Amino Acids (AA)

<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Ala-NH2 is a peptide that has been modified. Z-Ala-Ala-NH2 is a hydrolase and has the ability to hydrolyze peptides. It can be used in organic solvents as an unmodified hydrolase, or it can be modified with a nucleophile (such as an amine) to produce an active hydrolase. The unmodified form of Z-Ala-Ala-NH2 has been shown to have high yields and specificity for peptidyl substrates. This modification is also useful for the synthesis of amide bonds in peptides, which are more stable than ester bonds.</p>

<p>Please enquire for more information about Z-DL-Lys(Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Cholecystokinin Octapeptide (2-8) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>

<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>

<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hirudin (55-65) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Trp-Pro-Phe-pNA is a cyclosporine analog that inhibits the activity of protein isomerases. It has been shown to inhibit the phosphatase activity of casein and stabilize peptide bonds in bovine serum albumin. Suc-Ala-Trp-Pro-Phe-pNA can also be used as a substrate for tyrosine kinase and amide bond formation. Suc-Ala-Trp-Pro-Phe-pNA is an inhibitor of FK506 binding to its receptor, which may be due to its ability to compete with tyrosine residues for binding sites. This compound also exhibits stabilization effects on protein structures by inhibiting the degradation of proteins by proteolytic enzymes or other chemical agents.</p>

<p>Please enquire for more information about N-Acetyl-[Cys4,10, D-Phe7]-alpha-Melanocyte Stimulating Hormone Fragment 4-13 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>

<p>Please enquire for more information about Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Arg-Gly-Asp-Trp-OH is a cyclic peptide that has been shown to bind to staphylococcal cells, inhibiting their growth. The peptide was found to have proton binding and membrane interactions. This drug has shown efficacy in biological samples such as collagen and fibrinogen. H-D-Arg-Gly-Asp-Trp-OH also can be activated by a disulfide bond. It has been found to bind with monoclonal antibodies and model systems.</p>

<p>Please enquire for more information about H-Ala-Ala-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>

<p>Please enquire for more information about Tyr-Somatostatin-28 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fluorogenic dye targeting caspase 3</p>

<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>

<p>Please enquire for more information about Bz-Arg-Gly-Phe-Phe-Pro-4MbetaNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr4,D-Phe12)-Bombesin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Tritylglycine is an acidic amino acid that can be protonated in a highly acidic environment. It has been shown to inhibit the growth of tumor tissue by inducing apoptosis and inhibiting protein synthesis. N-Tritylglycine is used as a reagent for analytical chemistry, where it is used to detect amines such as histamine and serotonin. N-Tritylglycine also has been shown to be potent inhibitor of kinesin.</p>

<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>

<p>Please enquire for more information about Fmoc-Orn (Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Fluoro-2-methoxyphenol is a fluorinating agent that is used in the manufacture of pharmaceuticals, plastics and pesticides. It has been shown to induce apoptosis in cultured cells by upregulating reactive oxygen species (ROS) and increasing mitochondrial membrane permeability, as well as inhibiting cellular physiology. 4-Fluoro-2-methoxyphenol also inhibits the production of ATP and may be toxic to cells by interfering with dinucleotide phosphate.</p>

<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>

<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Polyphemusin II-derived peptide H-Arg-Arg-2-Nal-Cys-Tyr-Arg-Lys-D-Lys-Pro-Tyr-Arg-Cit (PIIH) is a cyclic polypeptide with a disulfide bond. PIIH binds to the alpha4beta1 integrin receptor, which is involved in the adhesion of leukocytes to endothelial cells and the migration of monocytes and lymphocytes. PIIH has been shown to be a potent inhibitor of chemokine binding to cxcr4, an important regulator of inflammatory response in mouse tumor models. PIIH also inhibits hiv infection as it inhibits the release of virus from infected cells. This pharmacological effect is mediated by its ability to bind HIV gp120 and block gp120 binding to CD4 receptors on target cells.</p>

<p>H-Val-Leu-Ser-Glu-Gly-OH is a polypeptide that is hydrophobic and has carboxypeptidase activity. It hydrolyzes anions, such as the penicillin G, which has been shown to have a high affinity for this enzyme. H-Val-Leu-Ser-Glu-Gly-OH has also been shown to interact with other proteins through hydrophobic interactions. When used in high concentrations, it can be used to filter out substances that are hydrophobic. It can also be used to hydrolyze anions and divalent ions, such as copper and zinc.</p>

<p>AF-2 is a potent, selective and competitive antagonist at the nicotinic acetylcholine receptor (nAChR). AF-2 binds to the extracellular domains of the nAChR and prevents agonists from binding. It has been shown to inhibit acetylcholine release in isolated heart preparations with high affinity and selectivity. The drug has been tested as an anthelmintic against Caenorhabditis elegans and found to be effective. AF-2 is a cholinergic compound that binds to ganglia, leading to a biphasic response. It also has significant effects on the central nervous system, inhibiting both nicotinic and muscarinic acetylcholine receptors.<br>AF-2 is sequenced according to the following formula: <br>H-Lys-His-Glu-Tyr-Leu-Arg-Phe <br>NH2</p>

