoxy cholesterol 4-acetate is a pleiotropic drug with a wide range of pharmacological activities. It is an inhibitor of the sirtuin family of proteins and may have anti-cancer effects. It has also been shown to be effective in the treatment of depression and myelodysplastic syndrome. The mechanism of action for this agent is not well understood, but it may be due to its ability to inhibit DNA methyltransferases, which would lead to a change in DNA methylation patterns. 4b-Hydroxy cholesterol 4-acetate has also been shown to decrease lipid levels in the blood and increase the activity of liver enzymes that metabolize fatty acids. This drug can also modify lamellar bodies and short-chain fatty acids by inhibiting the enzyme ATP citrate lyase, which catalyzes citrate cleavage into acetyl CoA and oxaloacetate.</p>Formula:C29H48O3Purity:Min. 95%Molecular weight:444.69 g/mol3-(Methylsulfonyl)propanoic acid
CAS:<p>3-(Methylsulfonyl)propanoic acid is a polynucleotide that is used in sequencing reactions. It has been shown to bind to the protein Smegmatis and increase the rate of the polymer composition. 3-(Methylsulfonyl)propanoic acid has also been shown to have a structural similarity with porins, which are proteins that form pores in cell membranes for ion transport. 3-methylsulfanylpropanoic acid binds to porins by coordinating geometry, allowing it to be transported into cells. The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of human activity has been shown using a patch-clamp technique on human ery</p>Formula:C4H8O4SPurity:Min. 95%Molecular weight:152.17 g/mol(S)-1,2,3,4,5,6,7,8-Octahydro-1-[(4-methoxyphenyl)methyl]isoquinoline (acetate salt )
CAS:<p>(S)-1,2,3,4,5,6,7,8-Octahydro-1-[(4-methoxyphenyl)methyl]isoquinoline (acetate salt ) is a diphosphine that can be used as a catalyst to produce formic acid from methanol and carbon monoxide. This product is an enantiomer of picric acid and has been shown to be an effective additive in the crystallization of picric acid. The acetate salt is also optically pure.</p>Purity:Min. 95%N-Cbz-L-aspartic acid 1-benzyl ester
CAS:<p>N-Cbz-L-aspartic acid 1-benzyl ester is a synthetic stereoselective allyl group that can be used for biochemical studies. It has been shown to have a role in the repair of damaged DNA and cellular growth. N-Cbz-L-aspartic acid 1-benzyl ester is an adenosine diphosphate (ADP) analog, which acts as an acceptor of ADP and inhibits phosphatases.</p>Formula:C19H19NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:357.36 g/mol12-Aminododecanoic acid
CAS:<p>12-Aminododecanoic acid is a fatty acid that is used in the manufacture of magnetic particles. It is synthesized by cationic polymerization of 4-tert-butylbenzoic acid and dodecanedioic acid. The process involves the use of water vapor to remove hydrochloric acid from the solution and form a salt, which then reacts with dodecanedioic acid to produce 12-aminododecanoic acid. This compound has been shown to have transport properties for nitrogen atoms and can be used in exfoliated materials such as nanometals. 12-Aminododecanoic acid has also been shown to exhibit redox activity due to its ability to react with hydrogen peroxide.</p>Formula:C12H25NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:215.33 g/molChloranilic acid
CAS:<p>Chloranilic acid is a thermally unstable compound that undergoes a number of reactions with the addition of heat. It reacts with nitrogen atoms to form amides, nitriles, and nitro compounds. Chloranilic acid also reacts with polymerases to form stable complexes. The proton at the center of the chloranilic acid molecule is lost when it forms an acid complex. This reaction occurs in aqueous solution as well as in biological systems, where it is used for hydrogen bonding interactions. The stable complexes that are formed by chloranilic acid have been shown to have biological properties such as antimicrobial activity, antiviral activity, and antifungal activity.</p>Formula:C6H2Cl2O4Purity:Min. 95%Color and Shape:Orange To Red SolidMolecular weight:208.98 g/molPhosphonooxy acetic acid
CAS:<p>Phosphonooxy acetic acid is a product of the reaction between phosphoglycolate and oxygen. It is involved in photosynthesis and has been shown to have a physiological function in plants. Phosphonooxy acetic acid also has enzyme activities, including hydroxylase and phosphatase activities. The bacterial strain can affect the production of this compound, as well as the plant's physiological conditions. Epidermal growth factor (EGF) is an important protein that regulates cell proliferation and differentiation that has been found to be regulated by phosphonooxy acetic acid in vitro. In addition, structural analysis of this compound has revealed that it binds to transcriptional regulators such as activator protein 1 and nuclear factor-kappa B, which are important for autoimmune diseases. This chemical also has biochemical properties, including its optimum pH of 7.0 and x-ray diffraction data.</p>Formula:C2H5O6PPurity:Min. 95%Color and Shape:SolidMolecular weight:156.03 g/mol2-[4-(2-Methylpropenyl)phenyl]propionic acid
CAS:<p>2-[4-(2-Methylpropenyl)phenyl]propionic acid is an analgesic and antipyretic agent. It has been shown to have antiinflammatory properties, which are mediated through inhibition of prostaglandin synthesis. This agent binds to the enzyme cyclooxygenase and inhibits the biosynthesis of prostaglandins that are responsible for inflammation. 2-[4-(2-Methylpropenyl)phenyl]propionic acid also has optical antipyretic activity, which may be due to its ability to inhibit the release of prostaglandins from arachidonic acid in the hypothalamus. The optical antipyretic activity is most likely due to the enantiomers that this drug contains. 2-[4-(2-Methylpropenyl)phenyl]propionic acid has a pharmacologic profile that includes analgesic and antipyretic activities.END>></p>Formula:C13H16O2Purity:Min. 95%Color and Shape:PowderMolecular weight:204.26 g/molEthyl5-acetyloxy-1,2-dimethylindole-3-carboxylate
CAS:Controlled Product<p>Please enquire for more information about Ethyl5-acetyloxy-1,2-dimethylindole-3-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H17NO4Purity:Min. 95%Molecular weight:275.3 g/molall-cis-6,9,12,15-Octadecatetraenoic acid
CAS:<p>All-cis-6,9,12,15-octadecatetraenoic acid is a polyunsaturated fatty acid that has been shown to have anti-inflammatory properties. It is found in the form of stearidonic acid and can be derived from plants such as flaxseed or soybeans. All-cis-6,9,12,15-octadecatetraenoic acid has been shown to inhibit the production of chemoattractant protein (MCP) in 3T3L1 preadipocytes by blocking the synthesis of arachidonic acid. This compound also inhibits the proliferation of MDA-MB 231 breast cancer cells and induces cell death via apoptosis.</p>Formula:C18H28O2Purity:Min. 95%Molecular weight:276.41 g/mol2-Diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride
CAS:<p>2-Diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride is a methyltransferase inhibitor that blocks the synthesis of monoethyl ether, which is used to synthesize dicyclomine. It has been shown to be effective in vitro against biological samples such as rat liver and blood cells. 2-Diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride also has been shown to have a pharmacological effect on rats with bowel disease, congestive heart failure, and crystalline cellulose. The chemical structure of 2-Diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride is similar to that of phosphorus pentoxide, which makes it difficult for this drug to cross the blood brain barrier.</p>Formula:C19H36ClNO2Purity:Min. 95%Molecular weight:345.95 g/mol6-(Methoxycarbonyl)spiro[3.3]heptane-2-carboxylic acid
CAS:<p>Please enquire for more information about 6-(Methoxycarbonyl)spiro[3.3]heptane-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14O4Purity:Min. 95%Molecular weight:198.22 g/mol6-Formylpyridine-3-carboxylic acid
CAS:<p>Please enquire for more information about 6-Formylpyridine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5NO3Purity:Min. 95%Molecular weight:151.12 g/molMethyl 2,4-dichloropyrimidine-6-carboxylate
CAS:<p>Please enquire for more information about Methyl 2,4-dichloropyrimidine-6-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4Cl2N2O2Purity:Min. 95%Color and Shape:Off-White To Yellow SolidMolecular weight:207.01 g/mol2-Amino-4,6-difluorobenzoic acid
CAS:<p>Please enquire for more information about 2-Amino-4,6-difluorobenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5F2NO2Purity:Min. 95%Molecular weight:173.12 g/molMethyl 6-methyl-2-oxo-4-phenyl-1,2,3,4-tetrahydropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Methyl 6-methyl-2-oxo-4-phenyl-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H14N2O3Purity:Min. 95%Molecular weight:246.26 g/mol3,4-Dihydro-1H-isochromene-1-carboxylic acid
CAS:<p>3,4-Dihydro-1H-isochromene-1-carboxylic acid is a pyridine derivative that has been used as an intermediate in the synthesis of other compounds. 3,4-Dihydro-1H-isochromene-1-carboxylic acid is a weak acid that can be prepared by the reaction of 3,4-dihydroisoquinoline with chloroform and hydrochloric acid. It is also synthesized from 1,4 benzodioxane and phenylacetic acid. This compound has been used to prepare amides, amidines, and ureas. 3,4-Dihydroisoquinoline is also used as a precursor for the synthesis of pyridinium salts.</p>Formula:C10H10O3Purity:Min. 95%Molecular weight:178.18 g/molSinapic acid acyl-β-D-glucoside
