
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,969 products)
- Amino Acid and Amino Acid Related Compounds(3,474 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38282 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Ile-Arg-Pro-OH
CAS:<p>Please enquire for more information about H-Ile-Arg-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H32N6O4Purity:Min. 95%Molecular weight:384.47 g/molH-Ala-Val-NH2·HCl
CAS:<p>Please enquire for more information about H-Ala-Val-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H17N3O2·HClPurity:Min. 95%Molecular weight:223.7 g/molBoc-Ile-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ile-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-methyl-6-(trifluoromethyl)aniline
CAS:<p>2-Methyl-6-(trifluoromethyl)aniline is a colorless, oily liquid with a sulfurous odor. It is soluble in water and alcohol. The reaction rate of 2-methyl-6-(trifluoromethyl)aniline with sulfoxides is faster than that of benzyl anilines, but slower than that of anilino derivatives. The addition of hydrophobic groups to the 2-methyl-6-(trifluoromethyl)aniline molecule increases the reaction rate. 2-Methyl-6-(trifluoromethyl)aniline can be used as an anesthetic agent because it is a potent inhibitor of nerve conduction in sciatic nerves. It also has been shown to be effective in desulfurizing propylene, which is important for the production of polypropylene plastics and synthetic rubber. 2-Methyl-6-(triflu</p>Formula:C8H8F3NPurity:Min. 95%Molecular weight:175.15 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H270N48O51S2Purity:Min. 95%Molecular weight:4,046.55 g/molFmoc-Val-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Val-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Angiotensin II Receptor Ligand Nicotinoyl-Tyr-Lys(Z-Arg)-His-Pro-Ile-OH
CAS:<p>Angiotensin II receptor ligand nicotinoyl-tyrosine-arginine-proline-ile (ANGII) is a peptide that acts as a potent angiotensin II receptor agonist. It can be used to anesthetize rats and cause bradykinin b2 receptor activation. ANGII has been shown to inhibit the growth of several types of tumors, such as human melanoma cells, in animal experiments. This drug also has antiangiogenic properties, which may be due to its ability to induce the production of tumor necrosis factor-α (TNF-α).</p>Formula:C52H69N13O11Purity:Min. 95%Molecular weight:1,052.19 g/molH-DL-Leu-DL-Ala-OH
CAS:<p>Please enquire for more information about H-DL-Leu-DL-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H18N2O3Purity:Min. 95%Molecular weight:202.25 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/molVIP (3-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H226N40O39SPurity:Min. 95%Molecular weight:3,101.58 g/molPACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>Formula:C203H331N63O53SPurity:Min. 95%Molecular weight:4,534.26 g/molSarafotoxin B trifluoroacetate salt
CAS:<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>Formula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/molZ-DL-Lys(Z)-OH
CAS:<p>Please enquire for more information about Z-DL-Lys(Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H26N2O6Purity:Min. 95%Molecular weight:414.45 g/molBiotinyl-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H286N54O55S3Purity:Min. 95%Molecular weight:4,146.69 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molBoc-Phe-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H98N16O15SPurity:Min. 95%Molecular weight:1,507.76 g/mol1-Methylbiguanide hyrdochloride
CAS:<p>1-Methylbiguanide hydrochloride is a pharmaceutical drug that has been shown to be an antidiabetic agent. It is a white crystalline powder with a melting point of about 180°C and a solubility in water of about 1 g/L. 1-Methylbiguanide hydrochloride is used for treating diabetes mellitus type 2, which is caused by insulin resistance. The drug works by stimulating the release of insulin from the pancreas and increasing the rate at which glucose enters cells. Studies have shown that 1-methylbiguanide hydrochloride has low biodegradability, but it can be removed from wastewater using an activated carbon column or hydrophilic interaction chromatography. 1-Methylbiguanide hyrdochloride has been shown to be safe for humans and may not cause side effects in people with kidney disease who take it as prescribed. This drug also does not interact with other medications, such as warfarin</p>Formula:C3H9N5·HClPurity:Min. 95%Molecular weight:151.6 g/molH-D-Ile-Asp-OH
CAS:<p>Please enquire for more information about H-D-Ile-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N2O5Purity:Min. 95%Molecular weight:246.26 g/molFmoc-D-Ser(BSi)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H31NO5SiPurity:Min. 95%Molecular weight:441.59 g/molSorbin (147-153) amide (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Sorbin (147-153) amide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H58N10O9Purity:Min. 95%Molecular weight:738.88 g/molCyclolinopeptide B Cyclo(-Pro-Pro-Phe-Phe-Val-Ile-Met-Leu-Ile)
CAS:<p>Please enquire for more information about Cyclolinopeptide B Cyclo(-Pro-Pro-Phe-Phe-Val-Ile-Met-Leu-Ile) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H83N9O9SPurity:Min. 95%Molecular weight:1,058.38 g/molN,S-Bis-Fmoc-glutathione Fmoc-Glu(Cys(Fmoc)-Gly-OH)-OH
CAS:<p>Please enquire for more information about N,S-Bis-Fmoc-glutathione Fmoc-Glu(Cys(Fmoc)-Gly-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H37N3O10SPurity:Min. 95%Molecular weight:751.8 g/molBPP 5a Pyr-Lys-Trp-Ala-Pro-OH
CAS:<p>BPP 5a is an amide-based enzyme inhibitor with potent activity against bradykinin b2 receptor. It binds to the b2 receptor and inhibits its enzymatic activity, leading to a decrease in blood pressure. BPP 5a is orally administered and has been shown to be safe and effective in clinical trials. It also has potentiation effects that are mediated by the inhibition of kininases, which leads to a decrease in circulating levels of bradykinin. BPP 5a is used as a diagnostic aid for porcine kidney disease and has been shown to inhibit the production of monoclonal antibodies.</p>Formula:C30H41N7O7Purity:Min. 95%Molecular weight:611.69 g/molSuc-Ala-Ala-Pro-Met-pNA
CAS:<p>Suc-Ala-Ala-Pro-Met-pNA is a proteolytic enzyme that is active at acidic pH and cleaves casein to produce smaller peptides. It has been shown to have anti-inflammatory effects in animal models of inflammatory diseases by inhibiting the production of vasoactive intestinal peptide and other inflammatory mediators. Suc-Ala-Ala-Pro-Met-pNA also has a high salt tolerance and can survive in the presence of chloromethyl ketone, which is used as a chemical tool for protein sequencing. The enzyme produces dodecyl as its cleavage product, which can be used to determine the optimal reaction conditions for this enzyme.</p>Formula:C26H36N6O9SPurity:Min. 95%Molecular weight:608.67 g/mol(d(CH2)51,Tyr(Et)2,Val4,Arg8,des-Gly-NH29)-Vasopressin
CAS:<p>Please enquire for more information about (d(CH2)51,Tyr(Et)2,Val4,Arg8,des-Gly-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H73N11O11S2Purity:Min. 95%Molecular weight:1,080.32 g/molFibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt
CAS:<p>Fibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH trifluoroacetate salt is a peptidomimetic with peroxidase activity. It has the ability to bind to red blood cells and monoclonal antibodies, which are used in spatially specific immunoassays. Fibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH trifluoroacetate salt also has an effect on hyperresponsiveness and can be used as a costimulatory antigen for cancer immunotherapy.</p>Formula:C38H64N8O15Purity:Min. 95%Molecular weight:872.96 g/molAc-Ser-Gln-Asn-Tyr-OH
CAS:<p>Ac-Ser-Gln-Asn-Tyr-OH is an oligopeptide that is a substrate for enzymes that catalyze the hydrolysis of peptides. Ac-Ser-Gln-Asn-Tyr-OH has been shown to be an effective inhibitor of elastase and other proteases, with a kinetic mechanism involving a serine residue at position 1 as the nucleophile. This inhibitor binds to the active site of elastase and prevents access by the substrate. Acetylation at the C terminus may increase solubility, while substitution of tyrosine with a phenylalanine or tryptophan residue increases inhibitory activity. The optimum pH for this enzyme is around 7, while it’s inorganic nature makes it less sensitive to organic solvents.</p>Formula:C23H32N6O10Purity:Min. 95%Molecular weight:552.53 g/molAtriopeptin I (rat)
