
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
4-Fluorophenoxyacetic acid
CAS:<p>4-Fluorophenoxyacetic acid is a chemical compound that is used as an insecticide. It has been shown to be effective against the planthopper and ipomoea, two agricultural pests. 4-Fluorophenoxyacetic acid binds to the active site of a specific protein in the insect's cells, inhibiting its function and causing cell death. 4-Fluorophenoxyacetic acid also inhibits the growth of human breast cancer cells in culture. The molecular weight of this compound is 180.2 g/mol and has a melting point of 185°C with a boiling point of 232°C at atmospheric pressure. 4-Fluorophenoxyacetic acid can be synthesized by reacting phenol with acetic anhydride in the presence of palladium complexes and nitrogen atoms. The reaction mechanism for this synthesis is nucleophilic addition to form a covalent bond between the nitrogen atom and sulfur atom on one side of the</p>Formula:C8H7FO3Purity:Min. 95%Color and Shape:PowderMolecular weight:170.14 g/molGastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C214H324N58O63SPurity:Min. 95%Molecular weight:4,749.28 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/mol5-Bromo-2-fluorobenzoic acid
CAS:<p>5-Bromo-2-fluorobenzoic acid is a potential drug that can be used to treat diseases such as malaria. It is also used in the synthesis of fluorine compounds, such as fluoroarenes. 5-Bromo-2-fluorobenzoic acid is activated by deprotonation with butyllithium and reacts with chlorine to give the product of 5-bromo-2-chlorobenzoic acid. The reagent chlorotrimethylsilane may also be used for this reaction. Substitution of fluorine for chlorine at the 2 position yields the desired product, 5-bromo-2-(trifluoromethyl)benzoic acid. This compound is a useful intermediate for making other drugs, including those that are important for treating cancer and viral infections.</p>Formula:C7H4BrFO2Purity:Min. 95%Color and Shape:PowderMolecular weight:219.01 g/mol3-Cyano-2-methylphenylboronic acid
CAS:<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>Formula:C8H8BNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:160.97 g/molOxalic acid dihydrate
CAS:<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br>br> Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>Formula:C2H2O4•(H2O)2Purity:Min. 95%Molecular weight:126.07 g/molEthylenediaminetetraacetic acid tripotassium salt dihydrate
CAS:<p>Ethylenediaminetetraacetic acid tripotassium salt dihydrate is an anticoagulant that can be used as a coagulant for blood samples. It is often used in polymerase chain reactions to synthesize DNA, or to isolate and purify genomic DNA. This compound has ferroelectric properties and can be used as a target cell in optical imaging applications. Ethylenediaminetetraacetic acid tripotassium salt dihydrate is also used in the production of polyurethanes and as a polymerization inhibitor in cinnamon oil.</p>Formula:C10H13K3N2O8·2H2OPurity:Min. 95%Molecular weight:442.54 g/molCortistatin-17 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H139N27O24S3Purity:Min. 95%Molecular weight:2,151.5 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/mol5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester
CAS:<p>Please enquire for more information about 5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H7F3N2O2Purity:Min. 95%Molecular weight:208.14 g/mol3-Methylbenzofuran-2-carboxylic acid
CAS:<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:176.17 g/molAmyloid β-Protein (1-42) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-42) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O60SPurity:Min. 95%Molecular weight:4,514.04 g/molMethyl-N,N-diethyldithiocarbamate
CAS:<p>Methyl-N,N-diethyldithiocarbamate is a copper complex that reacts with nitrogen atoms to form a stable chemical species. It has been shown to have cancer-fighting properties and is used in the treatment of liver cancer. Methyl-N,N-diethyldithiocarbamate also acts as an anti-inflammatory agent. The mechanism of action of methyl-N,N-diethyldithiocarbamate is not fully understood, but it has been suggested that this compound binds to p450 enzymes and inhibits their activity. This drug may also inhibit the production of carbon disulphide (CS2) by the liver microsomes and the elimination rate of methyl-N,N-diethyldithiocarbamate from rat livers.</p>Formula:C6H13NS2Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:163.31 g/molNeurokinin A trifluoroacetate salt
CAS:<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>Formula:C50H80N14O14SPurity:Min. 95%Molecular weight:1,133.32 g/molEthoxyiminoacetic acid ethyl ester
CAS:<p>Ethoxyiminoacetic acid ethyl ester is an annulated, lactam-containing compound that is synthesized via the condensation of ethyl thiooxamate and carboxylic acid. This drug has been shown to be efficient in inhibiting the growth of bacteria that are resistant to antibiotics such as polycyclic, triazoles, and condensates. It also inhibits protein synthesis by binding to bacterial DNA gyrase and topoisomerase IV. Ethoxyiminoacetic acid ethyl ester has shown significant antimicrobial activity against Gram-positive bacteria such as streptococci and staphylococci.</p>Formula:C6H11NO3Purity:Min. 95%Molecular weight:145.16 g/molBiotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C137H217N47O41S4Purity:Min. 95%Molecular weight:3,306.75 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate
CAS:<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>Formula:C109H159N25O32S5•(C2H4O2)xPurity:Min. 95%Molecular weight:2,491.91 g/molTri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate
