
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,466 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38249 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
1-O-Octadecyl-sn-glycero-3-phosphocholine
CAS:<p>Edelfosine is a phospholipid analog that has been shown to inhibit insulin-induced glucose uptake in adipocytes. It is a potent inhibitor of the insulin receptor tyrosine kinase and can also act as an allosteric inhibitor of protein kinase C (PKC). Edelfosine inhibits the growth of mammary carcinomas by inhibiting PKC, which leads to a decrease in cell proliferation. This drug also interacts with sulfonic acids, forming hydrogen bonds, which may be the reason for its high-performance liquid chromatography. The molecular weight of edelfosine is 582.3 g/mol.</p>Formula:C26H56NO6PPurity:Min. 95%Molecular weight:509.7 g/molSuc-Leu-Leu-Val-Tyr-pNA
CAS:<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H50N6O10Purity:Min. 95%Molecular weight:726.82 g/molH-Val-Ala-pNA acetate salt
CAS:<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/molBrain-Binding Peptide
CAS:<p>Please enquire for more information about Brain-Binding Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H64N12O14S2Purity:Min. 95%Molecular weight:965.11 g/molH-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH
CAS:<p>Please enquire for more information about H-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H79N17O11Purity:Min. 95%Molecular weight:1,046.23 g/molBoc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt
CAS:<p>Please enquire for more information about Boc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N4O4Purity:Min. 95%Molecular weight:344.45 g/molAc-Val-Tyr-Leu-Lys-Ala-SBzl
CAS:<p>Please enquire for more information about Ac-Val-Tyr-Leu-Lys-Ala-SBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H56N6O7SPurity:Min. 95%Molecular weight:740.95 g/molBoc-Asp(OtBu)-ONp
CAS:<p>Please enquire for more information about Boc-Asp(OtBu)-ONp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N2O8Purity:Min. 95%Molecular weight:410.42 g/molN-α,ε-bis-Z-L-Lysine N-hydroxysuccinimide ester
CAS:<p>N-alpha,epsilon-bis-Z-L-Lysine N-hydroxysuccinimide ester is a methyl ester of the amino acid Lysine. This drug has been shown to have antinociceptive effects in animal models and may be useful for the treatment of inflammatory pain. The active conformation of this drug is dependent on the presence of hydroxybenzimidazole (HOBt). In the absence of HOBt, the compound does not have any activity. Acetylation or amidation may also affect its activity. The reaction with nitric acid yields a nitro derivative, which can be reduced back to the original compound by catalytic hydrogenation using palladium on carbon. A carboxylic acid group at the amino terminus can be converted to an amide or amido group by treatment with an appropriate reagent such as acetonitrile. This drug binds to a catalytic site on</p>Formula:C26H29N3O8Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:511.52 g/molH-Gly-Arg-Gly-OH
CAS:<p>Glucagon-like peptide-1 (GLP-1) is a hormone that is released by the L cells of the ileum and colon in response to food intake. It stimulates insulin release from pancreatic β cells, delays gastric emptying, and suppresses appetite. GLP-1 also reduces blood glucose concentrations by increasing hepatic glycogen synthesis and decreasing gluconeogenesis. GLP-1 has been shown to have a protective effect on liver function during periods of high fat diet consumption.</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/molLeu-Enkephalin amide acetate salt
CAS:<p>Leu-Enkephalin amide acetate salt H-Tyr-Gly-Gly-Phe-Leu-NH2 acetate salt is a peptide that is used as an analgesic and antipyretic drug. It is a synthetic form of endogenous enkephalins, which are natural pain relievers. The chemical stability of Leu-Enkephalin amide acetate salt H-Tyr-Gly-Gly-Phe-Leu-NH2 acetate salt makes it an effective drug for chronic use, and it has been shown to have a low side effect profile. This compound also has been shown to block the synthesis of histamine in vivo, but its bioavailability in vivo is not high due to its rapid degradation by proteases.</p>Formula:C28H38N6O6Purity:Min. 95%Color and Shape:PowderMolecular weight:554.64 g/molLHRH II trifluoroacetate salt
CAS:<p>LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.</p>Formula:C60H69N17O13Purity:Min. 95%Molecular weight:1,236.3 g/mol4-Fluoromethyl-α-methylbenzyl alcohol