CAS:<p>Atriopeptin I is a peptide hormone that is produced in the rat mesenteric gland. It has been shown to have β-amino acid, diagnostic agents, ph optimum, and receptor activity. Atriopeptin I has been found to have atrial natriuretic effects and may be useful for the treatment of infectious diseases. Atriopeptin I has also been shown to bind with a monoclonal antibody and enzyme inhibitors as well as having a disulfide bond. The biological function of this peptide hormone is not yet known, but it is thought to be involved in fatty acid metabolism.</p>Formula:C83H135N29O30S2Purity:Min. 95%Molecular weight:2,083.27 g/molH-Thr-Lys-Pro-Pro-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H47N9O7Purity:Min. 95%Molecular weight:597.71 g/molThrombin B-Chain (147-158) (human)
CAS:Please enquire for more information about Thrombin B-Chain (147-158) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C54H84N16O18Purity:Min. 95%Molecular weight:1,245.34 g/mol(Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H283N51O53SPurity:Min. 95%Molecular weight:4,125.63 g/molBoc-Cys(Bzl)-OSu
CAS:<p>Boc-Cys(Bzl)-OSu is a prodrug that is metabolized by esterases to form the active compound, boc-Cys(Bzl)-OH. This molecule inhibits matrix metalloproteinase (MMP) activity and can be used for the treatment of viral infections, such as hepatitis C and HIV. Boc-Cys(Bzl)-OSu has been shown to inhibit MMPs in a number of different ways including steric interactions with the active site of MMPs and by binding to the receptor protein for these enzymes. It also has antiviral activity against HIV and other viruses.</p>Formula:C19H24N2O6SPurity:Min. 95%Molecular weight:408.47 g/molH-Trp-Glu-OH
CAS:<p>H-Trp-Glu-OH is a fatty acid that is involved in the synthesis of proteins. It is involved in the transcription-polymerase chain reaction, which is a technique used to amplify DNA sequences. H-Trp-Glu-OH is also used in sample preparation and in the treatment of neurological disorders and diabetes. H-Trp-Glu-OH has been shown to inhibit neuronal death by inhibiting uptake and cell proliferation through hydrogen bonds with human serum and peroxisome proliferation. This compound has also been shown to have diagnostic properties for diabetes, as it can be detected in human serum after an insulin stimulus.</p>Formula:C16H19N3O5Purity:Min. 95%Molecular weight:333.34 g/molH-His-Tyr-OH
CAS:<p>H-His-Tyr-OH is a histidine-containing compound that has been synthesized and structurally characterized. H-His-Tyr-OH was shown to be a competitive inhibitor of the enzyme histidine decarboxylase in a rat liver microsomal preparation. The kinetic constants for the inhibition of the enzyme were determined, and the binding site on the enzyme was identified by molecular modeling. This study also showed that H-His-Tyr-OH binds to monoclonal antibodies with high affinity and specificity, which may be useful for therapy.</p>Formula:C15H18N4O4Purity:Min. 95%Molecular weight:318.33 g/molHCV Core Protein (19-25)
CAS:<p>Please enquire for more information about HCV Core Protein (19-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H59N9O11Purity:Min. 95%Molecular weight:829.94 g/molH-Gly-Gly-His-Ala-OH
CAS:<p>H-Gly-Gly-His-Ala-OH is a peptide of four amino acids. It has been shown experimentally that the side chain of His is always oriented in the same direction, regardless of the conformation. The proton shift constants and vicinal coupling constants for Gly, Gly and Ala are constant, while His has a variable proton shift constant. The experimental parameters for the molecule have been rationalized by using conformational shifts to explain their variability. For example, the proton shift constants have been found to be dependent on the rotation about an axis perpendicular to the peptide backbone. H-Ala-Gly-Gly-His-OH is a pentapeptide with five amino acids that differs from HGGHAOH by having Ala instead of His at position 1. The vicinal coupling constants are different and so are other experimental parameters.</p>Formula:C13H20N6O5Purity:Min. 95%Molecular weight:340.34 g/molH-Lys-Val-OH hydrochloride salt
CAS:<p>H-Lys-Val-OH hydrochloride salt is a polymerase chain that has been synthesized from the amino acid lysine. It is an optical sensor that can be used to detect and quantify proteins. H-Lys-Val-OH hydrochloride salt binds to DNA in the cell nucleus and is sensitive to the concentration of adenosine triphosphate (ATP) in cells. This nucleotide plays an important role in cellular energy production. The binding constants for H-Lys-Val-OH hydrochloride salt are determined from the fluorescence emission spectrum, which changes with different concentrations of ATP. The method can be used to measure glomerular filtration rates and can be used as a low energy radiation source for cervical cancer treatment.</p>Formula:C11H23N3O3Purity:Min. 95%Molecular weight:245.32 g/mol4-Methylsalicylamide
CAS:<p>4-Methylsalicylamide is a chemical compound that belongs to the class of isonicotinic amides. It is a potent anti-inflammatory agent with minimal inhibitory concentration (MIC) values of 4 µg/mL for gram-positive bacteria and 8 µg/mL for gram-negative bacteria. This compound has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. 4-Methylsalicylamide has been shown to have an inhibitory effect on ring-opening, which may be due to its ability to acetylate mitochondrial membranes, altering the membrane potential. The molecular modeling studies also showed that 4MSAM binds at the same site as antibiotics such as penicillin and erythromycin in bacterial ribos</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/mol(Cys8·13)-Dynorphin A (1-13) amide
CAS:<p>Please enquire for more information about (Cys8·13)-Dynorphin A (1-13) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H112N24O14S2Purity:Min. 95%Molecular weight:1,565.91 g/molL-Tyrosine ethyl ester hydrochloride
CAS:<p>L-Tyrosine ethyl ester hydrochloride is a non-protein amino acid that inhibits the activity of metalloproteases, which are enzymes that break down proteins. It has been shown to be effective against bowel disease and cancer by inhibiting the release of inflammatory cytokines. L-Tyrosine ethyl ester hydrochloride also has anti-inflammatory properties and can be used in the treatment of depression and liver cirrhosis. This drug is an inhibitor of hydroxylase, which is an enzyme involved in the synthesis of melanin. It is a structural analogue to L-DOPA, which is used for Parkinson's disease. L-Tyrosine ethyl ester hydrochloride has been shown to have antihypertensive effects and can be used as a diuretic agent.</p>Formula:C11H15NO3·HClPurity:Min. 95%Color and Shape:PowderMolecular weight:245.7 g/molVIP sulfoxide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H238N44O43SPurity:Min. 95%Molecular weight:3,341.8 g/molPmc-S-methylisothiourea
CAS:<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Formula:C16H24N2O3S2Purity:Min. 95%Color and Shape:PowderMolecular weight:356.51 g/mol(D-Pro4,D-Trp7·9·10,Val8)-Substance P (4-11)
CAS:<p>Please enquire for more information about (D-Pro4,D-Trp7·9·10,Val8)-Substance P (4-11) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H74N14O10SPurity:Min. 95%Molecular weight:1,159.36 g/molpp60 c-src (521-533) (phosphorylated) trifluoroacetate salt
CAS:<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N16O28PPurity:Min. 95%Molecular weight:1,543.48 g/molNeuropeptide Y (2-36) (human, rat) trifluoroacetate salt
CAS:Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C180H276N54O55SPurity:Min. 95%Molecular weight:4,108.51 g/molFmoc-Arg(Pbf)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-His(Trt)-OH
