
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,469 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38260 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Fmoc-Cys(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-D-Arg(Pbf)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Heat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>Formula:C11H16ClNO3Purity:Min. 95%Color and Shape:White to off white solid.Molecular weight:245.7 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molBrain-Binding Peptide
CAS:<p>Please enquire for more information about Brain-Binding Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H64N12O14S2Purity:Min. 95%Molecular weight:965.11 g/mol(D-Ala2)-Leu-Enkephalin amide
CAS:<p>Hyaluronic acid is a natural component of connective tissue and synovial fluid in animals. It is a linear, unbranched polysaccharide consisting of alternating D-glucuronic acid and N-acetyl-D-glucosamine. Hyaluronic acid has been shown to be useful in the treatment of long-term diseases such as heart disease or skin conditions like eczema. It is important for the efficient production of vaccines, which are used to prevent infectious diseases such as streptococcal infections. Hyaluronic acid can also be used as a microcontroller for minimally invasive procedures. This molecule can be used as an additive in the production of metallocene catalysts to increase the efficiency of these reactions, while reducing impurities during the process. The use of hyaluronic acid has been studied extensively, with many techniques employed to study its properties and functions. Genetic factors have also been found to play a role in</p>Formula:C29H40N6O6Purity:Min. 95%Molecular weight:568.66 g/molFmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Cyclohexyl-2-hydroxy-phenylacetic acid
CAS:<p>2-Cyclohexyl-2-hydroxy-phenylacetic acid is a potent inhibitor of the cholinergic muscarinic receptors. It has been used as an anticholinergic drug and in pharmaceutical preparations for the treatment of inflammatory diseases. 2-Cyclohexyl-2-hydroxy-phenylacetic acid is used to treat urinary incontinence, although it can also cause constipation. Side effects of 2-cyclohexyl-2-hydroxy phenylacetic acid include headache, drowsiness, dry mouth, and blurred vision. 2 CPHPA is an inorganic acid that reacts with phosphorus pentachloride to form an organic phosphate ester called pentachlorophosphoric acid (PCPA). This reaction can be reversed by adding hydrochloric acid. The PCPA salt of 2 CPHPA is called diethylamine salt.</p>Formula:C14H18O3Purity:Min. 95%Molecular weight:234.29 g/molCyclo(-D-Ala-Val)
CAS:<p>Please enquire for more information about Cyclo(-D-Ala-Val) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O2Purity:Min. 95%Molecular weight:170.21 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/molZ-His-p-nitro-Phe-Phe-OMe
CAS:<p>Please enquire for more information about Z-His-p-nitro-Phe-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H34N6O8Purity:Min. 95%Molecular weight:642.66 g/molFmoc-3-(2-naphthyl)-L-alanine
CAS:<p>Fmoc-3-(2-naphthyl)-L-alanine is a supramolecular compound that functions as an inhibitor of prostate cancer cells. It inhibits the uptake of metal chelates by prostate cancer cells and stabilizes them, which may lead to a diagnostic and therapeutic agent for prostate cancer. Fmoc-3-(2-naphthyl)-L-alanine has also been shown to inhibit the growth of human serum prostate cancer cells in vitro and in vivo models. This molecule is a bifunctional compound that can be used as both an antigen and a surrogate for cytosolic prostate specific antigen (PSA) levels. Fmoc-3-(2-naphthyl)-L-alanine has been shown to bind to the PSA protein, which is normally found on the surface of prostate epithelial cells. This binding prevents it from being released into the blood circulation, where it would otherwise be measured by a PSA test</p>Formula:C28H23NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:437.49 g/molH-Arg-Phe-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N6O4Purity:Min. 95%Molecular weight:392.45 g/molFGF acidic I (102-111) (bovine brain)
CAS:<p>Please enquire for more information about FGF acidic I (102-111) (bovine brain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H82N16O13Purity:Min. 95%Molecular weight:1,223.38 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/mol4-Amino-3-methoxypyridine
CAS:<p>4-Amino-3-methoxypyridine (4AMMP) is a naturally occurring amino acid that can be found in the nuclei of innervated tissues. It is an inhibitor of the enzyme tyrosine hydroxylase and inhibits the synthesis of catecholamines. The concentration of 4AMMP in blood was measured by radioactivity. This agent has been used for studies on the thalamic nucleus and cortex, as well as for measuring catecholamine levels in tissue homogenates.</p>Formula:C6H8N2OPurity:Min. 95%Molecular weight:124.14 g/molZ-Pro-Met-OH
CAS:<p>Z-Pro-Met-OH is a potent inhibitor of protein kinases. It has been shown to be resistant to peptidyl and sulphonium activation and also inhibits trypsin and other proteases. Z-Pro-Met-OH is a chloromethane derivative that is both an inhibitor of protein kinases and a substrate for the enzyme, which generates a constant concentration of product in the presence of enzyme. Z-Pro-Met-OH is more sensitive than other inhibitors tested to date, with the exception of staurosporine. It has sequence similarity to mammalian proteins, but lacks homology with any known protein.</p>Formula:C18H24N2O5SPurity:Min. 95%Molecular weight:380.46 g/molH-Tyr-AMC·TFA
CAS:<p>Please enquire for more information about H-Tyr-AMC·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H18N2O4·C2HF3O2Purity:Min. 95%Molecular weight:452.38 g/molH-Tyr-Gly-Arg-Phe-Ser-OH·HCl
CAS:<p>Please enquire for more information about H-Tyr-Gly-Arg-Phe-Ser-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40N8O8·HClPurity:Min. 95%Molecular weight:665.14 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Formula:C81H156N10O13SPurity:Min. 95%Molecular weight:1,510.23 g/molBoc-4-Abz-OSu
CAS:<p>Please enquire for more information about Boc-4-Abz-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N2O6Purity:Min. 95%Molecular weight:334.32 g/molNeural-Cadherin (76-85) amide (chicken)
CAS:<p>Please enquire for more information about Neural-Cadherin (76-85) amide (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H75N17O13Purity:Min. 95%Molecular weight:1,050.17 g/molH-Pro-Lys-OH acetate salt
CAS:<p>H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.</p>Formula:C11H21N3O3Purity:Min. 95%Molecular weight:243.3 g/molAc-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2
CAS:<p>Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 is a synthetic chemokine that is a member of the CXC subfamily. Chemokines are small proteins that have a hydrophobic region, which allows them to insert into membranes. This chemokine has been shown to be capable of forming dimers in the presence of other chemokines and exhibits a high degree of homology with congener chemokines. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence has been shown to denature at pH 8 and has water solubility; however, it does not dissolve in lipid bilayers such as phospholipid bilayers or monolayers. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence is also stable in an Alzheimer's disease mouse model.</p>Formula:C39H59N7O6Purity:Min. 95%Molecular weight:721.93 g/mol3-Fluoro-4-methoxybenzoic acid
CAS:<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>Formula:C8H7FO3Purity:Min. 95%Color and Shape:PowderMolecular weight:170.14 g/molMyelin Basic Protein (87-99) (human, bovine, rat)
CAS:<p>Please enquire for more information about Myelin Basic Protein (87-99) (human, bovine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O17Purity:Min. 95%Molecular weight:1,555.82 g/molMethyltetrazine amine