CAS:<p>Tri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate (TBA) is a gadolinium chelate that is used as a contrast agent in magnetic resonance imaging. TBA binds to the malignant cells and shows an increase in uptake of the gadolinium contrast agent. TBA has been shown to be effective in the diagnosis of cancerous brain tissue and is also able to detect cancer cells in animals. TBA has shown some efficacy against bacterial infection by binding to the cell membrane and inhibiting protein synthesis. It is also able to act synergistically with antibiotics such as penicillin or ampicillin to kill bacteria more effectively.</p>Formula:C28H52N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:572.73 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/moltert-Butyl carbamate
CAS:<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>Formula:C5H11NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:117.15 g/molOsteoblast Activating Peptide (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37Purity:Min. 95%Molecular weight:2,763.07 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/molAmyloid β-Protein (11-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H244N40O42SPurity:Min. 95%Molecular weight:3,335.87 g/mol3-Amino-4-hydroxybenzoic acid hydrochloride
CAS:<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>Formula:C7H8ClNO3Purity:Min. 95%Molecular weight:189.6 g/molThr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
CAS:<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>Formula:C145H234N52O44S3Purity:Min. 95%Molecular weight:3,505.93 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/mol7-Hydroxynaphthalene-1-sulfonic acid
CAS:<p>7-Hydroxynaphthalene-1-sulfonic acid is a chemical compound with the formula HNSO. It is an organic compound and a proton acceptor. The conjugate base of 7-hydroxynaphthalene-1-sulfonic acid has a strong absorption band in the ultraviolet region. In DMF solution, the reaction of 7-hydroxynaphthalene-1-sulfonic acid with formamide, hydroxy, and nitrogen atoms produces a product that has been characterized by photoexcitation and kinetic studies. The proton transfer process from formamide to 7-hydroxynaphthalene-1-sulfonic acid was found to be exponential and followed first order kinetics. The protonation constant for this process was determined to be 8.4 x 10 M/equivalent. 7HNSO can also act as an electron acceptor in dimethylsulphoxide (DMSO) solution</p>Purity:Min. 95%Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H42N10O7Purity:Min. 95%Molecular weight:618.69 g/molBiotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C148H223N43O42S3Purity:Min. 95%Molecular weight:3,372.82 g/molGalanin (2-11) amide trifluoroacetate salt
CAS:<p>Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu is a galanin analog and a ligand for the galanin receptor 1. It has affinity for the receptors in the brain, which are involved in cognition, and is used to study Alzheimer's disease. Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser -Ala -Gly -Tyr -Leu -Leu is a member of the family of neuropeptides and neuromodulators that regulate nerve injury and alzheimer's disease.</p>Formula:C54H81N13O14Purity:Min. 95%Molecular weight:1,136.3 g/mol3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid
CAS:<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>Formula:C12H12O4F2Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:258.22 g/mol(D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H79N13O12Purity:Min. 95%Molecular weight:1,210.38 g/molH-D-Pro-Pro-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Pro-Pro-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/mol2-Chlorooxazole-4-carboxylicacid
CAS:<p>2-Chlorooxazole-4-carboxylic acid is a synthetic compound belonging to the group of long-chain aliphatic carboxylic acids. It is an ester that can be synthesized by the reaction of toluene with 2,4-dichlorooxazole. The stereochemical configuration of this molecule is unknown. The synthesis of this compound has been reported in marine invertebrates and plants, including Mycalolide from the marine sponge Mycale sp.</p>Formula:C4H2ClNO3Purity:Min. 95%Molecular weight:147.52 g/molDibenzoyl-(-)-p-methoxy-L-tartaric acid
CAS:<p>Dibenzoyl-(-)-p-methoxy-L-tartaric acid is a chiral compound that has been extracted from plants and synthesized. It has a bitter taste and can be used as an enantiomer to treat schistosomiasis, a disease caused by parasitic flatworms. Dibenzoyl-(-)-p-methoxy-L-tartaric acid can be used as an enantiomer to treat schistosomiasis, which is caused by parasitic flatworms. The chemical is an anionic β-cyclodextrin derivative that binds to the parasites in the host's body and prevents them from releasing eggs into the water supply. This chemical also has pharmacological properties, such as antiinflammatory activities.</p>Formula:C20H18O10Purity:Min. 95%Color and Shape:White PowderMolecular weight:418.35 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H78N14O19Purity:Min. 95%Molecular weight:1,179.24 g/molMethyl 2-bromo-2-(4-chlorophenyl)acetate
CAS:<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>Formula:C9H8BrClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:263.52 g/molChromone-2-carboxylic acid
CAS:<p>Chromone-2-carboxylic acid is a hydrochloric acid analog that is a prodrug for the formation of the active metabolite chromone-2,4-dihydroxybenzoic acid. Chromone-2-carboxylic acid has been shown to have anti-inflammatory properties in vitro and in vivo. It has also been shown to inhibit leukotriene synthesis by blocking the binding of LTC4 to its receptor.</p>Formula:C10H6O4Purity:Min. 95%Molecular weight:190.15 g/molTRAP-14 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H119N21O22Purity:Min. 95%Molecular weight:1,738.94 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35N3O4Purity:Min. 95%Molecular weight:357.49 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/moltert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate
CAS:<p>Please enquire for more information about tert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23NO3Purity:Min. 95%Molecular weight:229.32 g/molH-Phe-Arg-Arg-OH acetate salt
CAS:<p>The H-Phe-Arg-Arg-OH acetate salt is a reversible (acetylcholinesterase inhibitor). It reversibly binds to the enzyme, acetylcholinesterase and blocks the breakdown of acetylcholine, which is an important neurotransmitter. The H-Phe-Arg-Arg-OH acetate salt has been shown to be effective against rat hearts that have been damaged by lysosomal enzymes. This drug can also act as an endogenous buffer in the blood plasma, preventing changes in pH due to acidosis or alkalosis. The H-Phe-Arg-Arg-OH acetate salt is a subcomponent of citrate and myocardial proteins, which are essential for biosynthetic processes in the body. It has been shown to be maximally additive with other drugs that affect cardiac function, such as beta blockers and digitalis glycosides. Proteolysis is maximally inhibited by this drug when it</p>Formula:C21H35N9O4Purity:Min. 95%Molecular weight:477.56 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H175N31O35S2Purity:Min. 95%Molecular weight:2,627.95 g/molH-Lys-Tyr-OH acetate salt
CAS:<p>H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molEnterostatin (human, mouse, rat) acetate salt
CAS:<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>Formula:C21H36N8O6Purity:Min. 95%Molecular weight:496.56 g/mol(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.</p>Formula:C121H190N34O35Purity:Min. 95%Molecular weight:2,681.01 g/molH-Gly-Gly-Lys-Arg-OH acetate salt
CAS:<p>The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.</p>Formula:C16H32N8O5Purity:Min. 95%Molecular weight:416.48 g/molN,N'-Dibenzylethylenediamine diacetate
CAS:Controlled Product<p>N,N'-Dibenzylethylenediamine diacetate is a diagnostic agent that is used to detect penicillin in blood samples. It reacts with the drug by forming a red-colored product, which can be detected with an ultraviolet light. This reaction is inhibited by cefapirin sodium and benzathine. The detection of penicillin in maternal blood has been shown to be significantly higher during the first trimester of pregnancy than during any other time period. Penicillin has also been shown to be effective against syphilis and streptococcal pharyngitis (strep throat), although it is not recommended for treatment trials because of its tendency to cause allergic reactions.</p>Formula:C16H20N2•(C2H4O2)2Purity:Min. 95%Molecular weight:360.45 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/mol(Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H300N54O59S2Purity:Min. 95%Molecular weight:4,432.95 g/mol([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-Arg-OH acetate salt is a polycarboxylic acid that is found in human immunoglobulins. It has been used as a synthetic substrate for the study of radiation enhancement. H-Arg-Arg-Arg-OH acetate salt is also an allergen and can cause allergic reactions, such as itching and swelling. This compound can be used to study the neutral pH, chemical reactions, protein synthesis, and the hydroxyl group.</p>Formula:C18H38N12O4Purity:Min. 95%Molecular weight:486.57 g/molAbz-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H58N12O16Purity:Min. 95%Molecular weight:986.98 g/molNeuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H310N58O61S2Purity:Min. 95%Molecular weight:4,627.14 g/mol4,6-Dichloro-2-methylnicotinic acid
CAS:<p>Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>Formula:C22H37N9O10Purity:Min. 95%Molecular weight:587.58 g/mol2,7-Naphthalenedisulfonic acid disodium salt
CAS:<p>2,7-Naphthalenedisulfonic acid disodium salt is a heteronuclear molecule that is synthesized by the reaction of 2,7-naphthalenedisulfonyl chloride with sodium sulfite in water. It has been used in the manufacture of dyes and pigments, as a corrosion inhibitor for steel and aluminum, and as an intermediate in the synthesis of pharmaceuticals. The compound has been detected in groundwater samples at concentrations up to 10 mg/L. The compound is also found in geothermal waters at concentrations up to 0.6 mg/L.</p>Formula:C10H6Na2O6S2Purity:Min. 95%Molecular weight:332.26 g/molH-Met-Arg-OH acetate salt
CAS:<p>H-Met-Arg-OH acetate salt is a metabolite of the amino acid L-methionine. It is also a dipeptide, which consists of two amino acids that are linked by an amide bond. The linkage between the amino acids in this compound is clockwise instead of the usual left to right orientation. This means that H-Met-Arg-OH acetate salt is not an essential amino acid and can be synthesized by the body. Salmonella typhimurium uses H-Met-Arg-OH acetate salt as a precursor for its synthesis of L-arginine and L-methionine, which are essential to bacterial growth and survival. Residues have been found in foods such as milk and eggs, and it has been shown that cotransduction can lead to resistance against antibiotics such as streptomycin and tetracycline.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/mol4-Nitro benzenebutanoic acid