CAS:<p>Boc-His(Trt)-OH is a chemical compound that has been used in the laboratory to study uptake and binding of compounds. It is stable in complex with albumin, which has led to its use as a model system for studying hepatic steatosis. This chemical can be synthesized by solid-phase synthesis with trifluoroacetic acid and polypeptide synthesis. FT-IR spectroscopy has been used to characterize Boc-His(Trt)-OH, revealing its chemical diversity.</p>Formula:C30H31N3O4Purity:Min. 95%Color and Shape:PowderMolecular weight:497.58 g/molTyr-Bradykinin
CAS:<p>Bradykinin is a peptide with a variety of physiological effects. It is formed by the cleavage of kininogen by kallikrein, and it is involved in the regulation of vascular tone and blood pressure, as well as responses to pain and inflammation. Bradykinin stimulates the release of histamine from mast cells, which causes an inflammatory response. Bradykinin also has been shown to stimulate the release of leukotrienes, prostaglandins, and cytokines from human lung tissue. The interaction between bradykinin and its receptors has been studied extensively using in vitro assays. The conformational changes in this peptide have been characterized by spectroscopic studies such as nuclear magnetic resonance (NMR) and circular dichroism (CD). In addition, bradykinin can be detected using luminescence techniques such as chemiluminescence or bioluminescence. Studies have shown that micromolar concentrations of bradykinin</p>Formula:C59H82N16O13Purity:Min. 95%Molecular weight:1,223.38 g/mol(Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H203N39O28SPurity:Min. 95%Molecular weight:2,804.33 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H49FN4O14Purity:Min. 95%Molecular weight:876.88 g/molZ-Ala-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N10O6Purity:Min. 95%Molecular weight:690.79 g/molAnnexin A1 (1-11) (dephosphorylated) (human, bovine, chicken, porcine) trifluoroacetate salt
CAS:<p>Annexin A1 (1-11) is a peptide that is part of the annexin family. It is involved in the degranulation of cells and inhibits inflammation by inhibiting the production of pro-inflammatory cytokines. Annexin A1 (1-11) has been shown to be an anti-inflammatory compound as it binds to phospholipids on the surface of neutrophils, leading to inhibition of their chemotaxis and phagocytosis. This peptide also interacts with other annexins and prevents apoptosis by blocking caspase activity. Finally, it has been found that annexin A1 (1-11) can promote the healing of wounds in mice by accelerating reepithelialization and reducing scar formation. The concentration required for these effects are nanomolar concentrations.</p>Formula:C63H94N14O17SPurity:Min. 95%Molecular weight:1,351.57 g/molFmoc-S-trityl-D-cysteine
CAS:<p>Fmoc-S-trityl-D-cysteine (Fmoc-SC) is a modified amino acid that is used in the synthesis of biomolecules. It can be synthesized using a stepwise process, starting with the reaction between cysteine and trityl chloride. Fmoc-SC has been shown to inhibit mitochondrial membrane potential and cell growth in cancer cells. Additionally, it has pharmacokinetic properties that make it suitable for intravenous administration. Fmoc-SC can also be used to modify proteins by reacting with hydroxyl groups on lysine residues and other nucleophiles, as well as to inhibit histone deacetylases (HDACs), which are enzymes that regulate transcriptional activity.</p>Formula:C37H31NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:585.71 g/molAmyloid beta-Protein (1-37) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-37) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H274N50O55SPurity:Min. 95%Molecular weight:4,074.49 g/mol(Trp7,beta-Ala8)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Trp7,beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H57N9O10SPurity:Min. 95%Molecular weight:868.01 g/mol4,4-Difluoro-N-((1S)-3-oxo-1-phenylpropyl)cyclohexanecarboxa
CAS:<p>Please enquire for more information about 4,4-Difluoro-N-((1S)-3-oxo-1-phenylpropyl)cyclohexanecarboxa including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H19F2NO2Purity:Min. 95%Molecular weight:295.32 g/molBoc-Gln-Pro-OH
CAS:<p>Please enquire for more information about Boc-Gln-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H25N3O6Purity:Min. 95%Molecular weight:343.38 g/molBz-Asn-pNA
CAS:<p>Bz-Asn-pNA is a peptide that is synthesized by the enzyme phosphoenolpyruvate carboxykinase. It has been shown to be an effective inhibitor of proteolytic enzymes, such as aminopeptidases. Bz-Asn-pNA has also been shown to be stable in high salt concentrations and its activity does not change at physiological pH levels. The kinetic constants for Bz-Asn-pNA have been determined using dodecylphosphocholine and endogenous substrate (3H)lysine. The optimum pH for Bz-Asn-pNA is between 7 and 8, which is optimal for protein synthesis.</p>Formula:C17H16N4O5Purity:Min. 95%Molecular weight:356.33 g/molHIV Protease Substrate III
CAS:<p>HIV protease is a large protein that cleaves the polyprotein of HIV. This enzyme is essential for viral replication and so any drug that inhibits its function will inhibit HIV infectivity. The HIV protease substrate III, which contains histidine at position 3, has been used to study the effects of HIV proteases on different tissue types. It has been shown that this substrate can be detected in the cytoplasm and vacuole of cells infected with HIV, indicating that it may be involved in the transport process. The addition of an acidic amino acid (p-nitro-phenylalanine) to the substrate increases its antiviral activity by increasing its stability against proteolytic enzymes and allowing it to penetrate into cells more easily.</p>Formula:C58H95N19O16Purity:Min. 95%Molecular weight:1,314.49 g/mol1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>Formula:C28H56NO7PPurity:Min. 95%Molecular weight:549.72 g/molZ-His(Z)-OH ethanol solvate
<p>Please enquire for more information about Z-His(Z)-OH ethanol solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H21N3O6Purity:Min. 95%Molecular weight:423.42 g/molAc-Arg-Phe-Met-Trp-Met-Lys-NH2 TFA salt
CAS:<p>Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 is an opioid receptor agonist with a high affinity for the μ-, δ-, and κ-opioid receptors. Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 binds to these receptors, thereby inhibiting the release of neurotransmitters that transmit pain signals from the peripheral nerves to the brain. Acetyl fentanyl also inhibits the binding of opioid receptor antagonists such as naloxone, which is used in emergency rooms to block or reverse the effects of opioids. Acetyl fentanyl has been shown to be an effective analgesic in animal studies.</p>Formula:C44H66N12O7S2•xC2HF3O2Purity:Min. 95%Molecular weight:939.2 g/molHCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H99N15O14SPurity:Min. 95%Molecular weight:1,214.52 g/mol(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Controlled Product<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2·C12H23NPurity:Min. 95%Molecular weight:370.53 g/mol(Asp28)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H281N49O61SPurity:Min. 95%Molecular weight:4,187.56 g/molZ-Gly-Pro-pNA
CAS:<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>Formula:C21H22N4O6Purity:Min. 95%Molecular weight:426.42 g/molAngiotensin I/II (4-8)
CAS:<p>Angiotensin I/II (4-8) H-Tyr-Ile-His-Pro-Phe-OH is a peptide that contains the sequence of angiotensin I and II. It has been shown to have proton transport properties, which may be related to its sequence. The amino acid sequence of this peptide is similar to other pentapeptides such as insulin and vasopressin. This peptide has been linked to a vector that can cross the blood brain barrier, allowing it to act on the central nervous system.</p>Formula:C35H45N7O7Purity:Min. 95%Molecular weight:675.77 g/mol...(Ala13)-Apelin-13 (human, bovine, mouse, rat) trifluoroacetate salt
CAS:<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>Formula:C63H107N23O16S·xC2HF3O2Purity:Min. 95%Molecular weight:1,474.74 g/molN,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine)
CAS:<p>Please enquire for more information about N,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2Purity:Min. 95%Color and Shape:PowderMolecular weight:168.28 g/molFmoc-Lys-OH·HCl