CAS:<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>Formula:C10H11N5Purity:Min. 95%Color and Shape:PowderMolecular weight:201.23 g/mol(Tyr69,Ala71·72,Lys74)-C3a (69-77)
CAS:<p>Please enquire for more information about (Tyr69,Ala71·72,Lys74)-C3a (69-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H77N13O11Purity:Min. 95%Molecular weight:976.17 g/mol(S)-(+)-Glycidyl-4-nitrobenzoate
CAS:<p>Glycidyl-4-nitrobenzoate (GLYNB) is an opioid receptor ligand, which binds to the κ opioid receptor. It has been used in biological testing and has been shown to have affinity for the κ opioid receptor. GLYNB may be a useful tool for investigating the molecular diversity of this receptor and its function in both normal and pathological conditions.</p>Formula:C9H9NO6SPurity:Min. 95%Molecular weight:259.24 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molSuc-Ala-Gly-Pro-Phe-pNA
CAS:<p>Suc-Ala-Gly-Pro-Phe-pNA is an amide that has been synthesized for the stabilization of proteins, peptides and nucleic acids. It has shown to be effective in preventing isomerization of casein and phosphatase (casein kinase II) by stabilizing the alpha helix structure. Suc-Ala-Gly-Pro-Phe-pNA also prevents fk506 binding to endoplasmic reticulum protein tyrosine kinases and isomerizes tyrosine to phenylalanine. The tetrapeptide sequence has been shown to be similar to sequences found in cellular proteins. This compound is a synthetic analog of the natural amino acid proline and can be used as a substitute in peptides or nucleotide sequences, due to its ability to stabilize these molecules against proteolysis or hydrolysis.</p>Formula:C29H34N6O9Purity:Min. 95%Molecular weight:610.62 g/molBoc-β-cyclopropyl-Ala-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-beta-cyclopropyl-Ala-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4·C12H23NPurity:Min. 95%Molecular weight:410.59 g/molHIV Protease Substrate IV
CAS:<p>Please enquire for more information about HIV Protease Substrate IV including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H83N15O13Purity:Min. 95%Molecular weight:1,090.28 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C141H235N47O41·xC2H4O2Purity:Min. 95%Molecular weight:3,244.67 g/molH-Pro-Asn-OH
CAS:<p>H-Pro-Asn-OH is a reactive functional group that is activated by the presence of acidic conditions. It can react with epoxides to form cyclic ethers. H-Pro-Asn-OH can be used in vitro studies to assess the activation of caspases, which are proteolytic enzymes that play a role in cell apoptosis. It has also been used for molecular imaging and as an antigen for immunotherapy in cancer treatment. This molecule has a reactive functional group on its side chain and reacts with epoxides to form cyclic ethers.</p>Formula:C9H15N3O4Purity:Min. 95%Molecular weight:229.23 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N5O5·HClPurity:Min. 95%Molecular weight:534.05 g/molFmoc-L-aspartic acid β-allyl ester
CAS:<p>Fmoc-L-aspartic acid beta-allyl ester is a specific interaction between an amide and an enzyme target. It has been shown to have anti-inflammatory properties by inhibiting the activity of COX-2, which inhibits the production of prostaglandins. Fmoc-L-aspartic acid beta-allyl ester is a cyclic peptide with a lactam ring system that has been synthesized in a stepwise manner on a solid phase. This molecule interacts with cell line A549 and blocks the proliferation of cancer cells. Fmoc-L-aspartic acid beta-allyl ester also contains a disulfide bond that stabilizes its structure.</p>Formula:C22H21NO6Purity:Min. 95%Molecular weight:395.41 g/molH-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%TRH-Gly
CAS:<p>TRH-Gly Pyr-His-Pro-Gly-OH is a synthetic glucocorticoid that binds to the glucocorticoid receptor. It has been shown to be effective in inhibiting tumor growth and reducing the size of tumors in rats. TRH-Gly Pyr-His-Pro-Gly-OH has also been shown to reduce the release of calcium from intracellular stores, inhibit the biosynthesis of messenger RNA, and inhibit DNA synthesis in human tumor cells. It is used to treat patients with cancer and those with chronic obstructive pulmonary disease (COPD).</p>Formula:C18H24N6O6Purity:Min. 95%Molecular weight:420.42 g/molTRAP-5 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H51N9O6Purity:Min. 95%Molecular weight:633.78 g/molAmyloid β-Protein (1-46)
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-46) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C223H347N59O65SPurity:Min. 95%Molecular weight:4,926.57 g/molH-Arg-Ala-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Ala-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H20N6O2·2HClPurity:Min. 95%Molecular weight:317.22 g/mol4-Fluoromethyl-α-methylbenzyl alcohol
CAS:<p>4-Fluoromethyl-alpha-methylbenzyl alcohol is a nonclassical molecule that has been synthesized. This molecule has been modeled computationally and the results indicate that it exhibits a planar geometry with a diastereomeric ratio of 1:1. The theoretical calculations show that the reaction of 4-fluoromethyl-alpha-methylbenzyl alcohol with water is exothermic, which would result in the formation of an intermediate hydroxide ion. Kinetic studies have shown that this molecule can undergo transfer reactions and dehydrogenation reactions, both of which are possible mechanisms for its reactivity.</p>Formula:C8H9FOPurity:Min. 95%Molecular weight:140.15 g/molH-His-Phe-OH
CAS:<p>H-His-Phe-OH is a polypeptide that is used in the diagnosis of chronic kidney disease. It is synthesized by the chemical reaction between histidine and phenylalanine. H-His-Phe-OH has been shown to have a molecular weight of 4,000 Da, with a diameter of 5 nm. The binding constants for this molecule are 3.5 x 10^6 M^(-1), and its stability in biological fluids has been shown to be greater than 100 hours at pH 7.4, 37°C.</p>Formula:C15H18N4O3Purity:Min. 95%Molecular weight:302.33 g/mol4-Amino-5-methoxy-2-methylbenzenesulfonic acid
CAS:<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>Formula:C8H11NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:217.24 g/molType A Allatostatin I
CAS:<p>Type A Allatostatin I is a fatty acid that is synthesized in the liver and binds to the G protein-coupled receptor, alpha-MSH. Allatostatin I inhibits fatty acid synthesis and has been shown to have a protective effect on hepatic steatosis caused by methanol solvent exposure. It also has insecticidal properties which may be due to its ability to inhibit chitin synthesis in insects. Moreover, Type A Allatostatin I has shown ecological effects as an inhibitor of polymerase chain reactions (PCRs) for DNA replication. This compound also inhibits RNA synthesis in vitro at physiological levels. Type A Allatostatin I has been shown to be an endogenous factor that plays a role in obesity and diabetes, as well as its pathogenic mechanism.</p>Formula:C61H94N18O16Purity:Min. 95%Molecular weight:1,335.51 g/molFmoc-[15N]Leu-OH