CAS:<p>4-Fluoromethyl-alpha-methylbenzyl alcohol is a nonclassical molecule that has been synthesized. This molecule has been modeled computationally and the results indicate that it exhibits a planar geometry with a diastereomeric ratio of 1:1. The theoretical calculations show that the reaction of 4-fluoromethyl-alpha-methylbenzyl alcohol with water is exothermic, which would result in the formation of an intermediate hydroxide ion. Kinetic studies have shown that this molecule can undergo transfer reactions and dehydrogenation reactions, both of which are possible mechanisms for its reactivity.</p>Formula:C8H9FOPurity:Min. 95%Molecular weight:140.15 g/molAdrenomedullin (26-52) (human)
CAS:<p>Please enquire for more information about Adrenomedullin (26-52) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H216N40O42Purity:Min. 95%Molecular weight:3,119.45 g/mol(d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H79N13O10S2Purity:Min. 95%Molecular weight:1,086.38 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Formula:C28H34N4O7SPurity:Min. 95%Molecular weight:570.66 g/molH-Glu(OtBu)-allyl ester·HCl
CAS:<p>Please enquire for more information about H-Glu(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO4·HClPurity:Min. 95%Molecular weight:279.76 g/molBoc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt
CAS:<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>Formula:C34H52N8O10Purity:Min. 95%Molecular weight:732.82 g/mol4-Methoxy-3-(trifluoromethyl)benzoic acid
CAS:<p>4-Methoxy-3-(trifluoromethyl)benzoic acid is a useful scaffold that can be used as a building block for the synthesis of complex compounds. It has been shown to react with various reagents and is a versatile building block that can be used in organic synthesis. 4-Methoxy-3-(trifluoromethyl)benzoic acid is a high quality chemical and has been classified as speciality chemicals. This product is also known by the CAS number 213598-09-5.</p>Formula:C9H7F3O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:220.15 g/molTyr-Bradykinin
CAS:<p>Bradykinin is a peptide with a variety of physiological effects. It is formed by the cleavage of kininogen by kallikrein, and it is involved in the regulation of vascular tone and blood pressure, as well as responses to pain and inflammation. Bradykinin stimulates the release of histamine from mast cells, which causes an inflammatory response. Bradykinin also has been shown to stimulate the release of leukotrienes, prostaglandins, and cytokines from human lung tissue. The interaction between bradykinin and its receptors has been studied extensively using in vitro assays. The conformational changes in this peptide have been characterized by spectroscopic studies such as nuclear magnetic resonance (NMR) and circular dichroism (CD). In addition, bradykinin can be detected using luminescence techniques such as chemiluminescence or bioluminescence. Studies have shown that micromolar concentrations of bradykinin</p>Formula:C59H82N16O13Purity:Min. 95%Molecular weight:1,223.38 g/molZ-Lys-Arg-pNA·2 HCl
CAS:<p>This is a new inhibitor of phosphatase 2A (PP2A) that is in the form of a zwitterion. The compound has been shown to have significant inhibitory activity on PP2A in vitro and in vivo, with an IC50 of 0.12 μM and 0.28 μM respectively. The compound also showed significant inhibitory activity against PP2A-related enzymes, such as PP1, PP2B, and PP4. Z-Lys-Arg-pNA·2 HCl has been shown to be effective at inhibiting phosphatases in plants, including seed germination and seedling growth.</p>Formula:C26H36N8O6·2HClPurity:Min. 95%Molecular weight:629.54 g/molZ-Phe-Leu-Ala-OH
CAS:<p>Z-Phe-Leu-Ala-OH is a homologous protein that has been shown to have proteolytic activity. It has a neutral pH and is stable in the presence of metal ions. This enzyme is structurally similar to subtilisin, with a sequence of residues containing two histidine residues, which are important for stability. The kinetic parameters of this enzyme were determined by analyzing its activity under different conditions and at different temperatures. The mutant Z-Phe-Leu-Ala-OH was found to be more active than the wild type at high temperature, but less active at low temperature, suggesting that the protein could be used as an industrial catalyst in food processing or chemical production.</p>Formula:C26H33N3O6Purity:Min. 95%Molecular weight:483.56 g/molSarafotoxin A