CAS:<p>Fmoc-Lys-OH·HCl is an acidic pyrylium that has been shown to be a potent inhibitor of tumor vasculature. It binds to the human serum albumin and inhibits the binding of ligands to the receptor tyrosine kinases, which are involved in brain tumor proliferation. Fmoc-Lys-OH·HCl has also been shown to inhibit the growth of cancer cells by binding to cell membrane receptors and inhibiting protein synthesis. This compound is also isomeric, meaning it can exist in different forms with different properties.</p>Formula:C21H24N2O4·HClPurity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:404.89 g/molH-Trp-Met-OH
CAS:<p>The molecular formula for H-Trp-Met-OH is CHNOS. It is a neutral, solubilized, imino amide residue of L-phenylalanine. The compound has not been identified but it is presumed to be an azide or sulfate ester of tyrosine. This compound was isolated from the membranes of bacteria and peptidases break it down into other amino acids with the exception of lysine. The yield from this reaction is unknown.</p>Formula:C16H21N3O3SPurity:Min. 95%Molecular weight:335.42 g/molH-D-Asp(OtBu)-allyl ester·HCl
CAS:<p>Please enquire for more information about H-D-Asp(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4·HClPurity:Min. 95%Molecular weight:265.73 g/molFmoc-S-trityl-L-penicillamine
CAS:<p>Fmoc-S-trityl-L-penicillamine is a coordination compound that contains a thiolate and amide group. It has been used as a model system for studying the interaction between proteins and metal ions, with the cyclic structure mimicking the active site of enzymes. The coordination of Fmoc-S-trityl-L-penicillamine to proteins is affected by trypsin, an enzyme that cleaves peptides at carboxyl side chains. Trypsin can also lead to dehydration of Fmoc-S-trityl-L-penicillamine, forming an eliminations product. This compound also reacts with lysine residues in proteins, resulting in an alkene byproduct that can be removed by hydrogenation.</p>Formula:C39H35NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:613.77 g/molZ-Ala-Ala-Lys-4MbetaNA formiate salt
CAS:<p>Please enquire for more information about Z-Ala-Ala-Lys-4MbetaNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H39N5O6·CH2O2Purity:Min. 95%Molecular weight:623.7 g/mol1,2-Distearoyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Distearoyl-rac-glycero-3-phosphocholine is a synthetic phospholipid, which is typically derived from the hydrogenation of naturally occurring lecithins. This compound serves as a key structural component in lipid bilayers, joining polar heads with hydrophobic tails to form stable membranes.</p>Formula:C44H88NO8PPurity:Min. 95%Molecular weight:790.15 g/molHIV-1 gag Protein p24 (194-210)
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (194-210) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H126N20O23SPurity:Min. 95%Molecular weight:1,683.97 g/molNeuromedin U-8 (porcine) trifluoroacetate salt
CAS:<p>Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor for</p>Formula:C54H78N16O10Purity:Min. 95%Molecular weight:1,111.3 g/molL-Lysine methyl ester 2HCl
CAS:<p>L-Lysine methyl ester 2HCl is a lysine derivative that has been synthesized by reacting L-lysine with methanol and hydrochloric acid. This compound's cytotoxicity has been demonstrated in an inhibition study using calf thymus dna. L-Lysine methyl ester 2HCl contains amide, acid, and ester linkages, as well as hydrogen bonds that are typical of natural compounds. It is also biologically active and has a molecular weight of 246.3 g/mol. The chemical structure of this compound consists of a central l-lysine molecule with two methyl groups on the nitrogen atom. The compound also contains a carboxyl group on the end of the chain and an ester group on the second carbon atom from the end of the chain. L-Lysine methyl ester 2HCl can be found in soybeans and bovine fetal tissue. It exhibits morphological properties similar to other</p>Formula:C7H16N2O2·2HClPurity:Min. 95%Color and Shape:PowderMolecular weight:233.14 g/molAmyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H107N19O17SPurity:Min. 95%Molecular weight:1,494.76 g/mol((R)-4-Hydroxy-4-methyl-Orn (TRITC)7)-Phalloidin
<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (TRITC)7)-Phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H70N12O13S2Purity:Min. 95%Molecular weight:1,231.4 g/molZ-His-p-nitro-Phe-Phe-OMe
CAS:<p>Please enquire for more information about Z-His-p-nitro-Phe-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H34N6O8Purity:Min. 95%Molecular weight:642.66 g/molPyr-Phe-Leu-pNA
CAS:<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>Formula:C26H31N5O6Purity:Min. 95%Molecular weight:509.55 g/mol(Des-Gly10,His(Bzl)6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,His(Bzl)6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molGM-CSF (96-112)
CAS:<p>Please enquire for more information about GM-CSF (96-112) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H139N21O29SPurity:Min. 95%Molecular weight:1,987.24 g/molFmoc-Tyr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Biotinyl-(Gln1)-Gastrin I (human) Biotinyl-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-Gastrin I (human) Biotinyl-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H141N23O33S2Purity:Min. 95%Molecular weight:2,341.53 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molH-Ala-Ala-Pro-Leu-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Pro-Leu-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H34N6O6·HClPurity:Min. 95%Molecular weight:527.01 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/molH-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2
CAS:<p>H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 is a compound which is structurally related to the amino acid histidine. It has been used as an indicator for Xanthochromia, a diagnostic for copper. H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 has also been used in polyester production and as a monitoring agent for modifications of polylactic acid thermally.</p>Formula:C40H69N11O8Purity:Min. 95%Molecular weight:832.05 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H86N18O12Purity:Min. 95%Molecular weight:1,239.43 g/molDynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Dynorphin A (1-11) amide trifluoroacetate salt is a modified form of the opioid peptide dynorphin, which is a natural ligand for kappa-opioid receptors. It has affinity for the surface receptors and can be used to study the modifications that occur in cell function. Dynorphin A (1-11) amide trifluoroacetate salt has been shown to decrease cell function when it interacts with these surface receptors, which are found in brain homogenates and other tissues. Dynorphin A (1-11) amide trifluoroacetate salt also has an effect on brain cells, which may be due to its ability to alter conformational changes in proteins by binding to them. This can lead to alterations in the structure of certain enzymes or receptor proteins.</p>Formula:C63H104N22O12Purity:Min. 95%Molecular weight:1,361.64 g/molFmoc-Gly-Phe-OH
CAS:<p>Fmoc-Gly-Phe-OH is a photolytic residue that has been synthesized by solid-phase techniques. This molecule is an immobilized linker that can be used in photolabile devices to analyze the kinetics of biological processes. Fmoc-Gly-Phe-OH can also be used in supramolecular devices and regenerative medicine to measure the diameter of cells, as well as for regenerative purposes in humans.</p>Formula:C26H24N2O5Purity:Min. 95%Molecular weight:444.48 g/mol1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt)
CAS:<p>1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:(C2H4O)nC44H87N2O10P•H3NPurity:Min. 95%Color and Shape:White PowderH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molFmoc-N-Me-Asp(OBzl)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-Asp(OBzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H25NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:459.49 g/molNeuropeptide S (rat) trifluoroacetate salt