CAS:<p>4-Nitro benzenebutanoic acid is a synthetic molecule that has not been extensively studied in biological systems. It is a calcium-binding molecule and may be used to study the mechanisms of calcium binding. 4-Nitrobenzenebutanoic acid has also shown some bifunctional activity and is used as a substrate in pharmacokinetic studies. The synthesis of this compound can be achieved by reacting azobenzene with butyric acid in the presence of an amine and inulin. This reaction produces nitrobenzenebutanoic acid, which undergoes hydrolysis to yield 4-nitrobenzenebutanoic acid.</p>Formula:C10H11NO4Purity:Min. 95%Molecular weight:209.2 g/mol3-Fluoro-4-nitrobenzoic acid
CAS:<p>3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molNeuropeptide VF (56-92) (human) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H304N52O51S2Purity:Min. 95%Molecular weight:4,256.95 g/molNuclear Factor NF-KB Inhibitor SN50 trifluoroacetate salt
CAS:<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>Formula:C129H230N36O29SPurity:Min. 95%Molecular weight:2,781.5 g/molMethyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate
CAS:<p>Please enquire for more information about Methyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8BrNO3Purity:Min. 95%Molecular weight:246.06 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS:<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>Formula:C8H14O4S2Purity:Min. 97%Color and Shape:Colorless Clear LiquidMolecular weight:238.33 g/mol4-(Piperidin-4-yl)benzoic acid hydrochloride
CAS:<p>Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16ClNO2Purity:Min. 95%Molecular weight:241.71 g/molChloromethyl acetate
CAS:<p>Chloromethyl acetate is a potent antibacterial agent that inhibits the growth of bacteria by inhibiting the synthesis of fatty acids. It also has an inhibitory effect on adenosine receptors and is used to treat congestive heart failure, inflammatory diseases, metabolic disorders, and other conditions. Chloromethyl acetate has been shown to be effective against a number of bacterial strains, including methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumoniae, and Mycobacterium tuberculosis. Chloromethyl acetate binds to the cyanoformate group in the bacterial cell wall by competitive inhibition. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme fatty acid synthase that is required for fatty acid biosynthesis, inhibiting protein synthesis and cell division.</p>Formula:C3H5ClO2Purity:Min. 95%Molecular weight:108.52 g/molDiisopropyl azodicarboxylate - 40% toluene solution
CAS:<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>Formula:C8H14N2O4Purity:Min. 95%Color and Shape:Yellow To Yellow Orange LiquidMolecular weight:202.21 g/molH-Arg-Phe-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N6O4Purity:Min. 95%Molecular weight:392.45 g/mol4-Acetamidophenyl boronic acid
CAS:<p>4-Acetamidophenyl boronic acid is a cross-coupling reagent that has been used in the synthesis of a variety of organic molecules. The reaction is stereoselective and proceeds with high yield. 4-Acetamidophenyl boronic acid has also been used to synthesize amides and azobenzenes, which can be substituted with chloride or uv irradiation to give chloroazobenzene or benzotriazole respectively. 4-Acetamidophenyl boronic acid has shown potent inhibition against the enzyme cyclooxygenase 2 (COX2) and acidic hydrolysis.</p>Purity:Min. 95%(7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C208H308N54O61SPurity:Min. 95%Molecular weight:4,573.06 g/molH-Gly-Gly-Lys-Ala-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N6O6Purity:Min. 95%Molecular weight:402.45 g/molH-Ala-His-Lys-OH acetate salt
CAS:<p>H-Ala-His-Lys-OH acetate salt is a copper complex that has been shown to have antioxidant properties in vitro. It has been studied for use as an analog of the vitamin C, which is a cofactor for collagen synthesis and follicular keratinization. Copper complexes with H-Ala-His-Lys-OH acetate salt have been shown to inhibit the formation of reactive oxygen species (ROS) and to stimulate collagen production by human dermal fibroblasts in vitro. This compound also stimulates the growth of human skin cells in vitro, which may be due to its ability to induce fibroblast proliferation.</p>Formula:C15H26N6O4Purity:Min. 95%Molecular weight:354.4 g/mol4,4',4''-Nitrilotribenzoic acid
CAS:<p>4,4',4''-Nitrilotribenzoic acid is a low molecular weight activated compound with a hexane molecule and luminescence properties. This compound has been used in the detection of human pathogens, for example, Salmonella enterica serovar Typhimurium. The uptake of 4,4',4''-nitrilotribenzoic acid by these bacteria has been shown to be due to its peroxidase-like activity. 4,4',4''-Nitrilotribenzoic acid has also been used for the activation of polybenzimidazole and for polymerization reactions in polybenzimidazole films. The time required for polymerization depends on the concentration of 4,4',4''-nitrilotribenzoic acid used.</p>Formula:C21H15NO6Purity:Min. 95%Molecular weight:377.35 g/molH-DL-Val-Leu-Arg-pNA acetate salt
CAS:<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>Formula:C23H38N8O5Purity:Min. 95%Molecular weight:506.6 g/molAlloferon - in acetate salt
CAS:<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>Formula:C52H75N22O16Purity:Min. 95%Molecular weight:1,264.29 g/molH-Pro-Pro-Gln-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/mol6-Maleimidocaproic acid N-hydroxysuccinimide ester