CAS:<p>Sarafotoxin A is a low potency β-amino acid analog that inhibits the inflammatory activity of endothelin-A. It has been shown to inhibit the production of reactive oxygen species, which may be due to its inhibition of fatty acid synthesis. Sarafotoxin A also has diagnostic properties and can be used in the diagnosis of inflammatory diseases.</p>Formula:C105H156N28O34S5Purity:Min. 95%Molecular weight:2,514.86 g/molAc-3,5-dinitro-Tyr-OH
CAS:<p>Please enquire for more information about Ac-3,5-dinitro-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11N3O8Purity:Min. 95%Molecular weight:313.22 g/molCholecystokinin Octapeptide (1-2) (desulfated)
CAS:<p>Cholecystokinin octapeptide (1-2) (desulfated) H-Asp-Tyr-OH is a peptide that has been found to have hypotensive properties. It is an agonist of the CCK receptor and has been shown to be effective in lowering blood pressure. Cholecystokinin octapeptide (1-2) (desulfated) H-Asp-Tyr-OH stabilizes membranes, which may account for its ability to reduce the permeability of erythrocyte membranes. This peptide also interacts with histidine residues in striate muscle, which may account for its ability to relax smooth muscle. Cholecystokinin octapeptide (1-2) (desulfated) H-Asp-Tyr-OH is orally administered or can be hydrolyzed into amino acids in the gastrointestinal tract.</p>Formula:C13H16N2O6Purity:Min. 95%Molecular weight:296.28 g/molLeu-Leu-Leu-OH
CAS:<p>Leu-Leu-Leu-OH is a pentapeptide that is used in cancer treatment to inhibit the growth of cancer cells. It prevents the production of proteins and, as a result, cell division. Leu-Leu-Leu-OH has been shown to be effective against tumor cells with an antibody that binds to the surface of cells. The monoclonal antibody is taken up by the cancer cells through receptor mediated endocytosis, which leads to inhibition of protein synthesis and cell death.</p>Formula:C18H35N3O4Purity:Min. 95%Color and Shape:White PowderMolecular weight:357.49 g/molBiotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H176N32O32SPurity:Min. 95%Molecular weight:2,574.91 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/molGalanin (1-19) (human)
CAS:<p>Please enquire for more information about Galanin (1-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H130N26O25Purity:Min. 95%Molecular weight:1,964.14 g/molNeuronostatin-13 (human, canine, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H110N20O16Purity:Min. 95%Molecular weight:1,415.68 g/mol(Propionyl1,D-Tyr(Et)2,Val4, Abu 6,Arg8·9)-Vasopressin
CAS:<p>Please enquire for more information about (Propionyl1,D-Tyr(Et)2,Val4, Abu 6,Arg8·9)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H82N16O11Purity:Min. 95%Molecular weight:1,119.32 g/molPyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H57N13O9Purity:Min. 95%Molecular weight:827.93 g/molN-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H35N3O3Purity:Min. 95%Molecular weight:425.56 g/molTyr-Somatostatin-14
CAS:<p>Please enquire for more information about Tyr-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H113N19O21S2Purity:Min. 95%Molecular weight:1,801.05 g/molAcetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt
CAS:<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>Formula:C22H40N6O8Purity:Min. 95%Molecular weight:516.59 g/molFor-Met-Lys-OH
CAS:<p>Please enquire for more information about For-Met-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23N3O4SPurity:Min. 95%Molecular weight:305.39 g/molFmoc-His(Fmoc)-OPfp
CAS:<p>Please enquire for more information about Fmoc-His(Fmoc)-OPfp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H28N3O6F5Purity:Min. 95%Molecular weight:765.68 g/molCalcium-Like Peptide 3 trifluoroacetate salt
CAS:<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N10O9Purity:Min. 95%Molecular weight:881.07 g/molVEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about VEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H99N23O18SPurity:Min. 95%Molecular weight:1,666.82 g/molH-Ser-Leu-Leu-OH
CAS:<p>Please enquire for more information about H-Ser-Leu-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H29N3O5Purity:Min. 95%Molecular weight:331.41 g/molBoc-Met-Enkephalin