CAS:Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C95H160N34O27Purity:Min. 95%Molecular weight:2,210.5 g/molAc-Ser-Gly-OH
CAS:<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molH-DL-delta-Hydroxy-DL-Lys(Boc)-OH
CAS:<p>Please enquire for more information about H-DL-delta-Hydroxy-DL-Lys(Boc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H22N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:262.3 g/molBoc-Arg-SBzl·HCl
CAS:<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N4O3S·HClPurity:Min. 95%Molecular weight:416.97 g/molSubstance P (5-11) trifluoroacetate salt
CAS:<p>Substance P is a bifunctional neuropeptide that acts as both a neurotransmitter and a neurohormone. The amino acid sequence of Substance P is H-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2. It is found in the brain and spinal cord, but also in other tissues such as the parotid gland and stomach. This peptide is released from nerve cells when they are stimulated by pain or anxiety, and it causes contraction of smooth muscles in the lungs, uterus, and gastrointestinal tract. Animal studies have shown that Substance P can be toxic to neonatal animals, leading to hypothyroidism and death. In vitro studies have shown that this peptide can induce the growth of glioma cells and tumors.</p>Formula:C41H60N10O9SPurity:Min. 95%Molecular weight:869.04 g/molSpexin trifluoroacetate salt
CAS:<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O19SPurity:Min. 95%Molecular weight:1,619.89 g/molFmoc-D-Asp(OMpe)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asp(OMpe)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29NO6Purity:Min. 95%Molecular weight:439.5 g/mol4-Methoxycarbonylphenylboronic acid
CAS:<p>4-Methoxycarbonylphenylboronic acid is an organic compound that can be synthesized from biphenyl. It is a diazonium salt with a bidentate ligand and a carbonyl group, which allows it to form an intermolecular hydrogen bond. The phenyl group of 4-methoxycarbonylphenylboronic acid can be oxidized to the corresponding carboxylic acid or reduced to the corresponding alcohol.<br>4-Methoxycarbonylphenylboronic acid is also soluble in halides, iodinations, and mercaptoacetic acid. This compound has been used as an acceptor in the oxidation of aluminium with diborane as a catalyst. 4-Methoxycarbonylphenylboronic acid has also been used to synthesize other compounds such as metronidazole (a drug) and erythromycin (an antibiotic).</p>Formula:C8H9BO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:179.97 g/molMca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H65N13O15Purity:Min. 95%Molecular weight:1,100.14 g/mol(N-Me-Phe7)-Neurokinin B trifluoroacetate salt
CAS:<p>Please enquire for more information about (N-Me-Phe7)-Neurokinin B trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H81N13O14S2Purity:Min. 95%Molecular weight:1,272.5 g/molPAR-2 (1-6) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 agonist is a synthetic peptide that activates PAR-2. It binds to PAR-2 receptors, which are present in the mesenteric vasculature and in various other tissues. Activation of PAR-2 leads to an increase in intracellular calcium concentration, activation of protein kinase C, cytosolic calcium ion release, phosphorylation of myosin light chain, muscle cell proliferation, transcription and translation initiation, and increased production of vasoactive intestinal peptide. This drug also has anti-inflammatory effects and stimulates epidermal growth factor (EGF) and thrombin receptor expression as well as growth factor production.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molTRAP-5 trifluoroacetate salt
CAS:<p>TRAP-5 is a peptide consisting of the amino acid sequence H-Ser-Phe-Leu-Leu-Arg. This peptide has been shown to have antiviral, anti-inflammatory, and anticancer properties. It has also been found to inhibit platelet activation in vitro and to reduce atherosclerotic lesions in mice. TRAP-5 has been shown to have therapeutic potential for diseases such as heart disease and lung diseases, although its efficacy has not yet been tested in humans.</p>Formula:C30H50N8O7Purity:Min. 95%Molecular weight:634.77 g/molH-Leu-Leu-Tyr-OH
CAS:<p>H-Leu-Leu-Tyr-OH is a water soluble polymer that is produced by the enzymatic polymerization of L-leucine and L-tyrosine. This polymer is cytotoxic and has been shown to bind to DNA in the cell nucleus, as well as inhibit protein synthesis. H-Leu-Leu-Tyr-OH was developed as an alternative to polyethylene glycol (PEG) due to its low toxicity, high biocompatibility, and ability to be easily synthesized.</p>Formula:C21H33N3O5Purity:Min. 95%Molecular weight:407.5 g/molBifunctional Antiplatelet Agent H(-Lys-Arg)3-Arg-Gly-Asp-Val-OH
CAS:<p>Please enquire for more information about Bifunctional Antiplatelet Agent H(-Lys-Arg)3-Arg-Gly-Asp-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H103N25O13Purity:Min. 95%Molecular weight:1,298.55 g/mol(D-Ala2)-Leu-Enkephalin
CAS:<p>(D-Ala2)-Leu-Enkephalin H-Tyr-D-Ala-Gly-Phe-Leu-OH is a peptide that is a member of the endorphin family of endogenous analgesic compounds. It has been shown to have anti-inflammatory properties in clinical studies and to suppress bacterial growth in vitro. The compound has been implicated in the regulation of glucose homeostasis, as well as having an effect on body mass index and skin cells. (D-Ala2)-Leu-Enkephalin H-Tyr-D-Ala-Gly-Phe-Leu-(OH) is thought to modulate the activity of Toll like receptor 4, which is involved in inflammation and immune response.</p>Formula:C29H39N5O7Purity:Min. 95%Molecular weight:569.65 g/molFmoc-octyl-D-Gly-OH
CAS:<p>Fmoc-octyl-D-Gly-OH is a supramolecular polymer with a wide range of applications, including oil recovery and as a nanomaterial. Fmoc-octyl-D-Gly-OH is synthesized by the ring opening polymerization of octylglycol with D,L lactic acid. It has been shown to be an effective emulsifier in water, which may be due to its synergistic effect with other molecules. Fmoc-octyl-D-Gly-OH also has the ability to self assemble into a variety of morphologies such as nanoribbons, nanowires, and gel networks. This polymer can also be used as a hydrogenation catalyst for organic synthesis reactions that require high pressures and temperatures. Fmoc-octyl-D-Gly-OH has also been used in the production of ultrasonication devices for use in medicine.</p>Formula:C25H31NO4Purity:Min. 95%Molecular weight:409.52 g/molBoc-Asn-o-nitrophenyl ester
CAS:<p>Please enquire for more information about Boc-Asn-o-nitrophenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O7Purity:Min. 95%Molecular weight:353.33 g/molH-DL-Orn (Z)-OH
CAS:<p>Please enquire for more information about H-DL-Orn (Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H18N2O4Purity:Min. 95%Molecular weight:266.29 g/mol(Phe1-psi(CH2NH)Gly2)-Nociceptin (1-13) amide
<p>Please enquire for more information about (Phe1-psi(CH2NH)Gly2)-Nociceptin (1-13) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H102N22O14Purity:Min. 95%Molecular weight:1,367.6 g/mol2-Phenylpyridine
CAS:<p>2-Phenylpyridine is a heterocyclic organic compound that has been shown to have x-ray crystal structures. It has redox potentials, nitrogen atoms, and a fatty acid group attached. 2-Phenylpyridine has been shown to have nmr spectra that are characteristic of a transfer reaction mechanism. The steric interactions and the biphenyl groups have been shown to have ancillary effects on the reaction mechanism. 2-Phenylpyridine is also known to coordinate in a geometric shape called octahedral, which is most likely due to hydrogen bonding and photophysical properties. The analytical chemistry of this molecule consists of determining its melting point, boiling point, and density. 2-phenylpyridine</p>Formula:C11H9NPurity:Min. 95%Molecular weight:155.2 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>Formula:C11H16ClNO3Purity:Min. 95%Color and Shape:White to off white solid.Molecular weight:245.7 g/molH-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N8O10Purity:Min. 95%Molecular weight:726.78 g/molProinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H239N47O46Purity:Min. 95%Molecular weight:3,340.71 g/molBoc-beta-cyclopropyl-Ala-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-beta-cyclopropyl-Ala-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4·C12H23NPurity:Min. 95%Molecular weight:410.59 g/molNalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide
CAS:<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>Formula:C12H15FN4O5Purity:Min. 95%Color and Shape:Off-White To Yellow SolidMolecular weight:314.27 g/mol(Z-Asp-Glu-Val-Asp)2-Rhodamine 110
CAS:<p>Fluorogenic dye targeting caspase 3</p>Formula:C72H78N10O27Purity:Min. 95%Molecular weight:1,515.44 g/molH-Val-Ala-Ala-Phe-OH
CAS:<p>H-Val-Ala-Ala-Phe-OH is a polypeptide that has been synthesized to study the effects of metal surface on mass spectrometry. The peptide has been found to be labile and nonvolatile, which means it can easily evaporate and desorb from the metal surface. The research also shows that this polypeptide is more efficient in mass spectrometers with higher resolution.</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molAmyloid beta-Protein (1-40) trifluoroacetate salt
CAS:Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.Formula:C23H38N6O5·2HClPurity:Min. 95%Molecular weight:551.51 g/molrac 3,11-dichloro-6,11-dihydro-6-methyl-dibenzo[c,f][1,2]thiazepine 5,5-dioxide
CAS:<p>Racemic 3,11-dichloro-6,11-dihydro-6-methyl-dibenzo[c,f][1,2]thiazepine 5,5-dioxide is a hydrogen chloride salt of racemic 3,11-dichloro-6,11-dihydro-6-methyl dibenzo[c,f][1,2]thiazepine. Racemic 3,11 - dichloro - 6 , 11 - dihydro - 6 - methyl dibenzo [ c , f ] [ 1 , 2 ] thiazepine 5 , 5 - dioxide is used in the manufacture of high purity and high yield hydrogen chloride gas. Racemic 3,11 - dichloro - 6 , 11 - dihydro - 6 - methyl dibenzo [ c , f ] [ 1 , 2 ] thiazepine 5 , 5 - dioxide can be prepared by heating anhyd</p>Formula:C14H11Cl2NO2SPurity:Min. 95%Molecular weight:328.21 g/molBiotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H309N55O60S2Purity:Min. 95%Molecular weight:4,556.1 g/molN-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid
CAS:<p>N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid is a high quality chemical that is used as an intermediate in the production of pharmaceuticals and other fine chemicals. It is also a reagent for use in peptide synthesis. N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid has a CAS No. 669073-62-5 and can be used as a useful scaffold for the production of complex compounds. This compound is also useful for research purposes, due to its versatility as a building block with speciality chemical applications.</p>Formula:C23H26N2O6Purity:Min. 95%Molecular weight:426.46 g/molFmoc-Asp(OtBu)-Thr(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Asp(OtBu)-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H36N2O8Purity:Min. 95%Molecular weight:552.62 g/molBoc-Ile-Gly-OH
CAS:<p>Boc-Ile-Gly-OH is a reactive compound that contains an aldehyde group. It is catalytic and can be used in the synthesis of peptides, amino acids, and other compounds. Boc-Ile-Gly-OH is unmodified by reaction with carbonyl groups or any other functional groups. It has been modified by thermal treatment to produce an oxygen species at temperatures below 100°C.</p>Formula:C13H24N2O5Purity:Min. 95%Molecular weight:288.34 g/molSuc-Ala-Phe-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Ala-Phe-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H39N5O8·C2HF3O2Purity:Min. 95%Molecular weight:735.7 g/molb-Alanine methyl ester hydrochloride
CAS:<p>b-Alanine methyl ester hydrochloride is a fatty acid that is found in animal and plant tissues. It is a bifunctional molecule that can act as an inhibitor of serine proteases and also as an activator of fatty acid uptake by cells. This molecule has the potential to be used for the treatment of heart disease and other conditions caused by activation of serine proteases.</p>Formula:C4H9NO2·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:139.58 g/molH-Gly-Pro-Gly-Gly-OH
CAS:<p>H-Gly-Pro-Gly-Gly-OH is a peptide that has been shown to have anti-inflammatory properties. It is an amide with four amino acids, Glycine, Proline, Glycine and Hydroxyproline. The terminal residues of this peptide are Glycine and Hydroxyproline. The optical properties of this peptide include the absorption maximum at 264 nm and the extinction coefficient at 25°C is approximately 5200 M−1 cm−1. This amide also has been clinically studied for its effects in humans with inflammatory disease such as arthritis. Kinetic studies have shown that this peptide binds to protein data through site specific interactions and molecular electrostatic potential simulations have shown that the chelate ring on the tetrapeptide interacts with the protein data.</p>Formula:C11H18N4O5Purity:Min. 95%Molecular weight:286.28 g/mol(Des-Gly10,D-Tyr5,D-Leu6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Leu6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molPDGF Antagonist
CAS:<p>H-Ala-Asn-Phe-Leu-Val-Trp-Glu-Ile-Val-Arg-Lys-Lys-Pro is a monoclonal antibody that inhibits proliferation of endothelial cells. It binds to PDGF, which is a potent growth factor. This drug has been shown to inhibit the growth of vascular smooth muscle cells in vitro and in vivo by inhibiting cholesterol synthesis. H-Ala-Asn-Phe-Leu-Val-Trp has also been shown to have antagonist effects on basic fibroblast growth factor and cyclic AMP, which are important mediators of choroidal neovascularization and blood vessel formation.</p>Formula:C77H122N20O17Purity:Min. 95%Molecular weight:1,599.92 g/molOsteocalcin (45-49) (human)
CAS:<p>Please enquire for more information about Osteocalcin (45-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H39N5O7Purity:Min. 95%Molecular weight:581.66 g/molH-Val-Val-Val-OH
CAS:<p>H-Val-Val-Val-OH is an enantiomer of H-Val-Gly-Thr-Phe, a linear model of the apical region of the Caco2 cell. It is also a monolayer that has hydrogen bonds with other molecules. Molecular modeling shows that H-Val-Val-Val-OH inhibits the uptake of glucose by Caco2 cells. The transport properties of this molecule are not well understood, but it may inhibit glucose transport in the small intestine by binding to glucose transporter 2 (GLUT2). Chromatographic methods have been used to analyze H-Val-Val-Val-OH and its inhibition on growth factor activity.</p>Formula:C15H29N3O4Purity:Min. 95%Molecular weight:315.41 g/molMca-Pro-Leu-Gly-Pro-D-Lys(Dnp)-OH
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Pro-D-Lys(Dnp)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H52N8O14Purity:Min. 95%Molecular weight:892.91 g/molH-Gly-Pro-bNA
CAS:<p>H-Gly-Pro-bNA is a glycylproline amino acid sequence that is synthesized by the enzyme neutral endopeptidase. It has been found in tissues, such as hamster liver and human liver, and has been shown to be resistant to hydrolysis by peptidases. The H-Gly-Pro-bNA sequence is amphipathic, meaning it can exist in both water and lipid environments. H-Gly-Pro-bNA has been shown to be a substrate for hydroxylase activity, which converts it into an amino acid with a hydroxyl group at its alpha carbon. This amino acid can then bind to polyacrylamide gel electrophoresis under denaturing conditions.</p>Formula:C17H19N3O2Purity:Min. 95%Molecular weight:297.35 g/molRetrocyclin-1 trifluoroacetate salt
CAS:<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/mol(D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H210N40O31SPurity:Min. 95%Molecular weight:2,933.44 g/molH-Ser-Tyr-betaNA
CAS:<p>Please enquire for more information about H-Ser-Tyr-betaNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23N3O4Purity:Min. 95%Molecular weight:393.44 g/mol7alpha-Methyl-3,3-dimethoxy-5(10)-estrene-17-one
CAS:Controlled Product<p>Please enquire for more information about 7alpha-Methyl-3,3-dimethoxy-5(10)-estrene-17-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H32O3Purity:Min. 95%Color and Shape:PowderMolecular weight:332.48 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H229N45O37Purity:Min. 95%Molecular weight:3,050.52 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molBiotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about Biotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H207N41O46S7Purity:Min. 95%Molecular weight:3,376.81 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molH-Cys(NPys)-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/molPAR-4 (1-6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H42N8O8Purity:Min. 95%Molecular weight:618.68 g/molBoc-Glu-phenyl ester