CAS:<p>6-Maleimidocaproic acid N-hydroxysuccinimide ester (6MCA-NHS) is a fluorescent probe that reacts with the hydroxyl group of fatty acids in human serum and other biological samples. 6MCA-NHS binds to the carboxylic acid group at the end of a fatty acid molecule, forming a covalent bond. This process generates light emission that can be detected by a fluorescence probe to measure changes in pH or other chemical properties within the solution. 6MCA-NHS has been used as a tumor treatment, where laser ablation is used to break up tumor cells and release 6MCA-NHS into the cytoplasm. The drug can then bind to DNA molecules and inhibit protein synthesis, which results in cell death.</p>Formula:C14H16N2O6Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:308.29 g/molNeuropeptide Y (free acid) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H284N54O58SPurity:Min. 95%Molecular weight:4,272.67 g/mol(Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H293N55O50Purity:Min. 95%Molecular weight:4,087.65 g/mol4-Bromobutyl acetate
CAS:<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>Formula:C6H11BrO2Purity:Min. 95%Molecular weight:195.05 g/mol5-bromo-2-(trifluoromethyl)benzoic Acid
CAS:<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H4BrF3O2Purity:Min. 95%Molecular weight:269.02 g/molBNP-32 (rat) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C146H239N47O44S3Purity:Min. 95%Molecular weight:3,452.95 g/molNeuropeptide VF (124-131) (human) trifluoroacetate salt
CAS:<p>Neuropeptide VF (124-131) (human) trifluoroacetate salt H-Val-Pro-Asn-Leu-Pro-Gln-Arg-Phe-NH2 trifluoroacetate salt is a peptide that is synthesized in the hypothalamus and is involved in the regulation of gonadotropin secretion. It has been shown to inhibit cell growth in vitro and to have an inhibitory effect on cancer cells. This peptide also binds to receptors α, adenohypophyseal, cellular, testicular, vasoactive intestinal peptide, messenger RNA, estradiol benzoate, cancer, and progesterone receptor.</p>Formula:C45H72N14O10Purity:Min. 95%Molecular weight:969.14 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47Purity:Min. 95%Molecular weight:3,355.67 g/molAmyloid β/A4 Protein Precursor770 (394-410) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (394-410) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H151N31O26S2Purity:Min. 95%Molecular weight:2,099.44 g/molPACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H300N56O45SPurity:Min. 95%Molecular weight:4,024.75 g/molProtein Kinase P34 (cd2) Substrate trifluoroacetate salt
CAS:<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>Formula:C106H172N32O32Purity:Min. 95%Molecular weight:2,406.7 g/mol(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H308N58O53Purity:Min. 95%Molecular weight:4,324.9 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N7O5Purity:Min. 95%Molecular weight:359.38 g/molPyrrole-2-carboxylic acid
CAS:<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>Formula:C5H5NO2Purity:Min. 95%Molecular weight:111.1 g/molOleic acid
CAS:<p>Oleic acid is a naturally occurring monounsaturated fatty acid (C18:1, cis-9-octadecenoic acid) widely used as an excipient in pharmaceutical formulations. Due to its amphiphilic and lipophilic properties, oleic acid is an important drug excipient primarily used to enhance the solubility and bioavailability of poorly water-soluble drugs. As a fatty acid, it is widely used in cosmeceuticals as it acts as a solubilizer in lipid-based systems, an emulsifier in creams and ointments, and a penetration enhancer in transdermal patches, aiding drug absorption through the skin.</p>Formula:C18H34O2Color and Shape:Colorless Clear Liquid PowderMolecular weight:282.46 g/molLysozyme C (46-61) (chicken) trifluoroacetate salt
CAS:<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>Formula:C72H116N22O29Purity:Min. 95%Molecular weight:1,753.82 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/molAdrenomedullin 5 (primate) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin 5 (primate) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C253H394N82O71S2Purity:Min. 95%Molecular weight:5,784.48 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H218N42O47SPurity:Min. 95%Molecular weight:3,381.65 g/molHexanedioic acid
CAS:<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>Formula:C6H10O4Color and Shape:White Off-White PowderMolecular weight:146.14 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/molBoc-(R)-3-Amino-4-(2,4,5-trifluorophenyl)butanoic acid
CAS:<p>Intermediate in the synthesis of sitagliptin</p>Formula:C15H18F3NO4Purity:Min. 95%Molecular weight:333.3 g/mol(Ile3)-Pressinoic acid
CAS:<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/mol(Des-Gly10,tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>Formula:C59H84N16O12•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,209.4 g/molAcetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H63N9O8Purity:Min. 95%Molecular weight:822.01 g/mol[2-fluoro-4-(trifluoromethyl)phenyl]boronic Acid
CAS:<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>Formula:C7H5BF4O2Purity:Min. 95%Molecular weight:207.92 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H85N19O13Purity:Min. 95%Molecular weight:1,208.37 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/molLuteinizing Hormone-Releasing Hormone Antagonist trifluoroacetate salt
CAS:<p>Luteinizing Hormone-Releasing Hormone Antagonist trifluoroacetate salt is a potent antagonist of the luteinizing hormone-releasing hormone (LHRH) receptor. It is used specifically to treat platinum-resistant ovarian cancer, where it has been shown to be effective in reducing tumor size and volume. This drug has minimal toxicity and can be administered by injection or as a microcapsule. LHRH Antagonist trifluoroacetate salt is an analog of LHRH that has been modified so that it cannot cross the blood-brain barrier. It also binds to epidermal growth factor receptors, which are involved in cell proliferation, differentiation, and survival. Symptoms of overdose may include nausea, vomiting, headache, dizziness, seizures, and coma.</p>Formula:C48H59ClN12O8Purity:Min. 95%Molecular weight:967.51 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/molNeurokinin B trifluoroacetate salt