CAS:<p>Fmoc-[15N]Leu-OH is a research chemical that has various applications in the field of biosynthesis and antibody production. It is commonly used in peptide synthesis and as a building block for the preparation of peptides and proteins. Fmoc-[15N]Leu-OH is known for its high purity and quality, making it an ideal choice for researchers and scientists working in the field of molecular biology. This compound can be easily dissolved in ethanol or other organic solvents, allowing for convenient use in laboratory experiments. With its unique characteristics and wide range of applications, Fmoc-[15N]Leu-OH is a valuable tool for those involved in biochemical research.</p>Formula:C21H23NO4Purity:Min. 95%Molecular weight:354.41 g/molAnthranilyl-HIV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H65N13O11Purity:Min. 95%Molecular weight:940.06 g/mol(Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H114N32O13SPurity:Min. 95%Molecular weight:1,499.8 g/molAc-Trp-Glu-His-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Trp-Glu-His-Asp-aldehyde is a tetrapeptide that has been shown to inhibit the activity of caspases. Caspases are proteases that play an important role in cell death by inducing apoptosis and necrosis. The structure of the Ac-Trp-Glu-His-Asp-aldehyde was determined by X-ray crystallography, revealing a hydrophobic molecule with a pseudo acid residue. This compound binds to peptides and blocks the binding site for caspase substrates, which prevents their activation. Acetylation of this compound also increases its hydrophobicity, making it more likely to bind to other molecules such as proteins or lipids.</p>Formula:C28H33N7O9Purity:Min. 95%Molecular weight:611.6 g/molTos-Gly-Pro-OH
CAS:<p>Tos-Gly-Pro-OH is a fluorescent histone deacetylase (HDAC) inhibitor. It has been validated as a competitive inhibitor of HDACs by using a fluorescence assay to detect the deacetylated form of 7-amino-4-methylcoumarin. Tos-Gly-Pro-OH is used in the treatment of malignant tumors, such as leukemia and lymphoma, by inhibiting HDACs that are responsible for cellular proliferation. In addition, Tos-Gly-Pro-OH may be useful in the treatment of diseases caused by bacterial infection because it inhibits bacterial HDACs that are responsible for protein synthesis and chemotaxis. This drug also inhibits trypsin activity and can be used as an alternative to nonisotopic solvents for peptide synthesis.</p>Formula:C14H18N2O5SPurity:Min. 95%Molecular weight:326.37 g/molSecretin (porcine) acetate salt
CAS:Controlled Product<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>Formula:C130H220N44O41Purity:Min. 95%Molecular weight:3,055.41 g/mol(H-Cys-Phe-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-Phe-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30N4O6S2Purity:Min. 95%Molecular weight:534.65 g/molZ-Gly-Pro-Phe-Pro-Leu-OH
CAS:<p>Please enquire for more information about Z-Gly-Pro-Phe-Pro-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H45N5O8Purity:Min. 95%Molecular weight:663.76 g/molACTH (18-39) (human)
CAS:<p>ACTH is a polypeptide hormone that regulates the release of cortisol from the adrenal cortex. ACTH (18-39) is a fragment of ACTH which binds to the glucocorticoid receptor with high affinity. The carboxy terminal sequence of ACTH (18-39) is identical to that of human ACTH and can be used as an immunogen to produce monoclonal antibodies against ACTH. The monoclonal antibodies can then be used in prognostic studies for patients with congestive heart failure, diabetic neuropathy, or k562 cells. ACTH (18-39) has an optimum pH level of 7.0 and can bind to cellular receptors at physiological concentrations. It also has a molecular weight of 4,000 Daltons and is soluble in trifluoroacetic acid and hydrogen fluoride, but not in water or methanol.</p>Formula:C112H165N27O36Purity:Min. 95%Molecular weight:2,465.67 g/molH-Phe-Pro-bNA·HCl
CAS:<p>Please enquire for more information about H-Phe-Pro-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H25N3O2·HClPurity:Min. 95%Molecular weight:423.93 g/mol5-Amino-2-methoxyisonicotinic acid
CAS:<p>5-Amino-2-methoxyisonicotinic acid is a carboxylic acid that is used in the synthesis of aminopyridines. The compound can be synthesized from formamidine acetate and diethyl dicarbonate. This process involves lithiation, followed by addition of an amine and finally conversion to the desired product with formamidine acetate. 5-Amino-2-methoxyisonicotinic acid can also be synthesized from formamide and diethyl ether. 5-Amino-2-methoxyisonicotinic acid is an analog of 2,4,6-trimethylaniline and has been shown to have similar properties to this compound, including strong basicity.</p>Formula:C7H8N2O3Purity:Min. 95%Molecular weight:168.15 g/molDnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2
CAS:<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>Formula:C38H57N15O11SPurity:Min. 95%Molecular weight:932.02 g/molH-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Thr-Ser-OH
CAS:<p>H-Thr-Ser-OH is a synthetic peptide that contains the amino acid sequence H-Thr-Ser-OH. It has been shown to have antitumor activity and antiangiogenic properties. This peptide was observed to destabilize protonated lysine residues in the tumor cell membrane, leading to increased permeability of the membrane and subsequent leakage of ions and water. The resulting cytotoxic environment leads to cancer cell death by apoptosis. HTSOH also inhibits tumor angiogenesis by inhibiting vascular endothelial growth factor (VEGF) production. HTSOH is stable at physiological pH and has been crystallized with a resolution of 1.5 Å.</p>Formula:C7H14N2O5Purity:Min. 95%Molecular weight:206.2 g/mol2-Bromo-1-methyl-4-(methylsulfonyl)benzene
CAS:<p>Please enquire for more information about 2-Bromo-1-methyl-4-(methylsulfonyl)benzene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H9BrO2SPurity:Min. 95%Molecular weight:249.13 g/molZ-Ala-Ala-OMe
CAS:<p>Z-Ala-Ala-OMe is a serine protease inhibitor that binds to serine proteases, including chymotrypsin, trypsin, and elastase. The inhibition of these enzymes prevents the hydrolysis of proteins by these enzymes, which can lead to cell death. Z-Ala-Ala-OMe has been shown to inhibit the growth of bacteria in vitro and in animal models. This compound also showed an ability to inhibit the production of phosphite by immobilized subtilisin from Bacillus licheniformis (Bacillus subtilis) with a Km value of 0.5 mM</p>Formula:C15H20N2O5Purity:Min. 95%Molecular weight:308.33 g/molHippuryl-Lys-OH
CAS:<p>Hippuryl-Lys-OH is a novel, potent and selective serine protease inhibitor that targets human cathepsin B. It has been shown to have inhibitory properties against other serine proteases such as chymotrypsin, trypsin, and elastase. Hippuryl-Lys-OH is used in the treatment of cancer patients with diabetes who require a creatine level less than 400 μM per liter of serum. It also has potential applications in the treatment of Alzheimer's disease and Parkinson's disease due to its ability to inhibit polymerase chain reactions (PCR).</p>Formula:C15H21N3O4Purity:Min. 95%Molecular weight:307.35 g/mol(Tyr0)-Stresscopin (human)
CAS:<p>Please enquire for more information about (Tyr0)-Stresscopin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H335N57O55S2Purity:Min. 95%Molecular weight:4,530.33 g/mol(Nle 35)-Amyloid b-Protein (1-40) ammonium salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-40) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H297N53O58Purity:Min. 95%Molecular weight:4,311.77 g/molN-Methyl-1,2-phenylenediamine dihydrochloride
CAS:<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>Formula:C7H12Cl2N2Purity:Min. 95%Color and Shape:PowderMolecular weight:195.09 g/molpTH (44-68) (human)
CAS:<p>Please enquire for more information about pTH (44-68) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H199N41O41Purity:Min. 95%Molecular weight:2,836.08 g/molAlarin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C119H199N45O35Purity:Min. 95%Molecular weight:2,820.14 g/molZ-β-Ala-Val-OH
CAS:<p>Please enquire for more information about Z-beta-Ala-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molAmyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H141N21O30SPurity:Min. 95%Molecular weight:1,993.24 g/molH-Ala-Ala-Ala-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N5O5·HClPurity:Min. 95%Molecular weight:387.82 g/molH-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-L-methionine - Solid