CAS:<p>Boc-Glu-phenyl ester is an inhibitor of bacterial protein synthesis. It was first synthesized as a synthetic substrate for the enzyme staphylococcal protease and has been shown to be active against both human and staphylococcal cells, with activity against strains resistant to other antibiotics. Boc-Glu-phenyl ester inhibits the synthesis of proteins by binding to the catalytic site of the enzyme and preventing formation of peptide bonds. This inhibition leads to cell death due to a lack of critical proteins required for cellular function. Boc-Glu-phenyl ester is also specific for staphylococci, which may be due to its ability to inhibit the production of epidermolytic exotoxins.</p>Formula:C16H21NO6Purity:Min. 95%Molecular weight:323.34 g/molN-2-Chloroethyl-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-2-Chloroethyl-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30ClN3O2Purity:Min. 95%Molecular weight:367.91 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/molFmoc-Cit-OPfp
CAS:<p>Please enquire for more information about Fmoc-Cit-OPfp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H22F5N3O5Purity:Min. 95%Molecular weight:563.47 g/molH-Pro-Val-Asp-OH
CAS:<p>Please enquire for more information about H-Pro-Val-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H23N3O6Purity:Min. 95%Molecular weight:329.35 g/molN-Boc-glycine
CAS:<p>N-Boc-glycine is a chemical compound used in the synthesis of cyclic peptides. N-Boc-glycine is synthesized by the reaction of glycine with methanol and hydrochloric acid in the presence of an activated form of carbon monoxide. The pharmacokinetic properties of N-Boc-glycine are similar to those for human immunoglobulin, and it can be used as a reference compound for preparative high performance liquid chromatography (HPLC). It has been shown that the nitrogen atoms in N-Boc-glycine are chemically stable, which makes it suitable for asymmetric synthesis. N-Boc-glycine also has potent antagonist effects on biochemical properties such as calcium channel blockade, inhibition of platelet aggregation, and inhibition of neutrophil chemotaxis.</p>Formula:C7H13NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:175.18 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/mol(H-Gly-Cys-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Gly-Cys-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N4O6S2Purity:Min. 95%Color and Shape:PowderMolecular weight:354.41 g/molO-Hippuryl-L-b-phenyllactic acid sodium salt
CAS:<p>Please enquire for more information about O-Hippuryl-L-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/molH-Arg-Val-OH acetate salt
CAS:<p>H-Arg-Val-OH acetate salt is a recombinant humanized monoclonal antibody that binds to the serine protease, which is an enzyme that cleaves proteins at specific sites. The antibody inhibits the activity of this enzyme and prevents the release of proteins from cells. It has been shown to be clinically relevant in treating heart failure, chronic pulmonary disease, and congenital heart disease. In addition, H-Arg-Val-OH acetate salt inhibits the release of inflammatory molecules like interleukin 6 (IL6) and tumor necrosis factor alpha (TNFα), which are involved in a variety of diseases.</p>Formula:C11H23N5O3Purity:Min. 95%Molecular weight:273.33 g/molBradykinin (2-9) acetate salt
CAS:<p>Acetate salt</p>Formula:C44H61N11O10Purity:Min. 95%Molecular weight:904.02 g/molFmoc-beta-cyclohexyl-D-alanine
CAS:<p>Fmoc-beta-cyclohexyl-D-alanine is a fragment of the cyclic peptide cyclohexylalanine and has been shown to inhibit cell growth in culture. It binds to DNA in a transcriptional manner and induces apoptosis, which is characterized by dna fragmentation. Fmoc-beta-cyclohexyl-D-alanine also inhibits extracellular signal-regulated kinase (ERK) activity, leading to reduced expression of antiapoptotic proteins such as Bcl2 and BclXL. This drug has been shown to induce apoptosis in cells that have been transfected with an antiapoptotic vector.</p>Formula:C24H27NO4Purity:Min. 95%Molecular weight:393.48 g/molEpinecidin-1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C114H176N30O21SPurity:Min. 95%Molecular weight:2,334.87 g/molCyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Val-Tyr-Phe-Ala-His-Leu-Asp-Ile-Ile-Trp-OH
CAS:<p>Please enquire for more information about Cyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Val-Tyr-Phe-Ala-His-Leu-Asp-Ile-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H150N28O27Purity:Min. 95%Molecular weight:2,380.62 g/molH-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Exendin-4 (3-39)
CAS:<p>Please enquire for more information about Exendin-4 (3-39) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H272N46O58SPurity:Min. 95%Color and Shape:PowderMolecular weight:3,992.38 g/molOsteoblast Activating Peptide (human) trifluoroacetate salt
<p>Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37SPurity:Min. 95%Molecular weight:2,795.14 g/molAc-Ile-Glu-Pro-Asp-pNA
CAS:<p>Ac-Ile-Glu-Pro-Asp-pNA is a synthetic peptide that has been shown to induce apoptosis in tumor cells. The peptide was found to cause cell lysis and necrotic cell death, which is associated with the activation of serine proteases. Ac-Ile-Glu-Pro-Asp-pNA also has been shown to have a toxicity profile similar to other apoptotic agents such as staurosporine, but it has not been tested for its ability to kill cancer cells without causing damage to healthy cells. Ac-Ile-Glu-Pro-Asp-pNA induces mitochondrial membrane depolarization and protein synthesis inhibition in K562 cells, which are human erythroleukemia cells. This peptide also has shown an ability to bind with monoclonal antibodies and inhibit the growth of casein.</p>Formula:C28H38N6O11Purity:Min. 95%Molecular weight:634.64 g/molH-Gly-Ile-2-Nal-Trp-His-His-Tyr-OH
CAS:<p>Please enquire for more information about H-Gly-Ile-2-Nal-Trp-His-His-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H60N12O9Purity:Min. 95%Molecular weight:1,009.12 g/mol(Gln53)-Connexin 37 (51-58) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Gln53)-Connexin 37 (51-58) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H59N11O15Purity:Min. 95%Molecular weight:933.96 g/molpTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H247N49O37Purity:Min. 95%Molecular weight:3,364.91 g/molFor-Nle-Leu-Phe-Nle-Tyr-Lys-OH
CAS:<p>For-Nle-Leu-Phe-Nle-Tyr-Lys-OH is an amino acid sequence that is a proteolytic fragment of the erythrocyte membrane protein band 3. It has been shown to be able to inhibit the activity of cytosolic calcium and actin filament polymerization, as well as inhibiting apoptosis in human polymorphonuclear leukocytes (PMNL). This compound has been found to be effective in preventing uptake of bacteria by neutrophils, which may be due to its ability to alter the pH gradient across the membrane and increase intracellular calcium levels. For-Nle-Leu-Phe-Nle-Tyr-Lys-OH also inhibits diacylglycerol synthesis, which may contribute to its antiinflammatory effects.</p>Formula:C43H65N7O9Purity:Min. 95%Molecular weight:824.02 g/molAcetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H193N37O26SPurity:Min. 95%Molecular weight:2,638.15 g/mol4-Methoxybenzylboronic acid pinacolester
CAS:<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21BO3Purity:Min. 95%Molecular weight:248.13 g/molH-Pro-Asn-OH
CAS:<p>H-Pro-Asn-OH is a reactive functional group that is activated by the presence of acidic conditions. It can react with epoxides to form cyclic ethers. H-Pro-Asn-OH can be used in vitro studies to assess the activation of caspases, which are proteolytic enzymes that play a role in cell apoptosis. It has also been used for molecular imaging and as an antigen for immunotherapy in cancer treatment. This molecule has a reactive functional group on its side chain and reacts with epoxides to form cyclic ethers.</p>Formula:C9H15N3O4Purity:Min. 95%Molecular weight:229.23 g/molDynorphin B (1-9)