CAS:<p>Boc-Met-Enkephalin is a hexapeptide that is derived from the amino acid Met. It is related to the opioid peptide Met-enkephalin, which has been shown to be involved in pain modulation and emotional responses such as fear and pleasure. Boc-Met-Enkephalin was synthesized by coupling two different fragments through an amide bond. The sequential order of these fragments was determined by high-resolution NMR spectroscopy. The carbonyl groups on the peptides were identified by using heteronuclear 2D correlation experiments. This sequence of carbons was demonstrated with 13C and 15N spectroscopy, in which it was found that there are three molecules of methylene carbon per molecule of Boc-Met-Enkephalin.</p>Formula:C32H43N5O9SPurity:Min. 95%Molecular weight:673.78 g/mol(D-Pro4,D-Trp7·9·10)-Substance P (4-11)
CAS:<p>Substance P is a neuropeptide that is found in the central nervous system. It is also found in the gastrointestinal tract and plays a role in the regulation of smooth muscle contraction. Substance P has been shown to be involved in inflammatory responses, immune responses, and regulation of water and electrolyte balance. The maximal response of substance P occurs at concentrations between 0.1 to 1 nM and its inhibitory effect on the apical Ca2+ response occurs at concentrations between 10-100 nM. In addition, substance P has been shown to have an excitatory effect on 5-HT7 receptors with subunit composition GluN1/GluN2A/GluN2B/GluN3A/5-HT7(H).</p>Formula:C62H74N14O10SPurity:Min. 95%Molecular weight:1,207.41 g/molAmyloid β-Protein (40-1) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molSuc-Gly-Pro-pNA
CAS:<p>Suc-Gly-Pro-pNA is a proteolytic enzyme that hydrolyzes proteins. It has been shown to have potential for use as an anti-inflammatory agent. Suc-Gly-Pro-pNA has high proteolytic activity and can cleave peptide hormones such as angiotensin II and vasopressin. It also has thermal stability, and can tolerate high concentrations of salt and heat, making it suitable for therapeutic purposes. Suc-Gly-Pro-pNA binds to peptides with carboxy terminal residues by substrate binding, which may be the reason for its high degree of specificity. This enzyme is expressed in the cytosol and extracellular environment.</p>Formula:C17H20N4O7Purity:Min. 95%Molecular weight:392.36 g/molSomatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/molH-Ile-His-OH
CAS:<p>H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.</p>Formula:C12H20N4O3Purity:Min. 95%Molecular weight:268.31 g/mol(Nle 35)-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H313N55O60Purity:Min. 95%Molecular weight:4,496 g/molAc-Val-Asp-Val-Ala-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Val-Asp-Val-Ala-Asp-aldehyde is a pseudo acid that is used in molecular modeling and kinetic studies. Ac-Val-Asp-Val-Ala-Asp-aldehyde has been shown to be a potent inhibitor of caspase activity and has been shown to inhibit the activity of various other enzymes as well, including cyclohexane ring hydroxylases and nitroreductases. Ac-Val-Asp-Val-Ala-Asp--aldehyde analogs are being studied for their ability to bind to specific proteins or inhibit enzyme activities. Ac-- Val-- Asp-- Val-- Ala-- Asp-- aldehyde binds to the active site of caspase 3 and prevents it from cleaving its target protein, which leads to cell death.</p>Formula:C23H37N5O10Purity:Min. 95%Molecular weight:543.57 g/mol(Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O7Purity:Min. 95%Molecular weight:651.71 g/molZ-Leu-Leu-4,5-dehydro-Leu-aldehyde
CAS:<p>Please enquire for more information about Z-Leu-Leu-4,5-dehydro-Leu-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H39N3O5Purity:Min. 95%Molecular weight:473.61 g/molBz-Tyr-4-Abz-OH·sodium salt
CAS:<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H19N2NaO5Purity:Min. 95%Molecular weight:426.4 g/mol2-(N-Phenyl-N-benzyl-aminomethyl)-imidazol
CAS:<p>Please enquire for more information about 2-(N-Phenyl-N-benzyl-aminomethyl)-imidazol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H17N3Purity:Min. 95%Molecular weight:263.34 g/molH-Tyr-D-Ala-Gly-OH
CAS:<p>H-Tyr-D-Ala-Gly-OH is a chemical compound that is used in the field of molecular biology. It is an amino acid which has been modified to contain a terminal amine group, so it can be coupled to other molecules through a covalent bond. H-Tyr-D-Ala-Gly-OH can be used as a diagnostic marker for mouse monoclonal antibodies. The antibody reacts with the H-Tyr-D-Ala-Gly-OH by binding to its peptide receptors, which are located on the cell surface and inside the cells. This receptor activity can be detected using immunohistochemistry or flow cytometry. Immunohistochemical detection of H-Tyr-D-Ala-Gly--OH is useful for diagnosing cancer, such as breast cancer, where it can be found in high levels in metastatic lesions.</p>Formula:C14H19N3O5Purity:Min. 95%Molecular weight:309.32 g/molH-Arg-Ile-OH acetate salt