CAS:<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br><br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>Formula:C55H79N13O14S2Purity:Min. 95%Molecular weight:1,210.43 g/molAntifreeze Polypeptide 6 (winter flounder) trifluoroacetate salt
CAS:<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>Formula:C133H225N43O51•xC2HF3O2Purity:Min. 95%Molecular weight:3,242.47 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H222N38O49Purity:Min. 95%Molecular weight:3,161.43 g/molIntermedin-53 (human) trifluoroacetate salt
<p>Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C247H395N83O73S3Purity:Min. 95%Molecular weight:5,791.49 g/mol(2S)-β-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate
CAS:Controlled Product<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>Formula:C21H33N5O5Purity:Min. 95%Molecular weight:435.52 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Formula:C28H34N4O7SPurity:Min. 95%Molecular weight:570.66 g/molH-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
CAS:<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>Formula:C29H54N8O10Purity:Min. 95%Molecular weight:674.79 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C188H282N52O59S2Purity:Min. 95%Molecular weight:4,278.7 g/molMAGE-1 Antigen (161-169) (human) acetate salt
CAS:<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>Formula:C41H57N11O17Purity:Min. 95%Molecular weight:975.96 g/molCRAMP-18 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP-18 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H171N27O24Purity:Min. 95%Molecular weight:2,147.61 g/mol(D-Trp6)-LHRH (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H81N17O14Purity:Min. 95%Molecular weight:1,312.43 g/molEthyl-2-ethoxy-1-[[(2'-cyanobiphenyl-4-yl) methyl] benzimidazole-7-carboxylate
CAS:<p>Candesartan is a selective angiotensin II receptor antagonist that inhibits the binding of angiotensin II to its receptors, which in turn decreases the activity of angiotensin-converting enzyme. Candesartan cilexetil is an ester prodrug that has been shown to be effective in the treatment of high blood pressure. In the crystalline form, candesartan cilexetil is a white powder with a melting point of 130–135 °C and a solubility in water of >1 g/L. The molecular weight of candesartan cilexetil is 393.8 g/mol and it has a molecular formula C17H21NO2S. The chemical structure consists of two benzimidazole rings coupled together through an ethyl-2-ethoxy linker and attached to a carboxylate group on one end and an amide group on the other</p>Formula:C26H23N3O3Purity:Min. 95%Molecular weight:425.48 g/mol5-Formyltetrahydropteroic acid
CAS:<p>5-Formyltetrahydropteroic acid is a labile, water soluble compound that can be used as a chromatographic standard. It has been used to determine the purity of water by measuring the concentration of this impurity in the sample. 5-Formyl tetrahydropterin has been shown to inhibit tumor growth and induce apoptosis in cancer cells. This compound also inhibits protein synthesis in cells by inhibiting ribosomal RNA processing and decreasing the rate of protein synthesis. 5-Formyltetrahydropteroic acid is also used to prevent bone marrow from producing red blood cells when given with leucovorin, which prevents the breakdown of bone marrow cells caused by radiation therapy or chemotherapy.</p>Formula:C15H16N6O4Purity:Min. 95%Molecular weight:344.33 g/mol(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H251N49O40S2Purity:Min. 95%Molecular weight:3,625.2 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H129N25O25SPurity:Min. 95%Molecular weight:2,005.22 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molMyelin Basic Protein (83-99) (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C93H143N25O24Purity:Min. 95%Molecular weight:1,995.28 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H203N41O38Purity:Min. 95%Molecular weight:3,080.37 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H159N25O32S5·C2HF3O2Purity:Min. 95%Molecular weight:2,605.93 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molCART (55-102) (human) trifluoroacetate salt
CAS:<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>Formula:C225H365N65O65S7Purity:Min. 95%Molecular weight:5,245.17 g/mol(Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H231N45O41Purity:Min. 95%Molecular weight:3,188.6 g/molOrotic acid anhydrous
CAS:<p>Orotic acid anhydrous is a hydrogen bonding interaction that can be found in biological systems. It plays a role in the physiological effects of orotic acid, which is a metabolite of uridine and an intermediate in the synthesis of pyrimidine nucleotides. Orotic acid has antimicrobial properties and has been shown to inhibit enzyme activities involved in energy metabolism, such as polymerase chain reaction (PCR) and adenosine triphosphate (ATP) synthase. Orotic acid also inhibits the growth of bacteria, fungi, and parasites. Orotic acid anhydrous is used for treating myocardial infarcts or brain functions. The untreated group was given no treatment at all.</p>Formula:C5H4N2O4Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:156.1 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS:<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>Formula:C54H56N6O13Purity:Min. 95%Molecular weight:997.06 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/molNeurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H52N8O12Purity:Min. 95%Molecular weight:776.83 g/molLHRH II trifluoroacetate salt