CAS:<p>Boc-L-methionine is a chemical compound that contains the amino acid methionine. It is used in solid-phase synthesis to produce cyclic peptides and proteins. Boc-L-methionine is activated by treatment with trifluoroacetic acid and then reacts with a protected amino acid to form the corresponding amide or ester, respectively. The activated carboxylic acid group of Boc-L-methionine reacts with an unprotected amino group of the amino acid to form an amide or ester linkage, respectively. The reaction products are cleaved from the resin support by hydrogen fluoride for purification.</p>Formula:C10H19NO4SPurity:Min. 95%Molecular weight:249.33 g/molpTH-Related Protein (1-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>Formula:C180H288N58O47Purity:Min. 95%Molecular weight:4,016.58 g/mol(H-Cys-Tyr-OH)2
CAS:<p>Please enquire for more information about (H-Cys-Tyr-OH)2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30N4O8S2Purity:Min. 95%Color and Shape:PowderMolecular weight:566.65 g/molFmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H38N2O7Purity:Min. 95%Color and Shape:White PowderMolecular weight:586.67 g/molIGF-I (24-41)
CAS:<p>Please enquire for more information about IGF-I (24-41) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H133N27O28Purity:Min. 95%Molecular weight:2,017.16 g/molH-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu-OH
CAS:<p>The target of H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu is the phosphotyrosine residue in tyrosine kinase. This compound has been shown to inhibit the proliferation of cells that express this type of receptor and induce apoptosis. The x-ray structures of ligand binding to the receptor show a hydrogen bond network with the hydroxyl group at position 2, which is believed to be important for binding activity. The molecular modeling studies confirm that this interaction is energetically favorable, with a ΔΔG = -6.5 kcal/mol. H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-(OH) has also been found to have antiosteoporotic properties when administered orally in rats.</p>Formula:C66H97N12O24PPurity:Min. 95%Molecular weight:1,473.52 g/mol3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid
CAS:<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>Formula:C10H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:273.08 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/molAbz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H48N12O12Purity:Min. 95%Molecular weight:828.83 g/molH-Ala-Ala-Tyr-OH
CAS:<p>Please enquire for more information about H-Ala-Ala-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N3O5Purity:Min. 95%Molecular weight:323.34 g/molH-Leu-Ala-Leu-Ala-OEt·HCl
CAS:<p>Please enquire for more information about H-Leu-Ala-Leu-Ala-OEt·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H38N4O5·HClPurity:Min. 95%Molecular weight:451 g/molDynorphin B (1-9)
CAS:<p>Please enquire for more information about Dynorphin B (1-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H78N16O12Purity:Min. 95%Molecular weight:1,143.3 g/molBiotinyl-Somatostatin-14
CAS:<p>Please enquire for more information about Biotinyl-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H118N20O21S3Purity:Min. 95%Molecular weight:1,864.18 g/mol(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat)
CAS:<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H254N50O36Purity:Min. 95%Molecular weight:3,478.07 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/molZ-Ala-Pro-Tyr-OH
CAS:<p>Please enquire for more information about Z-Ala-Pro-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29N3O7Purity:Min. 95%Molecular weight:483.51 g/mol1,2-Dilauroyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Dilauroyl-rac-glycero-3-phosphocholine (DLPC) is a synthetic phospholipid that exhibits significant cytotoxicity against hyperproliferative cells. DLPC has been shown to inhibit the activity of the enzyme sphingosine 2-phosphate (S2P) and cell factor, both of which are important in signal transduction pathways. DLPC is capable of inducing phase transition at a temperature close to body temperature, making it biocompatible for use as a topical or injectable drug. It has also been shown to be effective in treating infectious diseases such as HIV and malaria, due to its ability to bind with basic proteins found on the surface of these viruses.</p>Formula:C32H64NO8PPurity:Min. 95%Molecular weight:621.83 g/molBPP 9a Pyr-Trp-Pro-Arg-Pro-Gln-Ile-Pro-Pro-OH
CAS:<p>BPP 9a is an enzyme inhibitor that binds to the active site of angiotensin-converting enzyme (ACE) and blocks its activity. It is a nonsteroidal anti-inflammatory drug that has been shown to be effective in reducing inflammation and pain associated with arthritis, osteoarthritis, gout, and menstrual cramps. BPP 9a has also been shown to reduce blood pressure in a dose-dependent manner, which may be due to its ability to inhibit the synthesis of angiotensin II from angiotensin I. This inhibition may lead to decreased vascular tone and blood pressure. BPP 9a has also been shown to have beneficial effects on bowel disease and polymerase chain reaction (PCR) analysis of DNA.</p>Formula:C53H76N14O12Purity:Min. 95%Molecular weight:1,101.26 g/mol2-Methyl-5-chloromethylpyridineHydrochloride
CAS:<p>Please enquire for more information about 2-Methyl-5-chloromethylpyridineHydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H9Cl2NPurity:Min. 95%Molecular weight:178.06 g/molFmoc-b-cyano-L-alanine
CAS:<p>Please enquire for more information about Fmoc-b-cyano-L-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H16N2O4Purity:Min. 95%Molecular weight:336.34 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N4O5Purity:Min. 95%Molecular weight:302.33 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/mol(D-Arg1,D-Pro2,D-Trp7·9,Leu11)-Substance P
CAS:<p>Substance P is a tachykinin that is released from the nerve endings of the parasympathetic nervous system. It binds to receptors in the plasma membrane of cells and causes them to release acetylcholine, which is an inhibitory neurotransmitter. Substance P also has been shown to interact with muscle cells and cause contractions. The incubation of Substance P with muscle cells inhibits the release of calcium ions, which reduces the membrane potential and decreases the contractility of these cells.</p>Formula:C75H108N20O13Purity:Min. 95%Molecular weight:1,497.79 g/molAnantin (linear sequence) trifluoroacetate salt
CAS:<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H113N21O25Purity:Min. 95%Molecular weight:1,888.99 g/molH-Val-Phe-OH
CAS:<p>H-Val-Phe-OH is a peptide consisting of three amino acids, Valine, Phenylalanine and Hydroxyproline. It is a small molecule that has been shown to have an antihypertensive effect in rats. H-Val-Phe-OH binds to the dihydropyridine receptor on the cell membrane surface, which causes blood vessels to relax and contract. This action leads to decreased blood pressure. The high reactivity of H-Val-Phe-OH with other molecules makes it biodegradable, which means it can be broken down by water or enzymes into smaller molecules that are less harmful to the environment.</p>Formula:C14H20N2O3Purity:Min. 95%Molecular weight:264.32 g/mol(Arg8,des-Gly-NH29)-Vasopressin
CAS:<p>Vasopressin is a hormone that is released from the posterior pituitary gland and stimulates the release of water from the kidneys. Vasopressin binds to receptors in the kidney tubules and increases water permeability and urine volume. Vasopressin also has been shown to be effective in reducing sensitivity to ionizing radiation, which may be due to its ability to bind with sulfur-containing amino acids such as cysteine and glutathione. The radiolabeled form of vasopressin is used as a tracer for measuring lung function, including volumes of air flow, gas density, and gas volume.</p>Formula:C44H61N13O12S2Purity:Min. 95%Molecular weight:1,028.17 g/molFmoc-S-trityl-L-penicillamine