CAS:<p>H-Arg-Ile-OH acetate salt is a regulatory protein that is found in plant cells. It has been shown to be involved in the regulation of cancer, as well as having some anti-inflammatory activities. H-Arg-Ile-OH acetate salt also has been shown to inhibit the production of fatty acids and coagulation factors by inhibiting serine proteases and thromboplastin activity, respectively. H-Arg-Ile-OH acetate salt may have an important role in regulating blood clotting by preventing fibrinogen from converting to fibrin, which leads to clot formation.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/mol(D-Leu6,Pro-NHEt 9)-LHRH (4-9)
CAS:<p>Please enquire for more information about (D-Leu6,Pro-NHEt 9)-LHRH (4-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H62N10O8Purity:Min. 95%Molecular weight:774.95 g/molH-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-OH acetate salt is a protease inhibitor. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, in vitro. H-Arg-Arg-OH acetate salt binds to the active site of the enzyme and prevents substrate binding. The acidity of the environment where this inhibitor is active can be used to control its activity. At acidic pH, H-Arg-Arg-OH acetate salt is more potent than at neutral pH. When it comes into contact with a protein substrate, H-Arg-Arg-OH acetate salt will bind to a hydroxyl group on the protein molecule and prevent it from hydrolyzing its substrate. This process can be reversed by adding an alkaline buffer to increase the pH of the system or by adding an acid buffer to decrease it.br>br> H-Arg-Arg-OH acetate salt is found in cyanob</p>Formula:C12H26N8O3Purity:Min. 95%Molecular weight:330.39 g/molBoc-cys(Npys)-oh
CAS:<p>Boc-cys(Npys)-oh is an active substance that inhibits the growth of mouse tumors and has been shown to inhibit a number of different biological processes. It is a cross-linking agent for amino acids and has been shown to have an inhibitory effect on the synthesis of proteins by blocking the formation of disulfide bonds. This compound belongs to the class of chemicals known as sulfonamides, which are used in the treatment of bacterial infections. Boc-cys(Npys)-oh also specifically binds to antigen sites on cells, inhibiting their growth, and can be used as an antitumor agent. The molecule can be chemically linked with other molecules such as trifluoroacetic acid (TFA), resulting in a product with different properties than those found in Boc-cys(Npys)-oh. The chemical ligation process is used to produce subcutaneous tumors in mice that are then treated with hydrogen fluoride (</p>Formula:C13H17N3O6S2Purity:Min. 95%Color and Shape:Off-White PowderMolecular weight:375.42 g/molAbz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H71N11O18Purity:Min. 95%Molecular weight:1,258.29 g/molH-Arg-Glu-OH
CAS:<p>H-Arg-Glu-OH is a small molecule that is used as a pharmacological agent for the treatment of diabetes. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of inflammatory mediators such as prostaglandin E2 and nitric oxide. H-Arg-Glu-OH also induces apoptosis in human monocytes and macrophages by binding to toll-like receptor 4 (TLR4) on the cell surface. This binding activates NFκB and JNK pathways, leading to the induction of apoptosis. H-Arg-Glu-OH binds with high affinity to monoclonal antibodies against glutamic acid and glycine, which are not present in humans. The compound may be toxic at a neutral pH because it is highly reactive due to intramolecular hydrogen bonding between carbonyl oxygens and amide hydrogens.</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/molBoc-Ala-Ala-Gly-pNA
CAS:<p>Boc-Ala-Ala-Gly-pNA is a peptide that has been synthesized using the Fmoc/tBu strategy. It has an acidic pH, and its proteolytic activity can be enhanced by the addition of chromogenic or fluorogenic substrates. Boc-Ala-Ala-Gly-pNA is used as a substrate in fingerprint analysis and can be used to identify bacteria such as Proteus mirabilis, Pseudomonas aeruginosa, and Bacillus cereus. This peptide can also be used to identify strains of Escherichia coli, Enterococci, Staphylococci, Streptococci, and Haemophilus influenzae.</p>Formula:C19H27N5O7Purity:Min. 95%Color and Shape:PowderMolecular weight:437.45 g/molBQ-123 Cyclo(-D-Trp-D-Asp-Pro-D-Val-Leu)