CAS:<p>a functionalised glucoside</p>Formula:C17H22O10Purity:Min. 95%Molecular weight:386.35 g/mol4-(Butylamino)benzoic acid
CAS:<p>4-(Butylamino)benzoic acid is a non-steroidal anti-inflammatory drug (NSAID) that has been used to treat pain. It is a prodrug, which is metabolized in the liver to 4-(butylamino)-phenylacetic acid, its active form. The 4-(butylamino)benzoic acid molecule has a hydrophobic effect and binds to chloride ions. This binding inhibits the production of prostaglandins, which are mediators of pain. 4-(Butylamino)benzoic acid also reduces the activity of plasma cells that produce antibodies and increases the activity of lymphocytes and platelets, leading to an increase in immunoglobulin levels.</p>Formula:C11H15NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:193.24 g/mol4,6-Diaminobenzene-1,3-dicarboxylic acid
CAS:<p>4,6-Diaminobenzene-1,3-dicarboxylic acid is an inorganic copper compound that is used as a copper salt. It has been shown to be effective as a chelating agent for the treatment of copper toxicity. 4,6-Diaminobenzene-1,3-dicarboxylic acid binds to metal ions and forms a complex with them. This complex can then be excreted from the body through urine or bile.</p>Formula:C8H8N2O4Purity:Min. 95%Molecular weight:196.16 g/molSodium acetate trihydrate
CAS:<p>Sodium acetate trihydrate is a salt that is used in the production of sodium salts and surface methodology, as well as in analytical methods. It is also used to prepare anhydrous sodium. Sodium acetate trihydrate can be used as a cell lysis agent for water vapor.</p>Formula:CH3COONa·3H2OPurity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:136.08 g/molGanoderic acid S
CAS:Controlled Product<p>Ganoderic acid S is a triterpenoid compound that has been shown to inhibit the growth of human cancer cells in vitro. It contains a carbonyl group and an hydroxyl group, which are reactive molecules that can form covalent bonds with proteins and other molecules. Ganoderic acid S also has anti-inflammatory properties and can inhibit the release of growth factors, such as monoclonal antibodies, from immune cells. In addition, it inhibits the production of mitochondrial enzymes, such as hydroxylases and oxidases, by binding to the heme moiety in their active site.<br>Ganoderic acid S is found in rhizoma gastrodiae (a type of mushroom), which has been used for centuries in traditional Chinese medicine to treat various conditions. The populations of mice given ganoderic acid S orally for three months showed increased life span and reduced tumor incidence.</p>Purity:Min. 95%4-Bromobenzenesulfonic acid
CAS:<p>4-Bromobenzenesulfonic acid is a chemical used in the synthesis of organic molecules. It is an intermediate in the production of cyclopropylboronic acid, which is used as a building block in various organic syntheses. 4-Bromobenzenesulfonic acid can be prepared by reacting pyridine with acetic anhydride and then adding sodium carbonate to remove water. This reaction produces a molecule with two acid groups that are nucleophilic and can react with carboxylic acids to form esters. The yield for this reaction is high and it does not require any special equipment or conditions. This chemical is also used as a linker for other compounds during synthesis reactions, such as diazonium salts or dioxane. 4-Bromobenzenesulfonic acid reacts with triethylphosphite to give disulfides, which are important for protein structure.</p>Formula:C6H7BO5SPurity:Min. 95%Molecular weight:201.99 g/mol4-(2-Chlorophenyl)-9-methyl-6H-thieno[3,2-f][1,2,4]triazolo[4,3-a][1,4]diazepine-2-propanoic acid methyl ester
CAS:Controlled Product<p>Please enquire for more information about 4-(2-Chlorophenyl)-9-methyl-6H-thieno[3,2-f][1,2,4]triazolo[4,3-a][1,4]diazepine-2-propanoic acid methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17ClN4O2SPurity:Min. 95%Molecular weight:400.88 g/mol3-Cyclopropylpropanoic acid
CAS:<p>3-Cyclopropylpropanoic acid is a synthetic derivative of oxalyl chloride. It has been shown to inhibit the growth of viruses, notably influenza A virus and human immunodeficiency virus (HIV), in cell culture. 3-Cyclopropylpropanoic acid also inhibits the g1 phase of the cell cycle. In addition, it has been shown to inhibit skin cancer and cardiovascular diseases in humans.</p>Formula:C6H10O2Purity:95%NmrMolecular weight:114.14 g/moltert-Butyl 3-(cyclopropylamino)azetidine-1-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 3-(cyclopropylamino)azetidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O2Purity:Min. 95%Molecular weight:212.29 g/mol4-bromo-2,5-difluorobenzoic Acid
CAS:<p>4-Bromo-2,5-difluorobenzoic acid is a potent inhibitor of isoforms CYP2C9 and CYP2D6. It is an acidic drug with a pKa of 3.8, which makes it ionizable in biological fluids. 4-Bromo-2,5-difluorobenzoic acid inhibits the activity of CYP2C9 and CYP2D6 by binding to the pharmacophore region of these enzymes. 4-Bromo-2,5-difluorobenzoic acid also has an isosteric functionality that increases its selectivity for CYP2C9 and CYP2D6 over other cytochrome P450 isoforms. The functional groups on 4-bromo-2,5-difluorobenzoic acid are part of the inhibitor's nature that make it selective for these two cytochrome</p>Formula:C7H3BrF2O2Purity:Min. 95%Molecular weight:237 g/molTetrahydro-a-(1-naphthalenylmethyl)-2-furanpropanoic Acid 2-(Diethylamino)ethyl Ester
CAS:Controlled Product<p>Tetrahydro-a-(1-naphthalenylmethyl)-2-furanpropanoic Acid 2-(Diethylamino)ethyl Ester is a fatty acid analog that has antimicrobial properties. It is used in the treatment of bone cancer, and can be used to diagnose and treat other diseases such as glomerular filtration rate, receptor binding, and malonic acid. Tetrahydro-a-(1-naphthalenylmethyl)-2-furanpropanoic Acid 2-(Diethylamino)ethyl Ester binds to receptors on cells, which leads to an increase in the amount of monoamine neurotransmitters released by the cells.</p>Formula:C24H33NO3Purity:Min. 95%Molecular weight:383.52 g/molBoc-(2R,5S)-5-phenylpyrrolidine-2-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(2R,5S)-5-phenylpyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21NO4Purity:Min. 95%Molecular weight:291.34 g/mol3,4,5-Triacetoxybenzoic acid
CAS:<p>Trifluoroacetic acid is an organic acid that is used in the synthesis of esters, ethers, and amides. It can be used to produce 3,4,5-triacetoxybenzoic acid (TABA), which inhibits the proliferation of leukemia cells. TABA binds to the active site of the protein runx2, which is involved in development and differentiation. It also inhibits vibrational spectra and chemical profiles that are related to cancer cell growth. TABA has been shown to induce autophagy through activation of AMPK signaling pathways in leukemia cells. TABA also inhibits lipid accumulation by inhibiting the expression of genes such as SREBP1c and ACC2.</p>Formula:C13H12O8Purity:Min. 97 Area-%Color and Shape:PowderMolecular weight:296.23 g/molDehydrotumulosic acid
CAS:Controlled Product<p>Dehydrotumulosic acid is a natural product that has been shown to inhibit the activity of P-glycoprotein (P-gp) in vitro. It also inhibits tumor growth and metastasis by inducing apoptosis in HL60 cells, as well as inhibiting the proliferation of human leukemia cells. Dehydrotumulosic acid is not toxic to normal cells because it does not induce apoptosis in these cells. The effect on tumor cell proliferation was found with an acetate extract of dehydrotumulosic acid and matrix effects were observed by use of poria, which may lead to a more accurate analytical method. Pharmacokinetic studies have been done with dehydrotumulosic acid, but no toxicity or adverse effects have been reported for this drug. This compound is being investigated for its potential use in cancer therapy and treatment.</p>Formula:C31H48O4Purity:Min. 95%Color and Shape:SolidMolecular weight:484.71 g/molACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H205N39O29SPurity:Min. 95%Molecular weight:2,846.36 g/mol2-Methylnicotinic acid methyl ester
CAS:<p>2-Methylnicotinic acid methyl ester is a synthetic chemical compound that belongs to the isomer family. It has been used in the synthesis of cocaine and isomers, as well as in the modification of drugs. 2-Methylnicotinic acid methyl ester can be synthesised from 2-methylpyridine and formaldehyde via the method of methylmagnesium iodide. 2-Methylnicotinic acid methyl ester has been shown to be a potent inhibitor of human platelet aggregation, which may be due to its structural similarity to nicotine.</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/molBoc-1-amino-1-cyclobutane carboxylic acid
CAS:<p>Boc-1-amino-1-cyclobutane carboxylic acid is a synthetic and potent agonist of the androgen receptor. It is an analog of apalutamide, which is a selective antagonist of the androgen receptor. Boc-1-amino-1-cyclobutane carboxylic acid has been shown to have high oral bioavailability, which makes it suitable for oral administration. Boc-1-amino-1-cyclobutane carboxylic acid has been shown to have increased functional activity in cancer cells, which may be due to its ability to inhibit the growth of tumor cells by binding to their androgen receptors. Boc-1-amino-1-cyclobutane carboxylic acid has also been found to have good affinity for the androgen receptor when tested on cultured cells.</p>Formula:C10H17NO4Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:215.25 g/molTaraxeryl acetate