CAS:<p>Fmoc-S-trityl-L-penicillamine is a coordination compound that contains a thiolate and amide group. It has been used as a model system for studying the interaction between proteins and metal ions, with the cyclic structure mimicking the active site of enzymes. The coordination of Fmoc-S-trityl-L-penicillamine to proteins is affected by trypsin, an enzyme that cleaves peptides at carboxyl side chains. Trypsin can also lead to dehydration of Fmoc-S-trityl-L-penicillamine, forming an eliminations product. This compound also reacts with lysine residues in proteins, resulting in an alkene byproduct that can be removed by hydrogenation.</p>Formula:C39H35NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:613.77 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molH-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2
CAS:<p>H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 is a compound which is structurally related to the amino acid histidine. It has been used as an indicator for Xanthochromia, a diagnostic for copper. H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 has also been used in polyester production and as a monitoring agent for modifications of polylactic acid thermally.</p>Formula:C40H69N11O8Purity:Min. 95%Molecular weight:832.05 g/molAmyloid β-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H285N51O54SPurity:Min. 95%Molecular weight:4,143.64 g/molpTH-Related Protein (1-34) (human, mouse, rat)
CAS:<p>PTH-Related Protein (1-34) is a potent antagonist of the PTH/PTHrP receptor, which belongs to the family of peptide hormones. It can be used for the treatment of osteoporosis and certain types of cancer. It inhibits bone resorption by binding to the receptor in bone cells and blocking PTH/PTHrP-induced activation of phosphaturic acid phosphatase. This drug also inhibits the production of insulin-like growth factor I (IGF-I) and its receptors, which may lead to an anti-cancer effect. PTH-Related Protein (1-34) has been shown to have a high specificity for the PTH/PTHrP receptor, with moderate affinity for other receptors such as glucagon and somatostatin. The peptide is amphipathic, meaning it has both hydrophilic and hydrophobic regions. This characteristic allows it to penetrate cell membranes more easily than other</p>Formula:C180H287N57O48Purity:Min. 95%Molecular weight:4,017.56 g/mol(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone
CAS:<p>(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone is an organic compound that belongs to the class of carbonyl reductase. It is used as a catalyst for the transformation of secondary alcohols to ketones or aldehydes, including isopropyl alcohol. The reaction proceeds via an intermediate carboxylic acid. The enzyme has been found in various microorganisms, and can be purified from Bacillus megaterium and Streptomyces lividans. The enzyme’s activity can be inhibited by steric effects, metal ions, or other compounds. (3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone crystallizes in two forms: one with the chiral center at the 3 position and one with it at the 4 position.</p>Purity:Min. 95%Fmoc-octyl-D-Gly-OH
CAS:<p>Fmoc-octyl-D-Gly-OH is a supramolecular polymer with a wide range of applications, including oil recovery and as a nanomaterial. Fmoc-octyl-D-Gly-OH is synthesized by the ring opening polymerization of octylglycol with D,L lactic acid. It has been shown to be an effective emulsifier in water, which may be due to its synergistic effect with other molecules. Fmoc-octyl-D-Gly-OH also has the ability to self assemble into a variety of morphologies such as nanoribbons, nanowires, and gel networks. This polymer can also be used as a hydrogenation catalyst for organic synthesis reactions that require high pressures and temperatures. Fmoc-octyl-D-Gly-OH has also been used in the production of ultrasonication devices for use in medicine.</p>Formula:C25H31NO4Purity:Min. 95%Molecular weight:409.52 g/molH-Ala-Phe-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Phe-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H20N4O4·HClPurity:Min. 95%Molecular weight:392.84 g/mol(Phe1,Ser2)-TRAP-6 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molCortistatin-29 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C161H240N46O41S2Purity:Min. 95%Molecular weight:3,540.05 g/molH-Gly-Ala-Pro-AFC
CAS:<p>Please enquire for more information about H-Gly-Ala-Pro-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H21F3N4O5Purity:Min. 95%Molecular weight:454.4 g/molZ-Phe-Leu-OH
CAS:<p>Z-Phe-Leu-OH is a protease inhibitor that belongs to the group of peptidyl-protease inhibitors. It inhibits the activity of a wide range of proteases and is specifically active against carboxypeptidases A and B. Z-Phe-Leu-OH has been shown to be specific for these enzymes, with no inhibitory activity against other proteases such as aminopeptidases, serine proteases, or metalloproteases. The amino acid composition of this protease inhibitor is different from other inhibitors that have been studied in detail. This agent was found to be more effective than phenylmethylsulfonyl fluoride (PMSF) at inhibiting carboxypeptidase A and B.<br>Z-Phe-Leu-OH has been shown to be an acidic compound with a pKa of 5.5; however, it does not react with chloromethyl ketone</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molH-D-Glu(Trp-OH)-OH
CAS:<p>H-D-Glu(Trp-OH)-OH is a synthetic peptide that has been shown to inhibit the replication of the herpes simplex virus (HSV). It binds to toll-like receptor 3 and 4 on cells, which may inhibit HSV replication. This compound has also been shown to be a potent inhibitor of HIV, as well as hepatitis B and C. H-D-Glu(Trp-OH)-OH has been shown to cause lung damage in mice. The mechanism for this effect is unknown, but it may involve an increase in reactive oxygen species or other cell signaling pathways.</p>Formula:C16H19N3O5Purity:Min. 95%Molecular weight:333.34 g/molSuc-Ala-Phe-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Ala-Phe-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H39N5O8·C2HF3O2Purity:Min. 95%Molecular weight:735.7 g/molN-(Hydroxymethyl)-phenylacetamide
CAS:<p>N-(Hydroxymethyl)-phenylacetamide is an organic solvent that is used in the synthesis of certain antibiotics. It is a synthetic compound and can be obtained by reacting toluene with benzene, using a strong acid catalyst such as sulfuric acid. N-(Hydroxymethyl)-phenylacetamide has been used in the synthesis of isoquinolones, which are also antibiotics. This organic solvent can also be used for recrystallization, which is a process that helps purify solids from liquids or liquids from solids. The yield of this reaction is high, making it an efficient way to synthesize these compounds.</p>Formula:C9H11NO2Purity:Min. 95%Molecular weight:165.19 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/mol(Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molAloc-OSu
CAS:<p>Aloc-OSu is a glycosylated glycopeptide antibiotic that belongs to the class of degradable antibiotics. The drug binds to the enzyme UDP-N-acetylglucosamine:glycoprotein glucosyltransferase, thereby inhibiting bacterial cell wall synthesis. Aloc-OSu has been shown to be effective against methicillin resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. Aloc-OSu has shown anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis.</p>Formula:C8H9NO5Purity:Min. 95%Molecular weight:199.16 g/molZ-Ala-Pro-Phe-chloromethylketone
CAS:<p>Z-Ala-Pro-Phe-chloromethylketone is a cytosolic protein that performs its function by denaturing proteins and is localized in the cytosol. It has been shown to be active against a number of bacteria, including Bacillus licheniformis and Listeria monocytogenes, as well as some fungi. Z-Ala-Pro-Phe-chloromethylketone targets the membrane potential in mitochondria and chloromethyl ketone is a strategy for inhibiting membrane potential in mitochondria. The x-ray diffraction data show that this protein forms a molecule with an alpha helix structure. It binds to the mitochondrial inner membrane by ligation and inhibits mitochondrial membrane potential.</p>Formula:C26H30ClN3O5Purity:Min. 95%Molecular weight:499.99 g/molH-Leu-Leu-Tyr-OH