CAS:<p>Please enquire for more information about Dynorphin B (1-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H78N16O12Purity:Min. 95%Molecular weight:1,143.3 g/mol3’’’-Epi-Empagliflozin
CAS:<p>Please enquire for more information about 3’’’-Epi-Empagliflozin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27ClO7Purity:95% MinColor and Shape:PowderMolecular weight:450.91 g/mol(2S,3S)-(-)-3-Amino-2-phenylpiperidine
CAS:<p>The process of asymmetric epoxidation is used to convert alkenes into epoxides in a single step. This reaction is catalyzed by the use of a chiral catalyst with an enantiomeric excess (ee) greater than 50%. The reactants are added to the catalyst and hydrogen peroxide, which oxidizes the alkenes. The resulting epoxides can be isolated from the reaction mixture by distillation or extraction. Factors that affect this reaction include the type of reactant, solvent, temperature, and pressure.</p>Formula:C11H16N2Purity:Min. 95%Molecular weight:176.26 g/molNeurotensin (1-8) Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-OH
CAS:<p>Neurotensin (NT) is a peptide that has been implicated in the regulation of feeding behavior, cardiovascular function, and pain perception. The neurotensin receptor is a G-protein coupled receptor with seven transmembrane domains. Neurotensin binds to the receptor and activates it by inducing intracellular calcium mobilization and neurotransmitter release. This activation can be dose-dependent, as seen in experiments using rat brain slices incubated with different concentrations of NT. Neurotensin also induces maximal activation at low concentrations, which may be due to its ability to bind to both extracellular and intracellular receptors. NT binds selectively to ventral tegmental area neurons from rats, leading to increased spontaneous firing rates. Cancer cells have been shown to express high levels of neurotensin receptors on their surface membrane, which may contribute to tumorigenesis and metastasis. Neurodegenerative diseases such as Alzheimer’s disease are thought to involve alterations in the expression or</p>Formula:C46H71N13O14Purity:Min. 95%Molecular weight:1,030.14 g/molBig Endothelin-1 (human)
CAS:<p>Please enquire for more information about Big Endothelin-1 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H282N48O56S5Purity:Min. 95%Molecular weight:4,282.88 g/mol4-Chloro-6-methyl-2-trifluoromethylpyrimidine
CAS:<p>Please enquire for more information about 4-Chloro-6-methyl-2-trifluoromethylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4ClF3N2Purity:Min. 95%Molecular weight:196.56 g/mol(Nle 8·18,Tyr34)-pTH (1-34) (human)
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H295N55O52Purity:Min. 95%Molecular weight:4,097.64 g/molHirudin (54-65) (sulfated)
CAS:<p>Hirudin is a protein that functions as an anticoagulant by binding to the active site of thrombin, preventing it from converting fibrinogen into fibrin. It has a high affinity for the thrombin receptor and can be modified in various ways. Hirudin's most common modification is sulfation, which enhances its anticoagulant activity. Hirudin is a proteolytic enzyme that can be synthesized using solid-phase chemistry. Its biological function is to inhibit blood coagulation by inhibiting the conversion of fibrinogen to fibrin. Hirudin binds to thrombin, preventing it from converting fibrinogen into fibrin and thus inhibits coagulation. It also prevents clot formation by inhibiting platelet aggregation, which may result from interactions with other proteins such as prothrombin and factor VIII.</p>Formula:C66H93N13O28SPurity:Min. 95%Molecular weight:1,548.58 g/mol2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride
CAS:<p>Please enquire for more information about 2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H27ClN2O2Purity:Min. 95%Molecular weight:290.83 g/molSuc-Leu-Leu-Val-Tyr-pNA
CAS:<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H50N6O10Purity:Min. 95%Molecular weight:726.82 g/molH-D-Leu-pNA
CAS:<p>Please enquire for more information about H-D-Leu-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H17N3O3Purity:Min. 95%Molecular weight:251.28 g/molZ-Pro-Leu-Gly-OH
CAS:<p>Z-Pro-Leu-Gly-OH is a peptide that belongs to the class of amides, oxalate salts, and grignard reagents. It can be synthesized from the reaction between an oxalate salt and a grignard reagent. The synthesis of Z-Pro-Leu-Gly-OH is usually done by reacting an oxalate salt with a grignard reagent in presence of a ketone or ketomethylene.</p>Formula:C21H29N3O6Purity:Min. 95%Molecular weight:419.47 g/molH-Gly-Arg-Asp-Gly-Ser-OH
CAS:<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molCyclo(-Pro-Gly)3
CAS:<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O6Purity:Min. 95%Molecular weight:462.5 g/molH-D-Ile-OBzl·p-tosylate
CAS:<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>Formula:C13H19NO2·C7H8O3SPurity:Min. 95%Molecular weight:393.5 g/molZ-Tyr-Leu-NH2
CAS:<p>The compound Z-Tyr-Leu-NH2 is a synthetic molecule that inhibits the activity of metalloproteases. It binds to the active site of these enzymes, preventing them from cleaving their substrates. The enzyme's activity is inhibited by binding to uncharged amino acid residues in the active site, which prevents attack by the metal ion and therefore prevents cleavage of substrate proteins. Z-Tyr-Leu-NH2 has been shown to be effective against proteases that are involved in Alzheimer's disease and other neurodegenerative diseases. The optimal pH for this compound is 7.5, with a reaction time of 1 hour at 37 degrees Celsius. The transition temperature for this compound is -10 degrees Celsius, with a phase transition at -4 degrees Celsius.</p>Formula:C23H29N3O5Purity:Min. 95%Molecular weight:427.49 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/molL-Threonine derivative-1
CAS:L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.Formula:C13H15NO6Purity:97.03% - 98.91%Color and Shape:SolidMolecular weight:281.262'-Methoxy-α-naphthoflavone
CAS:2'-Methoxy-alpha-naphthoflavone is a fine chemical that can be synthesized from naphthalene, benzaldehyde, and methoxyacetic acid. It is a versatile building block for research chemicals and has been shown to have high quality. 2'-Methoxy-alpha-naphthoflavone has been used as a reaction component in the synthesis of complex compounds with interesting biological activities.Formula:C20H14O3Purity:Min. 95%Molecular weight:302.32 g/molKALA Amphipathic Peptide
CAS:<p>Please enquire for more information about KALA Amphipathic Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C144H248N40O35SPurity:Min. 95%Molecular weight:3,131.82 g/molZ-Gly-Ala-His-AMC
CAS:<p>Please enquire for more information about Z-Gly-Ala-His-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N6O7Purity:Min. 95%Molecular weight:574.58 g/molBiotinyl-MCH (salmon) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H153N29O26S5Purity:Min. 95%Molecular weight:2,325.78 g/molN1-Glutathionyl-spermidine disulfide [
CAS:<p>N1-Glutathionyl-spermidine disulfide (N1-GS) is a molecule that has been shown to have clinical use in the treatment of chronic hepatitis C infection. The N1-GS molecule is composed of a glutathione (GSH) scaffold with two sulfhydryl groups and an amino acid side chain. N1-GS has a hydrophobic nature, which allows it to penetrate the cellular membrane and enter cells. It is also able to form hydrogen bonds and act as a catalyst for reactions. Fluorescence analysis revealed that this molecule is selective for disulfides over thiols, amines, or alcohols. Disulfides are very important in biological systems since they can be found in enzymes, proteins, and cellular membranes. The insolubility of the N1-GS molecule makes it difficult to analyze its structure using traditional methods such as gas chromatography or nuclear magnetic resonance spectroscopy. However, fluorescence</p>Formula:C34H66N12O10S2Purity:Min. 95%Molecular weight:867.09 g/mol