CAS:Controlled Product<p>Taraxeryl acetate is a fatty acid that is found in the extract of Curcuma aromatica (turmeric). It has been shown to inhibit cervical cancer cells in tissue culture. Taraxeryl acetate inhibits the growth of Streptococcus faecalis by binding to its ribosomal RNA and inhibiting protein synthesis. Toxicological studies on rats have shown that this compound does not have any harmful effects on physiological functions. This molecule has also been shown to be an inhibitor for protocatechuic acid, which is a chemical structure involved in the cycle analysis of curcuminoids. In addition, taraxeryl acetate has been used as an active ingredient in Chinese medicine preparations for the treatment of symptoms related to herpes simplex virus infections.</p>Purity:Min. 95%Fmoc-1-amino-4,7,10-trioxa-13-tridecanamine succinimic acid
CAS:<p>Fmoc-1-amino-4,7,10-trioxa-13-tridecanamine succinimic acid is a synthetic amide that is used as an intermediate in the synthesis of peptides. It has a conformational structure and can be labeled with dyes to study the structures of proteins or peptides. Fmoc-1-amino-4,7,10-trioxa-13-tridecanamine succinimic acid has been used as an immunogen in the preparation of monoclonal antibodies. It also can be conjugated to drugs or other compounds for use as bioconjugates. This compound has been shown to have enzymatic activity and can be used as a substrate for enzyme linked immunosorbent assays (ELISA). Trifluoroacetic acid is commonly used in the synthesis of this compound.</p>Formula:C29H38N2O8Purity:Min. 98 Area-%Molecular weight:542.62 g/mol(2S)-2-(1H-Tetrazol-1-yl)propanoic acid
CAS:<p>Please enquire for more information about (2S)-2-(1H-Tetrazol-1-yl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C4H6N4O2Purity:Min. 95%Molecular weight:142.12 g/molZiconotide acetate
CAS:Controlled Product<p>Ziconotide acetate is a polymer conjugate of ziconotide and goserelin acetate. It is used to treat severe chronic pain in patients who have not responded to other treatments, such as opioids or local anesthetics. Ziconotide acetate is administered by injection into the intrathecal space, where it acts on nerve cells in the dorsal horn of the spinal cord. The drug is slowly released from the polymer conjugate over time, which effectively reduces its irritant effects. It also has low solubility in water, which helps reduce its rate of clearance from the body. The active substances in this drug are ziconotide and goserelin acetate, both of which have been shown to be effective for treating chronic pain. Ziconotide acetate has also been shown to cause a decrease in blood levels of cholesterol and lipoproteins, although this effect may be due to goserelin acetate rather than ziconotide itself.</p>Formula:C102H172N36O32S7C2H4O2Purity:Min. 95%Molecular weight:2,699.19 g/mol1-Methyl-1H-benzimidazole-2-carboxylic acid
CAS:Controlled Product<p>1-Methyl-1H-benzimidazole-2-carboxylic acid is a synthetic compound that can be used as an antiprotozoal. It has been shown to have good activity against intestinalis, vaginalis, and intestinalis species. 1-Methyl-1H-benzimidazole-2-carboxylic acid binds to the acetyl groups of the parasite's cell membrane and inhibits the formation of the cytoplasmic membrane. This prevents the parasite from synthesizing ATP, which causes them to die. 1-Methyl-1H-benzimidazole-2-carboxylic acid also has strong activity against Giardia lamblia, which is caused by its ability to inhibit protein synthesis in this organism.</p>Formula:C9H8N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:176.17 g/mol(R)-2-Chloromandelic acid
CAS:<p>(R)-2-Chloromandelic acid is an organic compound with the formula CHClCOH. It is a mandelonitrile, which is a benzene ring fused to a nitrile. It has an optimal reaction at acidic pH and in organic solvents and is enantiopure. The cell lysis of Escherichia coli can be achieved by this compound, as seen through the use of acid dehydrogenase. (R)-2-Chloromandelic acid has been shown to inhibit platelet aggregation, making it an antiplatelet agent. This product can be synthesized using methods such as the enantioselective synthesis of clopidogrel or the asymmetric synthesis of D-mandelic acid methyl ester. The isolated yield for (R)-2-Chloromandelic acid is about 45%.</p>Formula:C8H7ClO3Purity:Min. 95%Color and Shape:SolidMolecular weight:186.59 g/mol2,3-Dibromopropanoic acid
CAS:<p>2,3-Dibromopropanoic acid is a carcinogenic chemical that has been shown to cause liver tumors in rats. It is a nucleophile that reacts with amide groups to form an amide bond. The analytical method for 2,3-dibromopropanoic acid is gas chromatography with flame ionization detection. Its structural formula is CHBrCHBrCOH. It has a carbonyl group and acidic properties, as well as a chloride ion present on the molecule. 2,3-Dibromopropanoic acid is an anxiolytic drug that has been shown to have health effects such as drowsiness and headache.</p>Formula:C3H4Br2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:231.87 g/molBoc-4-(4-fluorophenyl)-piperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about Boc-4-(4-fluorophenyl)-piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H22FNO4Purity:Min. 95%Molecular weight:323.36 g/mol3,6-Dihydro-4-(tributylstannyl)-1(2H)-pyridinecarboxylic acid t-butyl ester
CAS:Controlled Product<p>Please enquire for more information about 3,6-Dihydro-4-(tributylstannyl)-1(2H)-pyridinecarboxylic acid t-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H43NO2SnPurity:Min. 95%Color and Shape:PowderMolecular weight:472.29 g/molOctyl 3-octyloxiraneoctanoic acid
CAS:<p>Octyl 3-octyloxiraneoctanoic acid is a chloride compound that is used as a surfactant in the formulation of paints, lacquers, and coatings. Octyl 3-octyloxiraneoctanoic acid has been shown to be an effective emulsifier for water and oil based systems. It can also be used as a solvent for polyvinyl chloride. This compound reacts with water to form hydrogen chloride gas. The octadecyl group on the molecule is responsible for this property. Octyl 3-octyloxiraneoctanoic acid has been shown to react with boron nitride and cationic polymerization products, such as polylactic acid or polyethyleneimine. This reactive functional group allows it to be used in reactive coating applications, including powder coating and flame retardants.</p>Formula:C26H50O3Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:410.67 g/mol3-Bromo-4-pyridinecarboxylic acid
CAS:<p>3-Bromo-4-pyridinecarboxylic acid is a naphthyridine derivative that is used in drug development. It is a crystalline solid that can be dissolved in organic solvents. 3-Bromo-4-pyridinecarboxylic acid has been shown to have antiinflammatory properties and can be used as an oxidant. 3-Bromo-4-pyridinecarboxylic acid is being investigated as a receptor subtype for inflammatory diseases, and it has also been used to study the mechanism of chronic inflammatory diseases.</p>Formula:C6H4BrNO2Purity:Min. 95%Molecular weight:202.01 g/molTolfenamic Acid
CAS:<p>Tolfenamic acid is a non-steroidal anti-inflammatory drug that has been shown to inhibit the MCL-1 protein, which is involved in the regulation of programmed cell death. It has been used for the treatment of bowel disease and can be given orally or rectally. Tolfenamic acid may be effective against inflammatory bowel diseases such as ulcerative colitis and Crohn's disease. Tolfenamic acid binds to anionic sites on the matrix of cartilage and inhibits the production of prostaglandin E2 by inhibiting cyclooxygenase activity. Tolfenamic acid has also been shown to reduce pain by inhibiting the enzyme COX-2, which is associated with inflammation. The drug also has a strong effect on human polymorphonuclear leukocytes (PMN).</p>Formula:C14H12ClNO2Purity:Min. 97%Color and Shape:PowderMolecular weight:261.7 g/molPolyoxyethylated 12-hydroxystearic acid
CAS:<p>Polyoxyethylated 12-hydroxystearic acid is a surface active agent that is used as an adjuvant in pharmaceutical preparations. Polyoxyethylated 12-hydoxystearic acid has been shown to have antimicrobial properties, which are due to its ability to disrupt the lipid membrane of bacteria and fungi. This agent also has a protective effect against the cytotoxicity of trifluoroacetic acid, which is often used in cell culture studies. Polyoxyethylated 12-hydoxystearic acid also has potential applications in cancer therapy because it can be conjugated with anticancer drugs to form liposome nanoparticles, which may allow for more efficient delivery of these drugs into cancer cells.</p>Color and Shape:Off-White Powder4-Bromo-pyridine-2-carboxylic acid
CAS:<p>4-Bromo-pyridine-2-carboxylic acid is a metabotropic glutamate receptor antagonist that inhibits the neurotransmitter glutamate. It has been shown to have antibacterial activity against Staphylococcus aureus and anti-inflammatory properties against the fungus Candida albicans. The drug is orally bioavailable, which means it can be taken by mouth, and has a pharmacokinetic profile that increases its bioavailability. This means that 4-Bromo-pyridine-2-carboxylic acid is an inhibitor of deoxycytidine kinase and may be used as an antifungal agent.</p>Formula:C6H4BrNO2Purity:Min. 95%Color and Shape:White To Light (Or Pale) Grey SolidMolecular weight:202.01 g/mol2-Fluoro-3-(trifluoromethyl)benzoic acid
