Carboxylic Acids

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>

<p>Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>

<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br&gt;<br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Nitrobenzaldiacetate is a chemical compound that has been used as a reaction component and reagent. It is also useful for the synthesis of other compounds. 2-Nitrobenzaldiacetate is a high quality, versatile building block that can be used to make complex compounds. The CAS number for this chemical is 6345-63-7. This compound has been shown to have many uses in research, such as being a useful intermediate or building block in synthetic organic chemistry.</p>

<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>

<p>Benzimidazole-5-carboxylic acid is a monoclonal antibody that binds to the amide group of an amino acid. It has been shown to be a potent inhibitor of cell growth in cervical cancer cells and rat liver microsomes. It also showed inhibitory activity against fatty acid and nucleotide synthesis. Benzimidazole-5-carboxylic acid is a benzimidazole compound that has been shown to have anti-inflammatory effects in animal models and also inhibits the replication of HIV. This drug can inhibit the replication of influenza A virus in vitro and may be useful as an antiviral agent for treatment of influenza A infection.</p>

<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Formyltetrahydropteroic acid is a labile, water soluble compound that can be used as a chromatographic standard. It has been used to determine the purity of water by measuring the concentration of this impurity in the sample. 5-Formyl tetrahydropterin has been shown to inhibit tumor growth and induce apoptosis in cancer cells. This compound also inhibits protein synthesis in cells by inhibiting ribosomal RNA processing and decreasing the rate of protein synthesis. 5-Formyltetrahydropteroic acid is also used to prevent bone marrow from producing red blood cells when given with leucovorin, which prevents the breakdown of bone marrow cells caused by radiation therapy or chemotherapy.</p>

<p>H-Ile-NHOH acetate salt is an inhibitor of l-amino acid metabolism. It is a competitive inhibitor of the enzyme L-amino acid oxidase, which catalyzes the conversion of l-amino acids to alpha-keto acids and ammonia. H-Ile-NHOH acetate salt has been shown to inhibit the growth of wild type C. glutamicum in a molecular modeling study. In addition, this compound has been shown to block messenger RNA (mRNA) synthesis in a mutant strain of C. glutamicum that does not have the frameshifting mutation. H-Ile-NHOH acetate salt is also known to be an inhibitor of fatty acid biosynthesis by blocking the activity of acyl carrier protein synthetase and acyl carrier protein reductase.</p>

<p>5-Phenylisoxazole-3-carboxylic acid is a phenoxy compound that has been shown to inhibit the growth of tuberculosis bacteria. This drug binds to the postsynaptic potential in the cell membrane and inhibits the effector proteins from interacting with the receptor, preventing neurotransmitter release. The molecular modeling study showed that 5-Phenylisoxazole-3-carboxylic acid interacts with ethyl esters and rifampin, which inhibits xanthine oxidase. Xanthine oxidase inhibitors are used as a treatment for gout and hyperuricemia. 5-Phenylisoxazole-3-carboxylic acid also has fluorimetric properties, which can be used to measure its concentration in biological samples such as urine or plasma. Nitro groups in this drug make it susceptible to oxidation by nitric oxide, which can be monitored using nmr spectra.</p>

<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>

<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>

<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>

<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>

<p>Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>

<p>4-Maleimidomethylcyclohexanecaroboxylic acid (4MAMC) is a bifunctional molecule that is conjugated to a polymer, which has the ability to bind with cellular antigens and target tissue. It is used in clinical chemistry because it can be detected at low concentrations. 4MAMC has been shown to reduce cirrhosis caused by chronic liver injury. 4MAMC also increases the uptake of coagulation factors and decreases the expression of prothrombin, which leads to an increase in clotting time. The localization of 4MAMC is determined by the type of polymer conjugate it is bound with; for example, when it binds with human serum albumin, it localizes on the surface of cells.</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>

<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>

<p>The monoclonal antibody (mAb) is a recombinant protein that binds to the extracellular region of the vasopressin receptor. It is used in pharmacological research to study the physiological function and pharmacological effects of vasopressin. The mAb has been shown to be minimally toxic, with an LD50 value of greater than 10 mg/kg in mice. It has also been shown to inhibit viruses and inhibit drug-sensitive enzymes. This antibody can be used as a diagnostic tool for congestive heart disease, as well as in experimental models for studying the minimal toxicity and tumor treatment properties of various drugs.</p>

<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>

<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Thrombin Receptor Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Fluorophenoxyacetic acid is a chemical compound that is used as an insecticide. It has been shown to be effective against the planthopper and ipomoea, two agricultural pests. 4-Fluorophenoxyacetic acid binds to the active site of a specific protein in the insect's cells, inhibiting its function and causing cell death. 4-Fluorophenoxyacetic acid also inhibits the growth of human breast cancer cells in culture. The molecular weight of this compound is 180.2 g/mol and has a melting point of 185°C with a boiling point of 232°C at atmospheric pressure. 4-Fluorophenoxyacetic acid can be synthesized by reacting phenol with acetic anhydride in the presence of palladium complexes and nitrogen atoms. The reaction mechanism for this synthesis is nucleophilic addition to form a covalent bond between the nitrogen atom and sulfur atom on one side of the</p>

<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (DL-Isoser 1)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>

<p>Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>

<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galacto-RGD trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-D-Ala-D-lactic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>a-(Trichloromethyl)benzyl acetate is an organic compound with the formula CHClCOCH. It is a colorless liquid which is soluble in organic solvents. This compound exhibits oxidative carbonylation activity, and has been shown to be used for the coating of particles, detergent compositions, and analytical methods. The microcapsules are prepared by encapsulating a fatty acid in a glycol ether. The health effects of this compound are not well understood but it is believed that it may have some carcinogenic properties.</p>

<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>

<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>

<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>

<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>

<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>

<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>

<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>

<p>Eledoisin acetate salt is a cell-lysing agent that belongs to the group of potent antagonists. It is an inhibitor of neurokinin-1 receptor which regulates the release of substance P and other inflammatory mediators from nerve terminals. Eledoisin acetate salt has shown to inhibit locomotor activity in rats, as well as nucleotide levels in cells. This drug also has been shown to have carcinoid syndrome-like effects, such as weight loss and diarrhea. These symptoms are caused by the inhibition of substance P at its receptors. The tumor necrosis factor (TNF) may be responsible for these effects, since it causes increased production of substance P in cells.</p>

<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4,4',4''-Nitrilotribenzoic acid is a low molecular weight activated compound with a hexane molecule and luminescence properties. This compound has been used in the detection of human pathogens, for example, Salmonella enterica serovar Typhimurium. The uptake of 4,4',4''-nitrilotribenzoic acid by these bacteria has been shown to be due to its peroxidase-like activity. 4,4',4''-Nitrilotribenzoic acid has also been used for the activation of polybenzimidazole and for polymerization reactions in polybenzimidazole films. The time required for polymerization depends on the concentration of 4,4',4''-nitrilotribenzoic acid used.</p>

<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>

<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>

<p>H-Gly-Pro-Pro-OH trifluoroacetate salt is an amide with a high specificity and low energy. This compound is activated by sequences of collagen, which may be due to its ability to hydrate intracellular calcium concentrations. H-Gly-Pro-Pro-OH trifluoroacetate salt has been shown to have polymerase chain activation activity in the presence of lysine residues, and it can bind to regulatory sites on DNA. H-Gly-Pro-Pro-OH trifluoroacetate salt has also been shown to have hydroxyproline hydroxylase activity, which leads to a helical structure.</p>

<p>Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.</p>

<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>