<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Used in treatment of nonspecific ulcerative colitis</p>

<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>

<p>Please enquire for more information about H-Leu-Ala-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is a chiral, electron deficient reagent that reacts with aldehydes and boronic esters to form products with high chemical yields. This compound can be used as a catalyst for acylation reactions, such as the synthesis of p-nitrophenol. N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is synthesized by the reaction of trifluoroacetic acid and an amine, followed by chloroformate displacement. The product is then reacted with acylating agents in the presence of catalysts.</p>

<p>Bicine, also known as N,N-Bis(2-hydroxyethyl)glycine, is a Bis(2-hydroxyethyl) amine buffer with an optimal pH range of 7.6-9.0 and a pKa of 8.26. This buffering agent forms metal complexes and is used in crystallization and enzymatic studies.</p>

<p>Please enquire for more information about (Ala6,D-Trp8,L-alaninol15)-Galanin (1-15) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone is a mitochondria-targeting compound that has been shown to have neuroprotective and anti-inflammatory properties. It binds to the ATP synthase in the mitochondrial membrane, inhibiting ATP production and causing cell death by apoptosis. ZAFMK also inhibits kinases such as protein kinase 3β (PK3β) and caspase 9, which are involved in inflammation and apoptosis. ZAFMK has been shown to be effective against various diseases such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, Huntington's disease, and stroke.</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>Please enquire for more information about Fmoc-Lys(Adpoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys is a peptide that is found in the brain and spinal cord. It is an agonist of opioid receptors, which are involved in pain relief, as well as motor control. Dynorphin A (1-13) H has been shown to inhibit acetylcholine release, which may be due to its ability to bind to kappa opioid receptors. Dynorphin A (1-13) H is also known to bind to κ opioid receptors, where it inhibits locomotor activity and induces analgesia.</p>

<p>Please enquire for more information about pTH (44-68) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteocalcin (37-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cis-4-Hydroxy-D-proline is a metabolite of the amino acid proline. It has been shown to have beneficial effects on heart function in vitro and in vivo, as well as on collagen synthesis. Cis-4-Hydroxy-D-proline was also shown to inhibit herpes simplex virus replication and to induce apoptosis in hepatocyte-like cells. The affinity constants for cis-4-Hydroxy-D-proline were determined by ph assays, kinetic data, and structural analysis. The optimum pH for cis-4-Hydroxy D proline is 8.0 and the hydroxyl group makes this molecule more soluble in water than other molecules with a similar chemical structure.</p>

<p>1-O-Hexadecyl-sn-glycerol is a glycol ether that is used as a surfactant and emulsifier in cosmetic products. It has been shown to have minimal toxicity, and to not be carcinogenic or teratogenic. 1-O-Hexadecyl-sn-glycerol has been shown to increase the stability of proteins in rat liver microsomes, and it also prevents the hydrolysis of carbohydrates. The surface glycoprotein adsorbed by 1-O-Hexadecyl-sn-glycerol may play an important role in the binding of monoclonal antibodies. This compound affects cellular calcium levels, with high concentrations resulting in increased cytosolic calcium concentrations. Zirconium oxide can replace calcium ions in 1-O-Hexadecyl-sn-glycerol for this purpose, although this substitution reduces enzyme activity.</p>

<p>Please enquire for more information about H-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Glutaryl-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide is a signal molecule that has antimicrobial activity. It inhibits the proliferation of cells and is used as an antifungal agent. 2,5,6-Trimethyloxathiinium ion has been shown to induce apoptosis in human leukemia cells and inhibit the growth of erythrocytes infected with Plasmodium falciparum. This compound also inhibits wild type strains of bacteria and fungi and can be used as a natural fungicide. 2,5,6-Trimethyloxathiinium ion has been found to be effective in treating autoimmune diseases such as diabetes mellitus type II, which may be due to its ability to regulate glucose metabolism and suppress inflammatory responses.</p>

<p>The melanocortin-4 receptor (MC4R) is a G protein-coupled receptor that mediates the protective and cytoprotective activities of endogenous melanocortins. This receptor has been shown to be an important target for neuroprotective agents. The MC4R is expressed in the central nervous system, peripheral nervous system, and other tissues where it may have a role in regulating energy homeostasis. The N-terminal amino acid sequence of the human MC4R ligand is H-His-Phe-Arg-Trp-OH. This peptide has been shown to have potent agonist potency at the MC4R with a Kd of 0.2 nM and an EC50 of 2 nM.</p>

<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>

<p>Please enquire for more information about H-Gly-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-O-Octadecyl-sn-glycerol (1ODG) is a dietary lipid that is absorbed by the gastrointestinal tract and transported to the liver. It is used in cell culture as a substitute for lipids that are not available or cannot be used for experiments. 1ODG is also found in human lung and colon tissues, where it may act as a growth factor. 1ODG has been shown to inhibit herpes simplex virus type I (HSV-1) replication in cultured cells by increasing intracellular calcium levels and inhibiting viral DNA synthesis. It can also increase fatty acid synthesis and induce cellular proliferation of tissue culture cells, such as lung fibroblasts.</p>