CAS:<p>2-Fluoro-3-(trifluoromethyl)benzoic acid is an amide that has been shown to inhibit the growth of Huh-7 human hepatoma cells, which express ABCA1. This compound has been shown to bind to and inhibit the activity of the enzyme acid hydrazide. It has also been shown to be active against methoxy functional assays and macrophage cell lines.</p>Formula:C8H4F4O2Purity:Min. 95%Molecular weight:208.11 g/mol5-Oxo-1-(pyridin-3-ylmethyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about 5-Oxo-1-(pyridin-3-ylmethyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12N2O3Purity:Min. 95%Molecular weight:220.22 g/mol2-Ethoxyphenylboronic acid
CAS:<p>Ethoxyphenylboronic acid is a triazine compound which inhibits inflammation by inhibiting the kinase that catalyzes the phosphorylation of arachidonic acid. It also inhibits lipid kinase, which is involved in the metabolism of lipids, and it has been shown to inhibit cancer cell growth through hydrogen bond interactions with DNA. Ethoxyphenylboronic acid has been shown to have anti-inflammatory properties and may be useful for the treatment of inflammatory diseases such as arthritis. The compound can also inhibit hydrogen peroxide-induced oxidative damage in cells, due to its ability to release intracellular glutathione.</p>Formula:C8H11BO3Purity:Min. 95%Molecular weight:165.98 g/mol(2,7,8-Trimethyl-4-oxoquinazolin-3(4H)-yl)acetic acid
CAS:Controlled Product<p>Please enquire for more information about (2,7,8-Trimethyl-4-oxoquinazolin-3(4H)-yl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H14N2O3Purity:Min. 95%Molecular weight:246.26 g/molDecanoic acid
CAS:<p>Decanoic acid is a saturated fatty acid that has been used as a pharmaceutical agent for the treatment of congestive heart failure. Decanoic acid is also used in the production of glycol ethers and as an intermediate in organic synthesis. The melting point of decanoic acid is between 30 and 35 degrees Celsius, which is lower than the melting points of caproic acid (40 degress) or lauric acid (45 degrees Celsius). Decanoic acid has been shown to reduce blood glucose levels in diabetic mice and rats and has also been shown to have antimicrobial activity against c. glabrata, S. aureus, and E. coli. Decanoic acid may be effective as an adjuvant therapy for melanoma by inducing apoptosis through mitochondrial membrane potential disruption.</p>Formula:C10H20O2Purity:Min. 95%Color and Shape:PowderMolecular weight:172.26 g/moltert-Butyl 4-chloro-5,6-dihydropyrido[3,4-d]pyrimidine-7(8H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 4-chloro-5,6-dihydropyrido[3,4-d]pyrimidine-7(8H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16ClN3O2Purity:Min. 95%Molecular weight:269.73 g/molall-trans 5,6-Epoxy retinoic acid
CAS:<p>5,6-Epoxy retinoic acid is a synthetic retinoid that has been shown to have biological properties in tissue culture and rat liver microsomes. It is an agonist of the retinoic acid receptor (RAR) and binds to DNA at the same site as all-trans retinoic acid. 5,6-Epoxyretinoic acid also has effects on gene expression in human serum and inhibits the proliferation of cancer cells by inducing apoptosis. The synthetic retinoid can be used as a novel chemotherapeutic agent for breast cancer or leukemia.</p>Formula:C20H28O3Purity:Min. 95 Area-%Color and Shape:Yellow PowderMolecular weight:316.43 g/mol6a-Ethyl-chenodeoxycholic acid
CAS:Controlled Product<p>Please enquire for more information about 6a-Ethyl-chenodeoxycholic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H44O4Purity:Min. 95%Color and Shape:SolidMolecular weight:420.63 g/molN-Nitroso-N-methyl-4-aminobutyric acid methyl ester
CAS:<p>Please enquire for more information about N-Nitroso-N-methyl-4-aminobutyric acid methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O3Purity:Min. 95%Molecular weight:160.17 g/mol1-Cyclohexyl-5-oxopyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about 1-Cyclohexyl-5-oxopyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H17NO3Purity:Min. 95%Molecular weight:211.26 g/mol5-(4-Ethoxyphenyl)-5-ethylbarbituric acid
CAS:Controlled Product<p>Please enquire for more information about 5-(4-Ethoxyphenyl)-5-ethylbarbituric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H16N2O4Purity:Min. 95%Molecular weight:276.29 g/mol2-(Benzimidazolylthio) acetic acid
CAS:<p>2-(Benzimidazolylthio) acetic acid is a ligand that can be used as an antihelminthic. It can also be used to produce luminescent substances, inorganic salts and heterocycles. 2-(Benzimidazolylthio) acetic acid reacts with nucleophiles by nucleophilic attack, cleaving the bond and releasing the atom or group. 2-(Benzimidazolylthio) acetic acid has been used to synthesize condensation products with irradiation. This chemical has been shown to have antimicrobial properties against bacteria and fungi.</p>Formula:C9H8N2O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:208.24 g/molDimethyl 7,7'-dimethoxy-[4,4'-bibenzo[d][1,3]dioxole]-5,5'-dicarboxylate
CAS:<p>Dimethyl 7,7'-dimethoxy-[4,4'-bibenzo[d][1,3]dioxole]-5,5'-dicarboxylate is a biocompatible polymer that can be used in the treatment of liver injury. It has been shown to have an inhibitory effect on hepatic enzyme activities and synchronous fluorescence. Dimethyl 7,7'-dimethoxy-[4,4'-bibenzo[d][1,3]dioxole]-5,5'-dicarboxylate can be used as a matrix for curcuma aromatica to remove wastewater contaminants. This polymer also has the ability to inhibit monoethyl ether-induced liver injury in low-dose groups and reduce hepatitis B virus replication.</p>Formula:C20H18O10Purity:Min. 95%Molecular weight:418.35 g/mol2-(5-Chloro-1H-indol-2-yl)acetic acid
CAS:<p>Please enquire for more information about 2-(5-Chloro-1H-indol-2-yl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H8CINO2Purity:Min. 95%Molecular weight:313.09 g/mol(1R)-(-)-Menthyl acetate
CAS:<p>(1R)-(-)-Menthyl acetate is a lipase that catalyzes the hydrolysis of esters and amides. It has been immobilized to produce a solid-state biocatalyst that is efficient for the hydrolysis of ester bonds. Candida is an unicellular eukaryotic organism belonging to the phylum Ascomycota, class Saccharomycetes. The enzyme has shown excellent activity against Candida albicans, which causes candidiasis.</p>Formula:C12H22O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:198.3 g/mol(S)-2-Hydroxy-3-methoxy-3,3-diphenylpropionic acid
CAS:<p>This is a crystalline form of the pyrimidine derivative (S)-2-Hydroxy-3-methoxy-3,3-diphenylpropionic acid. The compound has been shown to have antiplatelet properties and is currently being developed as an antithrombotic agent. In vitro studies have shown that ambrisentan inhibits platelet aggregation, thromboxane synthesis, and leukocyte adhesion. It also reduces the levels of serum cholesterol and triglycerides in patients with chronic heart failure. Ambrisentan has been studied in clinical trials for the treatment of pulmonary hypertension associated with chronic obstructive pulmonary disease (COPD) and idiopathic pulmonary fibrosis (IPF).</p>Formula:C16H16O4Purity:Min. 95%Molecular weight:272.3 g/mol2-(4-Bromophenyl)succinic acid
CAS:<p>Please enquire for more information about 2-(4-Bromophenyl)succinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H9BrO4Purity:Min. 95%Molecular weight:273.08 g/mol5-(5-Chloro-1-methyl-1H-benzimidazol-2-yl)pentanoic acid
CAS:Controlled Product<p>Please enquire for more information about 5-(5-Chloro-1-methyl-1H-benzimidazol-2-yl)pentanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H15ClN2O2Purity:Min. 95%Molecular weight:266.72 g/molDL-Lactic acid sodium salt, 60% w/w syrup
CAS:<p>Lactic acid is a natural product that has been used for many years as an antimicrobial agent in wastewater treatment. It is also used in the food industry to prevent the growth of bacteria and fungi, and as a preservative. Lactic acid has been shown to have a physiological effect on locomotor activity, which may be due to its ability to convert pyruvate into lactate. Lactic acid also inhibits the growth of some bacterial strains by increasing the disulfide bond formation between two cysteine residues. The sodium salt form of lactic acid is more soluble than the acid form and can be used as an experimental model for studying sodium-lactate interactions. Sodium lactate is used in maternal blood transfusions to increase blood pH levels during labor, and is also added to water vapor for humidification purposes.</p>Formula:C3H5O3NaColor and Shape:Colorless Clear LiquidMolecular weight:112.06 g/molEthanesulfonic acid, 70% aqueous solution