CAS:<p>H-Leu-Leu-Tyr-OH is a water soluble polymer that is produced by the enzymatic polymerization of L-leucine and L-tyrosine. This polymer is cytotoxic and has been shown to bind to DNA in the cell nucleus, as well as inhibit protein synthesis. H-Leu-Leu-Tyr-OH was developed as an alternative to polyethylene glycol (PEG) due to its low toxicity, high biocompatibility, and ability to be easily synthesized.</p>Formula:C21H33N3O5Purity:Min. 95%Molecular weight:407.5 g/molZ-Leu-Met-OH
CAS:<p>Please enquire for more information about Z-Leu-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N2O5SPurity:Min. 95%Molecular weight:396.5 g/molAc-Ile-Glu-Pro-Asp-pNA
CAS:<p>Ac-Ile-Glu-Pro-Asp-pNA is a synthetic peptide that has been shown to induce apoptosis in tumor cells. The peptide was found to cause cell lysis and necrotic cell death, which is associated with the activation of serine proteases. Ac-Ile-Glu-Pro-Asp-pNA also has been shown to have a toxicity profile similar to other apoptotic agents such as staurosporine, but it has not been tested for its ability to kill cancer cells without causing damage to healthy cells. Ac-Ile-Glu-Pro-Asp-pNA induces mitochondrial membrane depolarization and protein synthesis inhibition in K562 cells, which are human erythroleukemia cells. This peptide also has shown an ability to bind with monoclonal antibodies and inhibit the growth of casein.</p>Formula:C28H38N6O11Purity:Min. 95%Molecular weight:634.64 g/molBoc-Lys(2-chloro-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3,5-Dichloro-4-methylpyridine
CAS:<p>Please enquire for more information about 3,5-Dichloro-4-methylpyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H5Cl2NPurity:Min. 95%Molecular weight:162.02 g/molH-Arg-Arg-Arg-Arg-OH acetate salt
CAS:<p>Acetate salt</p>Formula:C24H50N16O5Purity:Min. 95%Molecular weight:642.76 g/molZ-Val-Ala-OMe
CAS:<p>Z-Val-Ala-OMe is an anti-leishmanial agent that has been shown to be a more efficient method for the treatment of leishmaniasis than current treatments. It inhibits the growth of Leishmania by inhibiting serine proteases, which are involved in the formation of amorphous material on the surface of these parasites. Z-Val-Ala-OMe is active against both subtilis and licheniformis, with a residue half life of 3 hours at pH 5.5 and 20 degrees Celsius. This drug binds to the surface of Leishmania parasites and inhibits their ability to metabolize phosphite into ethyl esters.<br>The kinetic data obtained from Z-Val-Ala-OMe was measured using immobilized cells in a microtiter plate assay system. The data collected was used to generate a graph showing an initial burst phase followed by a linear phase for up to 72 hours post incubation with the drug</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molH-Pro-Leu-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H26N4O5Purity:Min. 95%Molecular weight:342.39 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS:<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O6Purity:Min. 95%Molecular weight:481.55 g/molH-Ala-His-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H19N5O4Purity:Min. 95%Molecular weight:297.31 g/molFmoc-Tyr(SO3H)-OH barium salt
CAS:<p>Please enquire for more information about Fmoc-Tyr(SO3H)-OH barium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H21NO8SPurity:Min. 95%Molecular weight:483.49 g/molH-Ala-Pro-4MbetaNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Pro-4MbetaNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H23N3O3·HClPurity:Min. 95%Molecular weight:377.86 g/mol3’’’-Epi-Empagliflozin
CAS:<p>Please enquire for more information about 3’’’-Epi-Empagliflozin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27ClO7Purity:95% MinColor and Shape:PowderMolecular weight:450.91 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H179N35O28SPurity:Min. 95%Molecular weight:2,591.99 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/molZ-His-Phe-Phe-OEt
CAS:<p>Z-His-Phe-Phe-OEt is a synthetic, polyacrylamide gel-based experiment that determines the amino acid composition of imidazolium zymogens. This experiment utilizes an ion-exchange chromatography technique to separate and identify peptides. The solvents used in this experiment are acetone and ion-exchange chromatography. In order to carry out this experiment, one must first dissolve the polyacrylamide gel in a system of solvents with a pH of 7.5 or lower in order to create an electrofocusing environment. This solution is then applied to the polyacrylamide gel, which will form a solid film when dried. The imidazolium zymogen can then be cleaved by pepsin, yielding peptides that can be analysed using mass spectrometry.</p>Formula:C34H37N5O6Purity:Min. 95%Molecular weight:611.69 g/molUrinary Trypsin Inhibitor Fragment
CAS:<p>Urinary Trypsin Inhibitor Fragment H-Arg-Gly-Pro-Cys-Arg-Ala-Phe-Ile-OH is a synthetic peptide that is used as a diagnostic agent. It has been shown to inhibit proinflammatory cytokines in vitro and in vivo. This peptide binds to the amino acid sequences of phospholipase A2, which are found in tumor cells, and can be used for cancer diagnosis. Urinary Trypsin Inhibitor Fragment H-Arg-Gly-Pro-Cys-Arg-Ala-Phe-Ile-OH also binds to DNA methylation, which may be useful for studying DNA methylation patterns in cancer cells.</p>Formula:C40H66N14O9SPurity:Min. 95%Molecular weight:919.11 g/molDABCYL-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H97N17O18SPurity:Min. 95%Molecular weight:1,532.72 g/molBoc-Phe-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Leu-Arg-AMC HCl
CAS:<p>Please enquire for more information about Z-Leu-Arg-AMC HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H38N6O6Purity:Min. 95%Molecular weight:578.66 g/molPyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/mol3-Boc-amino-2,6-dioxopiperidine
CAS:<p>Please enquire for more information about 3-Boc-amino-2,6-dioxopiperidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H16N2O4Purity:Min. 95%Molecular weight:228.25 g/molFmoc-Glu(OtBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%L-Lysine L-malate
CAS:<p>L-Lysine L-malate is a chemical compound that is used in wastewater treatment. It inhibits the activity of enzymes such as carbon disulphide oxidase, copper complexes, and cationic surfactants. L-Lysine L-malate can be synthesized from sodium citrate and malonic acid by reacting with hydrogen peroxide to form a bicyclic heterocycle. This compound has been shown to have biological effects on metabolic disorders in animal studies, which may be due to its ability to inhibit the synthesis of fatty acids and proteins. The adsorption mechanism for this product is unknown.</p>Formula:C6H14N2O2·C4H6O5Purity:Min. 95%Color and Shape:White PowderMolecular weight:280.28 g/molH-Ala-Gly-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Ala-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19N5O6Purity:Min. 95%Molecular weight:317.3 g/molH-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molN-Me-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-Me-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H29N3O2Purity:Min. 95%Molecular weight:319.44 g/molFmoc-Ser(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Biotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/molN-Boc-3-Azetidinol
CAS:<p>This linker is chemically stable and not cleavable under standard intracellular or extracellular conditions. N-Boc-3-Azetidinol is also a versatile organic intermediate used primarily in the pharmaceutical industry for synthesizing a wide range of drugs, including antibacterials, immunosuppressants, and cancer therapies.</p>Formula:C8H15NO3Purity:Min. 95%Molecular weight:173.21 g/molH-D-Glu(pNA)-OH