CAS:<p>LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.</p>Formula:C60H69N17O13Purity:Min. 95%Molecular weight:1,236.3 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H78N14O11Purity:Min. 95%Molecular weight:1,111.3 g/molHexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt
<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H250N44O43SPurity:Min. 95%Molecular weight:3,425.96 g/mol3-Methylthiopropionic acid
CAS:<p>3-Methylthiopropionic acid is a bacterial metabolite that can serve as an alternative carbon source for the production of amino acids. 3-Methylthiopropionic acid is used to study the effect of matrix on enzyme activities, and has been shown to have protein-binding properties. The compound also serves as a precursor in the synthesis of tiglic acid, which is a lysine precursor. 3-Methylthiopropionic acid has been found to be effective in slowing the growth of cancer cells. It has been shown to inhibit fatty acid synthesis, and may also inhibit methionine synthetase activity and cell proliferation.</p>Formula:C4H8O2SPurity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:120.17 g/mol5-Ethylpyridine-2-carboxylic acid
CAS:<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:Off-White PowderMolecular weight:151.16 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/mol3-Amino-4-methyl-thiophen-2-carboxylic acid methyl ester
CAS:<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>Purity:Min. 95%Molecular weight:171.22 g/molTIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H189N33O35S3Purity:Min. 95%Molecular weight:2,882.3 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molH-Val-Ala-pNA acetate salt
CAS:<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molα-Casein (90-96) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H64N10O12Purity:Min. 95%Molecular weight:913.03 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C121H168N26O33S4Purity:Min. 95%Molecular weight:2,643.05 g/molα-Conotoxin MI trifluoroacetate salt
CAS:Controlled Product<p>A component of Conus venom; antagonist of nicotinic acetylcholine receptors</p>Formula:C58H88N22O17S4Purity:Min. 95%Molecular weight:1,493.72 g/molAngiotensin II acetate salt
CAS:Controlled Product<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>Formula:C50H71N13O12·xC2H4O2Purity:Min. 95%Color and Shape:White SolidMolecular weight:1,046.18 g/molAPL1b27 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b27 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H174N30O38SPurity:Min. 95%Molecular weight:2,472.73 g/mol2-Hydroxy-4-(methylthio)butyric acid calcium salt
CAS:<p>2-Hydroxy-4-(methylthio)butyric acid calcium salt (2HMBAC) is a fatty acid that is found in malic acid. It is an important industrial chemical used for the preparation of other chemicals such as acetic anhydride, adipic acid, and butyric acid. 2HMBAC has been shown to have various biological functions including the inhibition of protein synthesis and the reduction of chloride ion transport. The dietary administration of 2HMBAC has been shown to relieve diarrhoea in rats.</p>Formula:C10H18CaO6S2Purity:Min. 95%Molecular weight:338.46 g/mol(Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/mol2-Bromoethanesulfonic acid sodium
CAS:<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>Formula:C2H4BrNaO3SPurity:Min. 95%Molecular weight:211.01 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N54O56SPurity:Min. 95%Molecular weight:4,328.86 g/molSplenopentin acetate salt
CAS:<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>Formula:C31H51N9O9Purity:Min. 95%Molecular weight:693.79 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H160N20O24Purity:Min. 95%Molecular weight:1,990.43 g/molZ-Ala-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N10O6Purity:Min. 95%Molecular weight:690.79 g/moluPAR (84-95) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H98N18O20SPurity:Min. 95%Molecular weight:1,447.62 g/mol5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H138N34O18Purity:Min. 95%Molecular weight:1,972.27 g/molSyntide 2 trifluoroacetate salt
CAS:<p>Syntide 2 is a diacylglycerol, which has been found to have a number of biochemical properties. It is an activator of protein kinase C and has been shown to be reactive in vitro assays. Syntide 2 has also been found to activate the light chain kinase in plant physiology. This compound has also been shown to promote neuronal death and may have a role in transcriptional regulation. Syntide 2 is used as a model system for studying the physiological function of α subunit-containing proteins.</p>Formula:C68H122N20O18Purity:Min. 95%Molecular weight:1,507.82 g/mol(R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid
CAS:<p>Please enquire for more information about (R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19F2NO4Purity:Min. 95%Molecular weight:315.31 g/mol(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H244N48O40S2Purity:Min. 95%Molecular weight:3,496.04 g/mol(Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H206N44O35SPurity:Min. 95%Molecular weight:2,857.26 g/molGalanin-Like Peptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C292H451N83O84SPurity:Min. 95%Molecular weight:6,500.28 g/molDodecylbenzenesulfonic acid, 70% in isopropanol