CAS:<p>Ethanesulfonic acid solution - 70 wt. % in H2O is a monosodium salt that is used as an enzymatic reagent for the determination of bacteria and fungi, as well as for the detection of infectious diseases. It has been shown to be effective against microdialysis probes with a high degree of sensitivity and specificity. Ethanesulfonic acid solution - 70 wt. % in H2O has been shown to have significant physiological effects on various regions of the body, including bowel disease, polymerase chain reaction (PCR), glycol ethers, antimicrobial agents, and radiation. Ethanesulfonic acid solution - 70 wt. % in H2O also inhibits the growth of bacteria by acting as a coumarin derivative that reacts with nucleotides to form dinucleotide phosphate, which blocks DNA synthesis and transcription from RNA templates.</p>Formula:C2H6O3SPurity:(Titration) 68.0 To 72.0%Color and Shape:Clear LiquidMolecular weight:110.13 g/molMethyl 4,5-dimethoxy-1-methyl-1H-indole-2-carboxylate
CAS:Controlled Product<p>Please enquire for more information about Methyl 4,5-dimethoxy-1-methyl-1H-indole-2-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H15NO4Purity:Min. 95%Molecular weight:249.26 g/molDibromoisocyanuric acid
CAS:<p>Dibromoisocyanuric Acid is an intermediate in the metabolism of fatty acids. It has been shown to inhibit fatty acid synthesis by inhibiting the transfer reactions of fatty acids from their acyl coenzyme A ester to carnitine, which is necessary for transport across the mitochondrial membrane. Dibromoisocyanuric Acid also inhibits monoclonal antibody production by monocytes and macrophages. Dibromoisocyanuric Acid may be used as a tumor suppressor in mice with tumors because it reduces gamma-aminobutyric acid levels, leading to increased locomotor activity and decreased body mass index.</p>Formula:C3HBr2N3O3Purity:Min. 95%Color and Shape:PowderMolecular weight:286.87 g/molL-a-Aminosuberic acid
CAS:<p>L-a-aminosuberic acid is a synthetic amino acid that has been used as an analog of L-cysteine. It can be used to induce tumor cell death by inhibiting the uptake of fatty acids in prostate cancer cells. L-a-aminosuberic acid is also able to inhibit the expression of proteins that are involved in prostate cancer, such as monoclonal antibodies and sequences. This compound may be a potential biomarker for the diagnosis of prostate cancer. The low expression levels may be due to the lack of disulfide bond formation, which is necessary for protein activity.</p>Formula:C8H15NO4Purity:Min. 95%Molecular weight:189.21 g/molMethyl 2-fluoroacetate
CAS:<p>Methyl 2-fluoroacetate is a nucleophilic drug that has been shown to cause conformational changes in the target protein. It has been shown to be water-soluble, and can be used as a probe for studying biological processes. Methyl 2-fluoroacetate has been shown to be effective against papillary muscle, and is a potential drug for treating cardiac conditions. The mechanism of action of methyl 2-fluoroacetate is not well understood, but it is thought to involve the formation of an alkoxy radical. The molecular structure of methyl 2-fluoroacetate was studied using vibrational spectroscopy and nuclear magnetic resonance (NMR) spectra. This drug was also found to inhibit the growth of tissue culture cells at low concentrations, which may indicate that it can affect cell function.</p>Formula:C3H5FO2Purity:Min. 95%Molecular weight:92.07 g/mol(4-Aminophenyl)boronic acid pinacol ester
CAS:<p>(4-Aminophenyl)boronic acid pinacol ester is a semiconducting material that can be used in thin film devices. It has been shown to be a good candidate for transistor and device applications due to its high yield, low cost, and high stability. This compound can also be used to modify the structure of other compounds through substitution reactions. (4-Aminophenyl)boronic acid pinacol ester has been synthesized from inexpensive starting materials, such as triphenylamine and amines.</p>Formula:C12H18BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:219.09 g/mol5-Ethylthiophene-2-carboxylic acid
CAS:<p>5-Ethylthiophene-2-carboxylic acid is a chemical compound that has been acetylated. It is often used as an intermediate in organic synthesis, especially as a building block for the production of pharmaceuticals and agrochemicals. 5-Ethylthiophene-2-carboxylic acid can be chromatographically separated by using strategies such as validation, algorithm, and regression. The chemical structure of this compound may be determined by using methods such as fingerprinting and gas chromatography. The structural isomers of this compound are naphthenic (5E) and butyllithium (5B). Chemists use 5E and 5B to profile the properties of this substance.</p>Formula:C7H8O2SPurity:Min. 95%Molecular weight:156.2 g/mol2-Hydroxyquinoline-4-carboxylic acid
CAS:<p>2-Hydroxyquinoline-4-carboxylic acid is a carboxylate that is structurally classified as a multidrug. It has been shown to inhibit bacterial efflux pumps and target enzymes, such as cancer cells and multidrug resistant bacteria. 2-Hydroxyquinoline-4-carboxylic acid also has potent antibacterial activity against Streptococcus faecalis, an opportunistic pathogen that causes infections in the urinary tract and on skin wounds. The fluorescence properties of this compound can be used for fluorescent labeling of biomolecules or for sensing applications.</p>Formula:C10H7NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:189.17 g/mol(D-His1)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-His1)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H282N50O60SPurity:Min. 95%Molecular weight:4,186.57 g/molChlorogenic acid hemihydrate
CAS:<p>Chlorogenic acid hemihydrate is a natural phenolic compound that belongs to the family of flavonol glycosides. The molecule has two caffeoylquinic acids and one chlorogenic acid functional groups, which are responsible for its antioxidant properties. Chlorogenic acid hemihydrate is soluble in water and can be used as a solid dispersion. This compound has been shown to have significant interactions with other drugs, including polymeric matrix, protocatechuic acid, and α-amyrin acetate. It also has been shown to have cell culture and in vivo model evidence of efficacy against cancer cells.</p>Purity:Min. 95%1-(3-Chloro-2-methylphenyl)-5-oxopyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about 1-(3-Chloro-2-methylphenyl)-5-oxopyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H12ClNO3Purity:Min. 95%Molecular weight:253.68 g/molPhenobarbital-1-butyric acid
CAS:Controlled Product<p>Please enquire for more information about Phenobarbital-1-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N2O5Purity:Min. 95%Molecular weight:318.32 g/molFmoc-(4-aminomethyl) benzoic acid
CAS:<p>Please enquire for more information about Fmoc-(4-aminomethyl) benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H19NO4Purity:Min. 95%Molecular weight:373.4 g/molButyl acetate
CAS:<p>Butyl acetate is a reactive solvent that has been used in wastewater treatment. It has also been proposed as an analytical method for the determination of the concentration of butyl ester in mixtures. In this technique, a constant pressure is maintained until the butyl ester is released from the sample matrix and enters into a gas phase. The gas phase is then drawn into a solid-phase microextraction (SPME) fiber and analyzed by gas chromatography/mass spectrometry. Butyl acetate has limited solubility in water, which limits its practical use as a solvent. However, it can be mixed with other solvents such as ethanoate or n-butyl acetate to produce solutions that are more easily soluble in water. The structural analysis of butyl acetate was carried out using infrared spectroscopy and nuclear magnetic resonance (NMR).</p>Formula:C6H12O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:116.16 g/molEthyl 1-N-Boc-3-oxopiperidine-4-carboxylate
CAS:<p>Please enquire for more information about Ethyl 1-N-Boc-3-oxopiperidine-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H21NO5Purity:Min. 95%Molecular weight:271.31 g/mol3,7-Dihydroxy-5-cholestenoic acid
CAS:Controlled Product<p>Please enquire for more information about 3,7-Dihydroxy-5-cholestenoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H44O4Purity:Min. 95%Molecular weight:432.64 g/molChloroacetic Acid-13C2
CAS:<p>Please enquire for more information about Chloroacetic Acid-13C2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%1-[2-(5-Methoxy-1H-indol-3-yl)ethyl]-5-oxopyrrolidine-3-carboxylic acid
CAS:Controlled Product<p>Please enquire for more information about 1-[2-(5-Methoxy-1H-indol-3-yl)ethyl]-5-oxopyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N2O4Purity:Min. 95%Molecular weight:302.33 g/mol2-(Benzofuran-2-yl)acetic acid
CAS:<p>2-(Benzofuran-2-yl)acetic acid is a glp-1 analogue that has been shown to inhibit fatty acid synthesis in the test tube. It has also shown an inhibitory effect on cardiac arrhythmia and chloride ion channel activity, which may be due to the dipole nature of its structure. 2-(Benzofuran-2-yl)acetic acid is not active against microbial infections. The chemical compound is a tautomer of 2-[(benzofuran-2-yl)amino]acetic acid.</p>Purity:Min. 95%D-Lactic acid lithium
CAS:<p>D(+)-Lactic acid lithium salt is a dipolar molecule with an activation energy of about 44 kJ/mol. It has been studied by NMR techniques and found to have a resonance in the range of 1.8-2.0 ppm, which is characteristic of protons on the oxygen atom. The proton magnetic resonance (PMR) study showed that the d-lactate resonances were very broad and shifted to higher frequencies, whereas the l-lactate resonances were sharp and shifted to lower frequencies. This may be due to the different number of protons on each type of lactate molecule. The magnetic resonance (NMR) study showed that lithium salt was a radical with a spin density distribution around 2.6 ppm in the nmr spectrum.</p>Formula:C3H6O3•LiPurity:Min. 95%Color and Shape:PowderMolecular weight:97.02 g/molMurideoxycholic acid