CAS:<p>Please enquire for more information about H-D-Glu(pNA)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H13N3O5Purity:Min. 95%Molecular weight:267.24 g/molFmoc-N-methyl-L-valine
CAS:<p>Fmoc-N-methyl-L-valine is a synthetic immunosuppressant that acts by inhibiting the production of cytokines and other inflammatory mediators. It binds to the enzyme cyclooxygenase, which is involved in the synthesis of prostaglandins and thromboxanes. Fmoc-N-methyl-L-valine has been shown to be effective against gram-positive bacteria. This compound also inhibits xanthine oxidase and may act as an analog for azathioprine, which is used in the treatment of autoimmune diseases such as rheumatoid arthritis. The reaction mechanism for this compound is not well understood but appears to involve a nucleophilic attack on a benzoquinoneiminium cation formed from the attack on an electron deficient benzene ring with a triphosgene electrophile.</p>Formula:C21H23NO4Purity:Min. 95%Molecular weight:353.41 g/molBoc-Cholecystokinin Octapeptide (desulfated)
CAS:<p>Please enquire for more information about Boc-Cholecystokinin Octapeptide (desulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H70N10O15S2Purity:Min. 95%Molecular weight:1,163.32 g/molZ-Leu-Ser-OMe
CAS:<p>Please enquire for more information about Z-Leu-Ser-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H26N2O6Purity:Min. 95%Molecular weight:366.41 g/mol1-[(3,3-Diphenylpropyl)methylamino]-2-methyl-2-propanol
CAS:<p>1-[(3,3-Diphenylpropyl)methylamino]-2-methyl-2-propanol is an epoxy that can be synthesized from benzene and lercanidipine. It has been used in the production of cinnamic acid and other molecules. This molecule can be prepared by reacting cinnamic acid with chloromethyl methyl ether in a ring-opening reaction. The chloride ion is utilized as a nucleophile to react with the amide nitrogen atom of the cinnamic acid molecule to form the amide bond. The large-scale production of 1-[(3,3-diphenylpropyl)methylamino]-2-methyl-2-propanol utilizes refluxing to remove water and other byproducts that are formed during the process.</p>Formula:C20H27NOPurity:Min. 95%Molecular weight:297.43 g/molZ-Lys(Fmoc)-OH
CAS:<p>Please enquire for more information about Z-Lys(Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N2O6Purity:Min. 95%Molecular weight:502.56 g/molH-Cys(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Asp-Ala-His-Lys-OH
CAS:<p>Please enquire for more information about H-Asp-Ala-His-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H31N7O7Purity:Min. 95%Molecular weight:469.49 g/molFor-Met-Lys-OH
CAS:<p>Please enquire for more information about For-Met-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23N3O4SPurity:Min. 95%Molecular weight:305.39 g/molAc-Glu-pNA
CAS:<p>Ac-Glu-pNA is a synthetic substrate that is used in protease assays. Its amino acid sequence contains reactive groups, such as the carboxy terminal, that are cleaved by proteases. Ac-Glu-pNA has been shown to be a good substrate for thermophilic and licheniformis proteases and has been reported to be stable at neutral pH values.</p>Formula:C13H15N3O6Purity:Min. 95%Molecular weight:309.27 g/molH-Met-Glu-OH
CAS:<p>H-Met-Glu-OH is a synthetic substance that inhibits the activity of cytochrome P450. It binds to cells, specifically platelets, and causes degranulation and activation of calcium ion channels. This leads to an increase in intracellular calcium ions that triggers blood clotting. H-Met-Glu-OH has been shown to be effective in treating cardiovascular diseases such as high blood pressure and heart arrhythmia. Clopidogrel is often used with H-Met-Glu-OH to prevent platelet aggregation, which would otherwise block the effectiveness of H-Met-Glu-OH.<br>H-Met-Glu has a high affinity for collagen and binds more efficiently to platelets than other cell types. This binding is reversible, which allows for repeated doses without causing toxicity or adverse effects on healthy cells.</p>Formula:C10H18N2O5SPurity:Min. 95%Molecular weight:278.33 g/molH-Phe-AMC trifluoroacetate salt
CAS:<p>H-Phe-AMC Trifluoroacetate salt is a synthetic, protease inhibitor that inhibits the activity of serine and cysteine proteases. It binds to the active site of these enzymes and blocks their function. H-Phe-AMC trifluoroacetate salt has been used in food chemistry to hydrolyze proteins, and can be used to measure enzyme activities. This product also has been shown to have biological functions such as the inhibition of molting, physiological function, and the prevention of carcinogenesis.</p>Formula:C19H18N2O3Purity:Min. 95%Molecular weight:322.36 g/molHIV-1 tat Protein (1-9)
CAS:<p>Tat is a protein from the human immunodeficiency virus type 1 (HIV-1) that is responsible for the regulation of viral gene expression. Tat binds to a cellular receptor, CD4, and enters the cell. The Tat protein forms a ternary complex with transcription factors and RNA polymerase II. This complex then binds to promoter regions of HIV genes and initiates transcription. Tat has been postulated to modulate immune functions such as chemokine production, T-cell activation, and macrophage activation. The HIV-1 tat Protein (1-9) H-Met-Asp-Pro-Val-Asp-Pro-Asn-Ile-Glu-OH has been shown to have an effect on the immune system by affecting chemokines and other immune functions.</p>Formula:C43H68N10O17SPurity:Min. 95%Molecular weight:1,029.12 g/molSuc-Gly-Pro-AMC
CAS:<p>AMC-conjugated molecule targeting the fibroblast activation protein (FAP)</p>Formula:C21H23N3O7Purity:Min. 95%Molecular weight:429.42 g/molH-Val-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu-OH
CAS:<p>H-Val-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu (HVLAHR) is a synthetic peptide that has been shown to have antiinflammatory properties. The peptide binds to the epidermal growth factor receptor (EGFR) and inhibits the production of proinflammatory cytokines and chemokines, such as IL1α, IL6, IL8, and TNFα. HVLAHR also binds to calmodulin and inhibits protein kinase C (PKC) activity. It has been shown that this peptide has neuroprotective effects in vitro by binding to neurogranin and inhibiting protein phosphorylation. HVLAHR can be used as a model organism in vitro to study protein kinase activity.</p>Formula:C51H100N22O11Purity:Min. 95%Molecular weight:1,197.48 g/molZ-D-Phe-Phe-Gly-OH
CAS:<p>Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.</p>Formula:C28H29N3O6Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:503.55 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/molBoc-Val-Arg-AMC•HCl
CAS:<p>Please enquire for more information about Boc-Val-Arg-AMC•HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H38N6O6•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:567.08 g/mol(D-Arg6)-Dynorphin A (1-13)
CAS:<p>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe-Leu <br>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe is a synthetic substrate for κ opioid receptors. It also has antinociceptive properties and may be used as a potential analgesic drug. Dynorphin A (1-13) H-Tyr-Gly-Gly <br>Dynorphin A (1-13) H Tyr Gly Gly Phe Leu D Arg Arg Arg Ile Arg Pro Lys Leu Lys OH has been shown to be effective in the treatment of humans and rats with cardiac or physiological function problems. Dynorphin A (1 13) H Tyr Gly Gly Phe Leu D Arg Arg Arg Ile Arg Pro Lys Leu Lys OH increases serum prolactin levels in humans, which may indicate that it stimulates the hypothalamus to</p>Formula:C75H126N24O15Purity:Min. 95%Molecular weight:1,603.96 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/molH-Gly-Tyr-NH2 acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19N3O5Purity:Min. 95%Molecular weight:297.31 g/molH-His-Phe-bNA·2 HCl