CAS:<p>Dodecylbenzenesulfonic acid is a sulfonic acid that is used in the production of polyaniline. It is also used as an organic reagent that can be applied in organic synthesis, including polymerization and electrochemical studies. Dodecylbenzenesulfonic acid has been shown to react with sodium salts to form dodecyl benzene, which can be observed by synchronous fluorescence spectroscopy. This chemical has a phase transition temperature of -9°C and a boiling point of 176°C. Dodecylbenzenesulfonic acid is soluble in water vapor, but insoluble in ethanol or acetone.</p>Formula:C18H30O3SPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:326.5 g/mol(Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molZ-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Z-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H49FN10O6Purity:Min. 95%Molecular weight:676.78 g/molBiotinyl-Neuromedin S (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H279N55O46SPurity:Min. 95%Molecular weight:4,017.58 g/molFmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid
CAS:<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>Formula:C23H27NO5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:397.46 g/molDiethyldithiocarbamic acid sodium trihydrate
CAS:<p>Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.</p>Formula:C5H11NS2•Na•(H2O)3Purity:Min. 95%Color and Shape:PowderMolecular weight:226.32 g/mol(Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H105N17O12SPurity:Min. 95%Molecular weight:1,384.73 g/molpTH (2-38) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H314N58O53S2Purity:Min. 95%Molecular weight:4,371.06 g/molM65 trifluoroacetate salt
<p>Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H326N64O61S5Purity:Min. 95%Molecular weight:4,823.51 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/mol2-Nitrobenzaldiacetate
CAS:<p>2-Nitrobenzaldiacetate is a chemical compound that has been used as a reaction component and reagent. It is also useful for the synthesis of other compounds. 2-Nitrobenzaldiacetate is a high quality, versatile building block that can be used to make complex compounds. The CAS number for this chemical is 6345-63-7. This compound has been shown to have many uses in research, such as being a useful intermediate or building block in synthetic organic chemistry.</p>Formula:C11H11NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:253.21 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H183N45O26Purity:Min. 95%Molecular weight:2,455.83 g/mol1-Methyl-1-cyclohexanecarboxylic acid
CAS:<p>1-Methyl-1-cyclohexanecarboxylic acid is a fatty acid that is present in the conjugates of natural and synthetic oils. It is an unsaturated fatty acid with a cycloalkane ring structure. The synthesis of 1-methyl-1-cyclohexanecarboxylic acid has been shown to be catalyzed by a carboxylase, which converts acetyl CoA into malonyl CoA. This reaction is irreversible and can be used as the first step in the biosynthesis of fatty acids. 1-Methyl-1-cyclohexanecarboxylic acid has been shown to cause cell death in leukemia cells, as well as inhibit epileptic seizures in rats.</p>Formula:C8H14O2Purity:Min. 95%Molecular weight:142.2 g/mol4-Pyridinylboronic acid
CAS:<p>4-Pyridinylboronic acid is a boron compound that contains two nitrogen atoms. It is an important reagent in organic synthesis and crystallography. 4-Pyridinylboronic acid has been shown to have biological properties, such as hydrogen bonding interactions. It is also used in the suzuki coupling reaction and the photochemical properties of the reaction solution are dependent on its coordination geometry. 4-pyridinylboronic acid has a high pH value, so it must be prepared in anhydrous sodium carbonate before use. The hydrogen bond between 4-pyridinylboronic acid and an azide is shown below: Nnowiki>/nowiki>Hnowiki>/nowiki>nowiki>/nowiki>Nnowiki>/nowiki>nowiki>/nowiki>H</p>Formula:C5H6BNO2Color and Shape:PowderMolecular weight:122.92 g/molNeuropeptide γ trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C99H158N34O29SPurity:Min. 95%Molecular weight:2,320.59 g/molErythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt
CAS:<p>Please enquire for more information about Erythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C72H99N17O17S2Purity:Min. 95%Molecular weight:1,538.79 g/molBig Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt )
CAS:<p>Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H236N38O47S5Purity:Min. 95%Molecular weight:3,628.17 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H116N20O19SPurity:Min. 95%Molecular weight:1,657.93 g/molCyclopenten-1-ylboronic acid
CAS:<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>Formula:C5H9BO2Purity:Min. 95%Molecular weight:111.93 g/molpTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C207H334N66O58Purity:Min. 95%Molecular weight:4,675.28 g/mol12-(Boc-aminooxy)-dodecanoic acid
CAS:<p>Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H33NO5Purity:Min. 95%Molecular weight:331.45 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>Formula:C139H231N43O39SPurity:Min. 95%Molecular weight:3,160.65 g/molCatestatin (human) trifluoroacetate
CAS:<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H164N32O27SPurity:Min. 95%Molecular weight:2,326.68 g/molMethyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate
CAS:<p>Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate is a metabotropic glutamate receptor antagonist. It blocks the glutamate receptor and prevents the transmission of nerve impulses in the central nervous system. This drug is used to treat neurological disorders such as anxiety, depression, and schizophrenia. Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate has been shown to have a number of side effects including drowsiness, nausea, dizziness and headache.</p>Formula:C11H10O3Purity:Min. 95%Molecular weight:190.2 g/molAzilsartan medoxomil
CAS:<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>Formula:C30H24N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:568.53 g/molAnxiety Peptide acetate salt
CAS:<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>Formula:C81H138N24O29Purity:Min. 95%Molecular weight:1,912.11 g/mol