CAS:Controlled Product<p>Murideoxycholic acid is a bile acid that is used in combination with other antibiotics to treat infections caused by bacteria. Murideoxycholic acid inhibits the bacterial transport of bile acids, which are important for the digestion of fats and proteins. Murideoxycholic acid binds to the cytochrome P450 enzyme in humans and rats, inhibiting its activity. This binding prevents the production of bile acids from cholesterol in the liver, which prevents their normal excretion into the intestine and leads to an increased risk for gallstones. Murideoxycholic acid also has been shown to inhibit human CYP3A4 enzyme activity. The hydroxyl group on this molecule reacts with ferrous ions to produce hydroxyl radicals, which can lead to oxidative stress and lipid peroxidation.</p>Formula:C24H40O4Purity:Min. 95%Molecular weight:392.57 g/mol4-(Trifluoromethoxy)phenylboronic Acid (contains varying amounts of Anhydride)
CAS:<p>4-(Trifluoromethoxy)phenylboronic acid is a boron-containing compound that has been shown to be a potent inhibitor of the histone deacetylase (HDAC) enzyme. It also has surfactant properties and can be used as a photochemical reagent. 4-(Trifluoromethoxy)phenylboronic acid is orally bioavailable and may have therapeutic potential for neurodegenerative diseases, such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. It also has the ability to inhibit cancer cell growth by inhibiting HDAC activity. This drug has been found to cross-couple with organosilicon compounds in order to form new compounds with potent inhibitory activity against HDAC enzymes.</p>Formula:C7H6BF3O3Purity:Min. 95%Molecular weight:205.93 g/molD-Glutamic acid α-amide
CAS:<p>D-Glutamic acid alpha-amide is a carbohydrate that has been shown to have antibiotic properties. It can be produced by chemoenzymatic synthesis and is used as an animal feed additive. D-Glutamic acid alpha-amide is a conjugate of D-glutamic acid with either glycine or beta-alanine. The residue of this compound on red blood cells is measured in order to assess the amount of D-glutamic acid alpha-amide that has been ingested. This compound has also been shown to have antigenic properties, which can elicit immune responses when injected into animals. The meningococcal vaccine that contains D-glutamic acid alpha-amide was found to be effective at stimulating an immune response in mice against meningitis caused by gram negative species, such as Neisseria meningitidis.</p>Formula:C5H10N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:146.14 g/mol1-(4-Fluorophenyl)-3-phenyl-1H-pyrazole-5-carboxylic acid
CAS:Controlled Product<p>Please enquire for more information about 1-(4-Fluorophenyl)-3-phenyl-1H-pyrazole-5-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H11FN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:282.27 g/mol1-Trifluoromethylcyclopropane-1-carboxylic acid
CAS:<p>1-Trifluoromethylcyclopropane-1-carboxylic acid is a ketone that is used in research in organic chemistry for the preparation of imidazole. It can be prepared by the transformation of ethyl 2-(trifluoromethyl)acrylate, and is also obtained from 1,4-dichloroacetone. 1-Trifluoromethylcyclopropane carboxylic acid has been shown to have some medicinal properties. It has been used in research on cancer cells and as an anti-inflammatory agent. The compound has a steric effect on the body and can be used as a weight loss drug, with one kilogram of 1-Trifluoromethylcyclopropane carboxylic acid being equivalent to 3 kilograms of weight loss.</p>Formula:C5H5F3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:154.09 g/molBoc-L-aspartic acid a-9-fluorenylmethyl ester
CAS:<p>Boc-L-aspartic acid a-9-fluorenylmethyl ester is a synthetic compound that mimics the structure of acetylcholine. It has been shown to be an efficient method for generating pseudopeptides and cyclic peptides. This compound may be used as a surrogate for acetylcholine in virus research, since it can bind to the same receptor. Boc-L-aspartic acid a-9-fluorenylmethyl ester has also been used to generate monoclonal antibodies that are neutralizing against foot-and-mouth disease viruses.</p>Formula:C23H25NO6Purity:Min. 97 Area-%Molecular weight:411.45 g/mol5-Methyl-1H-pyrrole-3-carboxylic acid
CAS:<p>Please enquire for more information about 5-Methyl-1H-pyrrole-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7NO2Purity:Min. 95%Molecular weight:125.13 g/mol6-Oxo norethindrone acetate
CAS:<p>Please enquire for more information about 6-Oxo norethindrone acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H26O4Purity:Min. 95%Molecular weight:354.44 g/molAluminum diacetate hydroxide
CAS:<p>Aluminum diacetate hydroxide is a white powder that is soluble in water. It is used as a laser ablation material and can be used to seal chemical reactions. Aluminum diacetate hydroxide also functions as a gas sensor, with its sensitivity to aromatic hydrocarbons and fatty acids. This compound has clinical use in detergent compositions, where it prevents the formation of foam.</p>Formula:C4H7AlO5Purity:Min. 28%Color and Shape:PowderMolecular weight:162.08 g/molb-Glycerophosphoric acid disodium salt tetrahydrate
CAS:<p>Glycerolipid metabolism component</p>Formula:C3H7O6P·2Na·4H2OPurity:Min. 95%Molecular weight:288.1 g/mol4-(Hydroxymethyl)phenylboronic acid
CAS:<p>4-(Hydroxymethyl)phenylboronic acid is an organic compound that has been identified as a reactive, fatty acid. It has shown antibacterial efficacy against gram-positive and gram-negative bacteria in the presence of nanogels. 4-(Hydroxymethyl)phenylboronic acid is also a cross-linking agent that can be used to form hydrogels for tissue engineering applications. This chemical is being studied as a potential treatment for inflammatory bowel disease and diabetes mellitus. 4-(Hydroxymethyl)phenylboronic acid has been shown to have anti-cancer properties by inhibiting the proliferation of cancer cells and inducing apoptosis. The molecule also undergoes structural analysis using confocal microscopy.</p>Formula:C7H9BO3Molecular weight:151.96 g/molEthanesulfonic acid
CAS:<p>Ethanesulfonic acid is a free radical scavenger that has been shown to have anti-inflammatory properties. It also has the ability to inhibit lipid peroxidation and prevent the formation of reactive oxygen species in biological samples. Ethanesulfonic acid is used as a solvent for liposomal formulations, which are drugs enclosed in a phospholipid film. Liposomal formulations have been shown to be useful for the treatment of bowel diseases such as inflammatory bowel disease. Ethanesulfonic acid may also be used in treating autoimmune diseases, cancer, influenza virus, and guanine nucleotide-binding proteins.</p>Formula:C2H6O3SPurity:Min. 95%Color and Shape:Colourless To Yellow To Brown LiquidMolecular weight:110.13 g/mol(2S, 3S)-3-(Ethoxycarbonyl)-oxirane-2-carboxylic acid
CAS:<p>Please enquire for more information about (2S, 3S)-3-(Ethoxycarbonyl)-oxirane-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H8O5Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:160.12 g/mol[2-(3,4-Dimethoxyphenyl)-1,3-thiazol-4-yl]acetic acid
CAS:<p>Please enquire for more information about [2-(3,4-Dimethoxyphenyl)-1,3-thiazol-4-yl]acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H13NO4SPurity:Min. 95%Molecular weight:279.31 g/molBoc-tranexamic acid
CAS:<p>Tranexamic acid is a non-protein amino acid that is used to reduce the risk of blood loss in surgical procedures. It is an inhibitor of plasmin, which is an enzyme that breaks down clots and fibrin. Tranexamic acid binds to the active site of plasmin and blocks its activity, preventing the breakdown of fibrin clots. Tranexamic acid has been shown to be selective for plasmin, as other enzymes such as urokinase are not blocked by this drug. The picolyl group on tranexamic acid interacts with the benzyl group on plasmin and this interaction may be responsible for the selectivity of tranexamic acid for plasmin over other enzymes.</p>Purity:Min. 95%Behenic acid
CAS:<p>Behenic acid is a fatty acid that has been used as a fluorescence probe for the detection of water vapor. It has shown to have antibacterial efficacy against bacteria including Acinetobacter baumannii, Staphylococcus aureus, and Pseudomonas aeruginosa. Behenic acid is also known to inhibit the synthesis of fatty acids in rat liver microsomes and to have biological properties such as the ability to induce hepatic steatosis. This fatty acid is found in some lichens and can be purified from them using an analytical method involving constant-pressure liquid chromatography. Behenic acid is also found in behen oil, which is produced by pressing nuts from the seed of the beech tree.</p>Formula:C22H44O2Purity:Min. 83 Area-%Color and Shape:PowderMolecular weight:340.58 g/moltert-Butyl 4-(2-oxo-2,4-dihydro-1H-benzo[d][1,3]oxazin-1-yl)piperidine-1-carboxylate