<p>Please enquire for more information about GM-CSF (17-31) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about H-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-cys(Npys)-oh is an active substance that inhibits the growth of mouse tumors and has been shown to inhibit a number of different biological processes. It is a cross-linking agent for amino acids and has been shown to have an inhibitory effect on the synthesis of proteins by blocking the formation of disulfide bonds. This compound belongs to the class of chemicals known as sulfonamides, which are used in the treatment of bacterial infections. Boc-cys(Npys)-oh also specifically binds to antigen sites on cells, inhibiting their growth, and can be used as an antitumor agent. The molecule can be chemically linked with other molecules such as trifluoroacetic acid (TFA), resulting in a product with different properties than those found in Boc-cys(Npys)-oh. The chemical ligation process is used to produce subcutaneous tumors in mice that are then treated with hydrogen fluoride (</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Substance P is a neuropeptide that is found in the central nervous system. It is also found in the gastrointestinal tract and plays a role in the regulation of smooth muscle contraction. Substance P has been shown to be involved in inflammatory responses, immune responses, and regulation of water and electrolyte balance. The maximal response of substance P occurs at concentrations between 0.1 to 1 nM and its inhibitory effect on the apical Ca2+ response occurs at concentrations between 10-100 nM. In addition, substance P has been shown to have an excitatory effect on 5-HT7 receptors with subunit composition GluN1/GluN2A/GluN2B/GluN3A/5-HT7(H).</p>

<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endotoxin inhibitor H-Lys-Thr-Lys-Cys-Lys-Phe-Leu-Lys-Lys-Cys-OH is a natural disulfide bond that inhibits cytosolic Ca2+ release and bacterial translocation. It has been shown to decrease the production of tumor necrosis factor alpha (TNFα) in vitro, which may be due to its effects on protein synthesis. It also has antimicrobial activity against bacteria such as Clostridium perfringens, Mycobacterium tuberculosis, and Mycobacterium avium complex. Endotoxin inhibitor H-Lys-Thr-Lys-Cys-Lys-Phe-Leu-Lys-- Lys -Cys -OH binds to the ribosomal RNA of bacteria, inhibiting protein synthesis by binding to the peptidyl transferase center</p>

<p>H-Gln-Gly-OH is a proteolytic enzyme that cleaves peptide bonds in proteins. It is an enzyme that is involved in inflammatory diseases, as it has been shown to inhibit the production of messenger RNA (mRNA) and protein synthesis. H-Gln-Gly-OH also has anti-inflammatory properties. It has been shown to inhibit the production of amines from the amino acid arginine, which may be linked to its anti-inflammatory effects. This enzyme does not have a specific role in human metabolism and is found in human liver and other tissues. The structural analysis of this enzyme reveals that it contains a carbonyl group and an amide group with acidic properties. H-Gln-Gly-OH has been implicated in autoimmune diseases and infectious diseases, as it has been found in Streptococcus pyogenes, Mycoplasma pneumoniae, Borrelia burgdorferi, Coxiella burnetii</p>

<p>H-Ala-His-OH is a dietary supplement that contains histidine and alanine. Histidine is an amino acid involved in protein synthesis, which is a process that produces proteins from amino acids. H-Ala-His-OH has shown to inhibit chemical reactions involving histidine, such as the conversion of histidine to urocanic acid by bacterial enzymes. The uptake of H-Ala-His-OH has been shown to be increased by creatine supplementation, which may be due to the ability of creatine to increase cellular energy levels. Magnetic resonance spectroscopy (MRS) analysis has shown that H-Ala-His-OH increases glutamine levels in the brain. This may be due to its ability to cross the blood brain barrier and affect glutamate transport through the blood brain barrier.</p>

<p>Please enquire for more information about Suc-Ala-Ala-Pro-Abu-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Ala-Glu-Pro-Phe-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>

<p>Please enquire for more information about Lys(Dabsyl)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-Cit-AMC is a fluorescent substrate for the enzymes cysteine and peptide aminopeptidases. It has been synthesized by conjugating 7-amino-4-methylcoumarin with L-phenylalanine. The product is useful in assays to measure the activity of these enzymes, which are involved in protein digestion and wound healing. Z-Phe-Cit-AMC can be hydrolyzed by bromelain, ficin, or papain and it can be used as a substrate for enzyme reactions.</p>

<p>Please enquire for more information about Ac-3,5-dinitro-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sarafotoxin A is a low potency β-amino acid analog that inhibits the inflammatory activity of endothelin-A. It has been shown to inhibit the production of reactive oxygen species, which may be due to its inhibition of fatty acid synthesis. Sarafotoxin A also has diagnostic properties and can be used in the diagnosis of inflammatory diseases.</p>