CAS:<p>Please enquire for more information about H-His-Phe-bNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H25N5O2·2HClPurity:Min. 95%Molecular weight:500.42 g/molNeuropeptide Y (2-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H278N54O55Purity:Min. 95%Molecular weight:4,090.47 g/molFmoc-Cit-OPfp
CAS:<p>Please enquire for more information about Fmoc-Cit-OPfp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H22F5N3O5Purity:Min. 95%Molecular weight:563.47 g/mol(D-Lys(nicotinoyl)1,b-(3-pyridyl)-Ala3,3,4-dichloro-D-Phe5,Asn6,D-Trp7·9, Nle 11)-Substance P trifluoroacetate salt
CAS:<p>Substance P is a tachykinin neuropeptide that belongs to the tachykinin family. It is found in the central and peripheral nervous system and has been shown to have an important role in locomotor activity, protein synthesis, receptor activity, and neurotransmitter release. Substance P is also associated with a number of diseases such as infectious diseases, sciatic nerve pain, and vasoactive intestinal peptide (VIP) production. This substance has been used for the diagnosis of neurogenic bladder dysfunction by measuring its effects on urinary bladder contractility.</p>Formula:C86H104Cl2N18O13Purity:Min. 95%Molecular weight:1,668.76 g/molH-Lys(2-chloro-Z)-OBzl·HCl
CAS:<p>Please enquire for more information about H-Lys(2-chloro-Z)-OBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H25ClN2O4·HClPurity:Min. 95%Molecular weight:441.35 g/molFmoc-Ile-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O6Purity:Min. 95%Molecular weight:480.55 g/molH-DL-Met-bNA·HCl
CAS:<p>Please enquire for more information about H-DL-Met-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H18N2OS·HClPurity:Min. 95%Molecular weight:310.84 g/molH-Pro-Gly-Pro-OH
CAS:<p>H-Pro-Gly-Pro-OH is a peptide that is derived from the sequence of human proline-glycine-proline (HGP). It has been shown to have a number of physiological activities, including anti-inflammatory effects. This peptide can be used as a model compound for inflammatory genes and proteins. H-Pro-Gly-Pro-OH has been shown to inhibit the synthesis of inflammatory cytokines in mouse splenocytes and neutrophil recruitment in wild type mice. HGP also suppresses chemotactic activity and inhibits neutrophil migration in an experimental model. HGP has also been shown to reduce intracellular calcium concentration in cerebellar granule cells, which may be due to its ability to inhibit protein synthesis.</p>Formula:C12H19N3O4Purity:Min. 95%Molecular weight:269.3 g/molH-Gly-Lys-His-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Lys-His-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H24N6O4Purity:Min. 95%Molecular weight:340.38 g/molAc-α-benzyl-muramyl-Ala-D-Glu(Lys(trans-(3-nitrocinnamoyl))-NH2)-NH2
CAS:<p>Please enquire for more information about Ac-alpha-benzyl-muramyl-Ala-D-Glu(Lys(trans-(3-nitrocinnamoyl))-NH2)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H56N8O14Purity:Min. 95%Molecular weight:884.93 g/molFluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H45FN4O16Purity:Min. 95%Molecular weight:892.83 g/molH-Met-Thr-OH
CAS:<p>Met-Thr-OH is a peptide binding inhibitor that is used as a research tool for determining the role of metalloproteins in vivo. Methionine aminopeptidase (MetAP) is an enzyme that cleaves methionine from protein and peptides and has been shown to play a vital role in cancer progression. MetAP has been shown to be inhibited by Met-Thr-OH, which binds to the enzyme's active site and blocks its activity. The inhibition of MetAP limits the production of proteins involved in cell growth and proliferation, leading to reductions in tumor size. This inhibition may also be due to the inhibition of other functional groups such as phosphorylation, dephosphorylation, or nitrosylation.</p>Formula:C9H18N2O4SPurity:Min. 95%Molecular weight:250.32 g/mol3-Hydroxy-3-methylglutaric acid
CAS:<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>Formula:C6H10O5Purity:Min. 95%Molecular weight:162.14 g/molH-Glu-Tyr-OH
CAS:<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>Formula:C14H18N2O6Purity:Min. 95%Molecular weight:310.3 g/molSuc-Phe-Gly-Leu-betaNA
CAS:<p>Suc-Phe-Gly-Leu-betaNA is a synthetic peptide that has been shown to bind to glutathione, an antioxidant. It is used in a method for determining the concentration of antioxidants in a sample by injection into the gas phase. The chemical ionisation (CI) and electrospray ionisation (ESI) are used to produce ions from the peptide. The compounds are then separated using chromatography before being quantified by measuring their mass using a mass spectrometer. This process is repeated until all of the antioxidant has been eluted from the column.</p>Formula:C31H36N4O6Purity:Min. 95%Molecular weight:560.64 g/molMbs-D-Arg-OH
CAS:<p>Please enquire for more information about Mbs-D-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H20N4O5SPurity:Min. 95%Molecular weight:344.39 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molProcathepsin B (26-50) (rat)
CAS:<p>Please enquire for more information about Procathepsin B (26-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H198N34O33SPurity:Min. 95%Molecular weight:2,713.16 g/molNeuromedin S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C193H307N57O49SPurity:Min. 95%Molecular weight:4,241.92 g/molH-Ala-D-Glu(Lys-D-Ala-D-Ala-OH)-OH
CAS:<p>Teicoplanin is an amide-linked glycopeptide antibiotic that binds to the bacterial cell wall. It is used for the treatment of infections caused by staphylococci and p. aeruginosa, which are resistant to other antibiotics. The drug binds to a specific site on the bacterial cell wall, forming a coordination complex with the peptidoglycan layer and making it easier for water molecules to penetrate the cell wall. This leads to increased rates of cell death by osmosis. Teicoplanin enhances the activity of other antibiotics against Gram-positive bacteria by preventing their binding to penicillin-binding proteins in the bacterial cell walls.</p>Formula:C20H36N6O8Purity:Min. 95%Molecular weight:488.54 g/mol2,9-Bis(2-Phenylethyl)anthra(2,1,9-def:6,5,10-d'e'f')diisoquinoline-1,3,8,10(2H,9H)-tetrone
CAS:<p>2,9-Bis(2-phenylethyl)anthraquinone (BPAQ) is a synthetic compound that is used as an fluorescent probe to study biological processes. BPAQ binds to peptides and inhibits their binding to the surface of cells. This property has been used in diagnostic tests for stenosis, infantum, and other conditions. BPAQ has also been shown to inhibit HIV-1 replication in human cells by binding to the HIV-1 envelope protein gp120 and blocking its interaction with CD4 receptors on host cells. The discovery of the antiviral activity of BPAQ was based on its ability to inhibit leishmania growth in animals.</p>Formula:C40H26N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:598.65 g/mol4-Chloro-6-methyl-2-trifluoromethylpyrimidine
CAS:<p>Please enquire for more information about 4-Chloro-6-methyl-2-trifluoromethylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4ClF3N2Purity:Min. 95%Molecular weight:196.56 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molFmoc-D-Gln(Mtt)-OH
CAS:<p>Fmoc-D-Gln(Mtt)-OH is a chiral, homologous protonated amino acid that has been synthesized. The configuration of the proton has not yet been determined and postulated as either R or S. The reagent can be used to probe the configuration of the proton by determining its chemical shift in a series of experiments. This compound is synthesized from D-glucamine and Mtt, which are both commercially available compounds. Fmoc-D-Gln(Mtt)-OH is easily soluble in organic solvents, such as ethanol, methanol, and dichloromethane. It is also stable under acidic conditions.</p>Formula:C40H36N2O5Purity:Min. 95%Molecular weight:624.72 g/mol