CAS:Controlled Product<p>Please enquire for more information about tert-Butyl 4-(2-oxo-2,4-dihydro-1H-benzo[d][1,3]oxazin-1-yl)piperidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%1-(4-Fluorophenyl)-5-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-(4-Fluorophenyl)-5-methyl-1H-pyrazole-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H9FN2O2Purity:Min. 95%Molecular weight:220.2 g/mol3,6-Dioxaoctanedioic acid
CAS:<p>3,6-Dioxaoctanedioic acid is a functional group that can be found in nature and has been studied for its potential to inhibit cancer cell growth. 3,6-Dioxaoctanedioic acid is a magnesium salt that is used as an experimental drug to treat bronchial asthma. It works by interfering with the function of serine protease enzymes. In addition, this compound has been shown to have particle size and transport properties that are suitable for inhalation therapy. These properties make it an effective drug for treatment of respiratory diseases such as asthma or chronic obstructive pulmonary disease.</p>Formula:C6H10O6Purity:90%MinMolecular weight:178.14 g/mol3-Hydroxymandelic acid
CAS:<p>3-Hydroxymandelic acid is a metabolite of mandelic acid and has been found to have cytostatic effects in human cells. The concentration–time curve for 3-hydroxymandelic acid displays a single-dose pharmacokinetics. It has been shown to inhibit the nuclear factor kappa-light-chain enhancer (NFκB) pathway, which is involved in the regulation of cell proliferation, differentiation, and apoptosis. 3-Hydroxymandelic acid also inhibits energy metabolism by reducing mitochondrial respiration. This compound binds to plasma proteins and is excreted through urine as well as being oxidized by hepatic cytochrome P450 enzymes.</p>Formula:C8H8O4Purity:Min. 95%Molecular weight:168.15 g/molOxaloacetic acid-13C4
CAS:<p>A labelled form of the oxalacetic acid (FO12113).</p>Formula:C4H4O5Purity:Min. 95%Molecular weight:136.04 g/mol6-Methylnicotinic acid
CAS:<p>6-Methylnicotinic acid is the major metabolite of nicotine, which is a natural alkaloid. The formation of 6-methylnicotinic acid from nicotine in the body is induced by carbon sources such as glucose and sucrose. This compound has been shown to inhibit herpes simplex virus type 1 replication in tissue culture and animal experiments. 6-Methylnicotinic acid also has an effect on the reaction rate of 2-chloro-6-methylnicotinic acid with hydrogen gas, forming methyl nicotinate, which is an organic acid found in tobacco leaves. 6-Methylnicotinic acid is hydrophilic and can be separated from other compounds using hydrophilic interaction chromatography (HIC).</p>Formula:C7H7NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:137.14 g/molEthyl 7-Methoxy-1H-Indazole-3-Carboxylate
CAS:Controlled Product<p>Please enquire for more information about Ethyl 7-Methoxy-1H-Indazole-3-Carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12N2O3Purity:Min. 95%Molecular weight:220.22 g/mol1,5-Diphenyl-1H-pyrazole-3-carboxylic acid
CAS:Controlled Product<p>1,5-Diphenyl-1H-pyrazole-3-carboxylic acid is a herbicide that belongs to the family of alkyloxycarbonyl amides. It is used in weed control and has shown good activity against many broadleaf weeds. 1,5-Diphenyl-1H-pyrazole-3-carboxylic acid inhibits the growth of plants by interfering with photosynthesis and the production of chlorophyll. The compound binds to the thylakoid membrane in chloroplasts, preventing electron transport and blocking the synthesis of carbohydrates from carbon dioxide and water. This leads to cell death as a result of oxygen depletion. 1,5-Diphenyl-1H-pyrazole-3-carboxylic acid also inhibits acetolactate synthase in plants, which produces amides that are important for protein synthesis.</p>Formula:C16H12N2O2Purity:Min. 95%Molecular weight:264.28 g/mol5-Hydroxyisophthalic acid
CAS:<p>5-Hydroxyisophthalic acid is a dicarboxylic acid that has one hydroxyl group. It is an odorless, colorless solid that is soluble in water and ether. 5-Hydroxyisophthalic acid has been found to be a good thermal expansion agent for polypropylene and polyethylene, due to its intermolecular hydrogen bonding ability. This compound also has the ability to form diphenyl ethers with carboxylates, which are used as stabilizers in PVC. 5-Hydoxyisophthalic acid is not very reactive and can be used as a neutral pH stabilizer in alkaline solutions. Hydrogen bonds between 5-hydroxyisophthalic acid molecules allow it to form complexes with sodium salts, such as sodium thiosulfate or sodium nitrite. The coordination geometry of the molecule also allows for hydrogen bonding interactions with other neutral molecules, such as p-hydroxybenzoic acid</p>Formula:C8H6O5Purity:Min. 95%Molecular weight:182.13 g/molPerfluorophenyl 1-Benzyl-1H-Imidazole-4-Carboxylate
CAS:Controlled Product<p>Please enquire for more information about Perfluorophenyl 1-Benzyl-1H-Imidazole-4-Carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H9F5N2O2Purity:Min. 95%Molecular weight:368.26 g/molCyclo(-Arg-Gly-Asp-D-Phe-Cys) acetate salt
CAS:<p>Cyclo(-Arg-Gly-Asp-D-Phe-Cys) acetate salt is a peptide that has been modified to be an active targeting agent. It is an amphipathic molecule that can be used to deliver therapeutic agents specifically to cancer cells. Cyclo(-Arg-Gly-Asp-D-Phe-Cys) acetate salt is conjugated to a drug and is taken up by cells through the process of endocytosis. Once inside the cell, the drug is released and binds with the cell membrane, which leads to cell death. The uptake of this peptide has been shown to be pH dependent; it is taken up more readily in acidic environments than in neutral or alkaline environments. This peptide has also been shown to have cytotoxic effects on both MFC7 cells and rat liver cells.</p>Formula:C24H34N8O7SPurity:Min. 95%Molecular weight:578.64 g/mol5-Methyl-4,5,6,7-tetrahydrothiazolo[5,4-c]pyridine-2-carboxylic acid hydrochloride
CAS:<p>Intermediate in the synthesis of edoxaban</p>Formula:C8H10N2O2S·HClPurity:Min. 95%Molecular weight:234.7 g/mol1-(tert-Butoxycarbonyl)-4-methylpiperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-(tert-Butoxycarbonyl)-4-methylpiperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO4Purity:Min. 95%Molecular weight:243.3 g/mol1-[2-(1H-Indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3-carboxylic acid
CAS:Controlled Product<p>Please enquire for more information about 1-[2-(1H-Indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H18N2O2Purity:Min. 95%Molecular weight:282.34 g/molPiperidinium acetate
CAS:Controlled Product<p>Piperidinium acetate is a photochemical agent that has been used in the photochemical oxidation of organic compounds. It is also used as a catalyst for the oxidative coupling of piperidinium salts with sodium salts to form piperidine. Piperidinium acetate can be used for the treatment of metabolic disorders, such as lactic acidosis and hyperglycemia, and autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus. This compound is also known to cause allergic symptoms and anhydrous sodium may be generated in the process.</p>Formula:C5H11N·C2H4O2Purity:Min. 95%Color and Shape:PowderMolecular weight:145.20 g/mol(2,4-Dioxo-1,4-dihydroquinazolin-3(2H)-yl)acetic acid
CAS:<p>Please enquire for more information about (2,4-Dioxo-1,4-dihydroquinazolin-3(2H)-yl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H8N2O4Purity:Min. 95%Molecular weight:220.18 g/mol2-[4-(tert-Butyldimethylsilyloxymethyl)-2-nitrophenoxy]acetic Acid
CAS:<p>Please enquire for more information about 2-[4-(tert-Butyldimethylsilyloxymethyl)-2-nitrophenoxy]acetic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23NO6SiPurity:Min. 95%Molecular weight:341.43 g/mol4-Bromo-2-fluorobenzoic acid methyl ester
CAS:<p>4-Bromo-2-fluorobenzoic acid methyl ester is a synthetic chemical that is used as a drug substance in the synthesis of pharmaceuticals. It is also a reagent for organic synthesis, specifically cross coupling reactions. 4-Bromo-2-fluorobenzoic acid methyl ester can be used to introduce an alkyl group into a molecule, which can then be used in other synthetic reactions. This chemical has been shown to inhibit prolyl hydroxylase (PHD), which is an enzyme that catalyzes the conversion of proline to hydroxyproline. 4-Bromo-2-fluorobenzoic acid methyl ester also inhibits the Bcl-2 family proteins, including bcl2, bclxl and bax, which are known to play a role in apoptosis. 4-Bromo-2-fluorobenzoic acid methyl ester</p>Formula:C8H6BrFO2Purity:Min. 95%Molecular weight:233.03 g/mol4-Cyano-2-methylphenylboronic acid, pinacol ester
CAS:<p>Please enquire for more information about 4-Cyano-2-methylphenylboronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18BNO2Purity:Min. 95%Molecular weight:243.11 g/molBenzyl 4-hydroxy-1-piperidinecarboxylate
CAS:<p>Benzyl 4-hydroxy-1-piperidinecarboxylate is a poison that belongs to the group of benzyl ethers. It is an aliphatic, nitrogen-containing compound with a hydrogenolysis mechanism. Benzyl 4-hydroxy-1-piperidinecarboxylate can be used as a catalyst for hydrogenation reactions and has been shown to have chemoselective properties.</p>Formula:C13H17NO3Purity:Min. 95%Molecular weight:235.28 g/mol3-Cyanoethylbenzoic acid
CAS:<p>3-Cyanoethylbenzoic acid is an anthropogenic compound that is produced by the Friedel-Crafts reaction between benzoyl chloride and acrylonitrile in the presence of a base. 3-Cyanoethylbenzoic acid is used as a solvent for chromatographic methods, such as gradient elution, ion exchange, and reversed phase. 3-Cyanoethylbenzoic acid has been used to determine the optical purity of benzoate salts and amides. This compound can be taken orally in solid oral dosage form or enterically in liquid oral dosage form. 3-Cyanoethylbenzoic acid interacts with other drugs that are metabolized by CYP3A4, such as erythromycin, to produce an active metabolite (N-desmethyldesipramide).</p>Formula:C10H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:175.18 g/mol4-Diazobenzenesulfonic Acid
CAS:<p>Applications 4-Diazobenzenesulfonic acid (cas# 305-80-6) is a useful research chemical.<br></p>Formula:C6H4N2O3SMolecular weight:184.172-Iodo-5-methoxybenzoic acid
CAS:<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>Formula:C8H7IO3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.04 g/mol(Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate
CAS:Controlled Product<p>Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt is a long acting analog of LHRH. It is a biocompatible polymeric drug that has been shown to have long term efficacy in treating various autoimmune diseases and infections. The drug's efficacy may be due to its ability to bind to the specific receptors on the surface of cells that are involved in the immune response. DesGly10,D-His(Bzl)6,ProNHEt9)-LHRH acetate salt Pyr His Trp Ser Tyr D His(Bzl)-Leu Arg Pro NHEt acetate salt is an analog of LHRH and has been shown to be effective in treating cancer and allergic symptoms as well.</p>Formula:C66H86N18O12•(C2H4O2)xPurity:Min. 95%Molecular weight:1,323.5 g/molOxindole-4-boronic acid, pinacol ester
CAS:<p>Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18BNO3Purity:Min. 95%Molecular weight:259.11 g/molMca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H105N19O19SPurity:Min. 95%Molecular weight:1,656.86 g/mol4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H33BN2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:388.31 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>Formula:C75H110N24O16S2Purity:Min. 95%Molecular weight:1,667.96 g/mol2-Mercaptonicotinic acid
CAS:<p>2-Mercaptonicotinic acid (2MNA) is an inhibitor of the P-glycoprotein, which is a multidrug resistance-associated protein. It prevents the transport of drugs and other molecules across the cell membrane. 2MNA has been shown to inhibit cancer cells in cervical cancer studies, and has been proven to reduce the toxicity of chemotherapy drugs in rats. 2MNA binds to p-glycoprotein and inhibits its function by forming a disulfide bond with cysteine residues on the transporter. 2MNA also has toxic effects on human serum and may be hazardous for use as a therapeutic agent.</p>Formula:C6H5NO2SPurity:Min. 95%Molecular weight:155.18 g/molCortistatin-29 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C161H240N46O41S2Purity:Min. 95%Molecular weight:3,540.05 g/molAPL1b25 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b25 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H166N28O35SPurity:Min. 95%Molecular weight:2,328.6 g/molPancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Pancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H287N55O53SPurity:Min. 95%Molecular weight:4,209.71 g/mol16-Hydroxyhexadecanoic acid
CAS:<p>16-Hydroxyhexadecanoic acid is a fatty acid that contains 16 carbons and 2 hydroxyl groups. It can be found in rat liver microsomes, where it binds to the cytochrome P450 enzyme, inhibiting its activity. The structural analysis of this compound has been shown to have intermolecular hydrogen bonding between the nitrogen atoms and the oxygen atoms in the hydroxyl group. 16-Hydroxyhexadecanoic acid also exhibits phase transition temperatures, which are increased by adding water molecules. This compound also has an inhibitory effect on recombinant cytochrome P450 enzymes from p. pastoris and can be used as a substrate for methyl myristate metabolism. In addition, 16-hydroxyhexadecanoic acid binds to dinucleotide phosphate (NADPH) and fluoresces when excited at 340 nm using a fluorescence detector.</p>Formula:C16H32O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:272.42 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molConjugated linoleic acid - liquid
CAS:<p>Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)</p>Formula:C18H32O2Purity:Min. 95%Color and Shape:Slightly Yellow Clear LiquidMolecular weight:280.45 g/mol12-Doxyl stearic acid
CAS:<p>12-Doxyl stearic acid is a fatty acid that inhibits the vasoactive intestinal peptide (VIP). The inhibitory effect of 12-Doxyl stearic acid on VIP was demonstrated by incubating the cells with this fatty acid and measuring the change in mitochondrial Ca2+ concentration. This inhibition was shown to be due to the inhibition of fatty acids and not an effect on Ca2+ ion channels. Fatty acids are important for normal cellular function, such as maintaining membrane fluidity and aiding in signal transduction. 12-Doxyl stearic acid has been shown to inhibit the production of cardiac fatty acids and may be useful in treating cardiac disorders. 12-Doxyl stearic acid also has a fluorescence probe that can be used to study how cells react to different conditions, such as changes in water vapor or pH levels.</p>Formula:C22H42NO4Purity:Min. 95%Color and Shape:Yellow Clear LiquidMolecular weight:384.57 g/molγ-Polyglutamic acid sodium - MW 800-1500
CAS:<p>Polymer of glutamic acid</p>Formula:(C5H9NO3)nPurity:Min. 95%Color and Shape:PowderEthylenediaminetetraacetic acid tripotassium salt dihydrate
CAS:<p>Ethylenediaminetetraacetic acid tripotassium salt dihydrate is an anticoagulant that can be used as a coagulant for blood samples. It is often used in polymerase chain reactions to synthesize DNA, or to isolate and purify genomic DNA. This compound has ferroelectric properties and can be used as a target cell in optical imaging applications. Ethylenediaminetetraacetic acid tripotassium salt dihydrate is also used in the production of polyurethanes and as a polymerization inhibitor in cinnamon oil.</p>Formula:C10H13K3N2O8·2H2OPurity:Min. 95%Molecular weight:442.54 g/mol2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid
CAS:<p>2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid (DMTA) is a versatile building block that can be used in the synthesis of a wide variety of compounds. DMTA is an important intermediate for the synthesis of complex molecules and is a useful scaffold for drug development. It has been shown to be an effective reagent for the synthesis of 2,4,6-trinitrobenzenesulfonic acid as well as other useful compounds. DMTA also has high quality and purity with CAS No. 462100-06-7 and is a speciality chemical.</p>Formula:C13H25NO7Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:307.34 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molAzilsartan medoxomil
CAS:<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>Formula:C30H24N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:568.53 g/molH-Gly-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O2·C2H4O2Purity:Min. 95%Molecular weight:281.31 g/molMating Factor a trifluoroacetate salt
CAS:<p>Please enquire for more information about Mating Factor a trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H114N20O17S·xC2HF3O2Purity:Min. 95%Molecular weight:1,683.97 g/molH-DL-Val-Leu-Arg-pNA acetate salt
CAS:<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>Formula:C23H38N8O5Purity:Min. 95%Molecular weight:506.6 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molHIV (gp120) Antigenic Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H211N41O31SPurity:Min. 95%Molecular weight:2,720.25 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/molBNP-32 (rat) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C146H239N47O44S3Purity:Min. 95%Molecular weight:3,452.95 g/mol(Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H158N32O23S2Purity:Min. 95%Molecular weight:2,192.62 g/molAlarin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C119H199N45O35Purity:Min. 95%Molecular weight:2,820.14 g/molBenzimidazole-5-carboxylic acid
CAS:<p>Benzimidazole-5-carboxylic acid is a monoclonal antibody that binds to the amide group of an amino acid. It has been shown to be a potent inhibitor of cell growth in cervical cancer cells and rat liver microsomes. It also showed inhibitory activity against fatty acid and nucleotide synthesis. Benzimidazole-5-carboxylic acid is a benzimidazole compound that has been shown to have anti-inflammatory effects in animal models and also inhibits the replication of HIV. This drug can inhibit the replication of influenza A virus in vitro and may be useful as an antiviral agent for treatment of influenza A infection.</p>Formula:C8H6N2O2Purity:Min. 98%Color and Shape:PowderMolecular weight:162.15 g/molMca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H110N22O20Purity:Min. 95%Molecular weight:1,675.84 g/mol4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid
CAS:<p>4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.</p>Formula:C9H9BrN2O3Purity:(Elemental Analysis) Min. 97%Color and Shape:PowderMolecular weight:273.08 g/molEthyl 2-((tert-butoxycarbonylamino)methyl)thiazole-4-carboxylate
CAS:<p>Please enquire for more information about Ethyl 2-((tert-butoxycarbonylamino)methyl)thiazole-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H18N2O4SPurity:Min. 95%Molecular weight:286.35 g/mol