CAS:<p>BQ-123 is a cyclic peptide that has been shown to have a binding affinity for the serotonin receptor. The binding of BQ-123 to the receptor leads to a reduction in intracellular calcium concentration, which may be due to the inhibition of serine protease activity. This agent also inhibits the production of tumour necrosis factor-α (TNF-α) and has an inhibitory effect on cardiac contractility.</p>Formula:C31H42N6O7Purity:Min. 95%Molecular weight:610.7 g/molBoc-D-Cys(NPys)-OH
CAS:<p>Please enquire for more information about Boc-D-Cys(NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H17N3O6S2Purity:Min. 95%Molecular weight:375.42 g/molSteroidogenesis-Activator Polypeptide (rat)
CAS:<p>Please enquire for more information about Steroidogenesis-Activator Polypeptide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H226N34O51Purity:Min. 95%Molecular weight:3,213.5 g/molH-Cys-Asp-Pro-Gly-Tyr-Ile-Gly-Ser-Arg-NH2
CAS:<p>C-Cys-Asp-Pro-Gly-Tyr-Ile-Gly-Ser-Arg is a cyclic peptide that is synthesized from the amino acid sequence of human epidermal growth factor (EGF). It has been shown to have in vitro and in vivo antitumor activity against melanoma cells. C-Cys-Asp-Pro-Gly-Tyr-Ile-Gly-Ser-Arg has also been shown to activate EGF receptors with physiological levels of EGF and to inhibit tumor metastasis.</p>Formula:C40H63N13O13SPurity:Min. 95%Molecular weight:966.07 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Ala-bNA·HBr
CAS:<p>H-Ala-bNA·HBr is a fluorogenic probe for pancreatic amide hydrolase that hydrolyzes the substrate H-Ala-bNA to release fluorescein. The probe has been used in enzymatic methods to identify and characterize the enzyme. The affinity of H-Ala-bNA·HBr for amide hydrolase is high and it can be used as a ligand to study the specificity of this enzyme. H-Ala-bNA·HBr can also be used as a fluorescent probe, with emission at 515 nm, and as a transfer reagent with an acceptor at 540 nm.</p>Formula:C13H14N2O·HBrPurity:Min. 95%Molecular weight:295.18 g/molMca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H81N15O19Purity:Min. 95%Molecular weight:1,388.44 g/molBoc-(R)-2-methoxyphenylglycine
CAS:<p>Please enquire for more information about Boc-(R)-2-methoxyphenylglycine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19NO5Purity:Min. 95%Molecular weight:281.3 g/molH(-Asn-Pro-Asn-Ala)2-OH
CAS:<p>Please enquire for more information about H(-Asn-Pro-Asn-Ala)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H50N12O13Purity:Min. 95%Molecular weight:810.81 g/molH-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>Formula:C20H35N9O10SPurity:Min. 95%Molecular weight:593.61 g/molLHRH hydrochloride salt
CAS:<p>LHRH is a hormone that has been used to treat endometriosis, prostate cancer, and ovarian cysts. It is an agonist of the gonadotropin-releasing hormone receptor (GnRH receptor). LHRH binds to the GnRH receptor in the pituitary gland and stimulates the release of follicle-stimulating hormone and luteinizing hormone. This leads to increased production of estrogen and testosterone. LHRH has been shown to be effective in treating infectious diseases such as tuberculosis and HIV/AIDS. LHRH can also be used as a diagnostic aid for determining whether or not a tumor is cancerous by measuring its protein content.</p>Formula:C55H75N17O13·xHClPurity:Min. 95%Molecular weight:1,182.29 g/molNeuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H288N56O57Purity:Min. 95%Molecular weight:4,064.48 g/molAc-Lys-Ala-bNA
CAS:<p>Please enquire for more information about Ac-Lys-Ala-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H28N4O3Purity:Min. 95%Molecular weight:384.47 g/molSuc-Ala-Gly-Pro-Phe-pNA
CAS:<p>Suc-Ala-Gly-Pro-Phe-pNA is an amide that has been synthesized for the stabilization of proteins, peptides and nucleic acids. It has shown to be effective in preventing isomerization of casein and phosphatase (casein kinase II) by stabilizing the alpha helix structure. Suc-Ala-Gly-Pro-Phe-pNA also prevents fk506 binding to endoplasmic reticulum protein tyrosine kinases and isomerizes tyrosine to phenylalanine. The tetrapeptide sequence has been shown to be similar to sequences found in cellular proteins. This compound is a synthetic analog of the natural amino acid proline and can be used as a substitute in peptides or nucleotide sequences, due to its ability to stabilize these molecules against proteolysis or hydrolysis.</p>Formula:C29H34N6O9Purity:Min. 95%Molecular weight:610.62 g/molFmoc-Pro-DHPP resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pro-DHPP resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molMAPKK2 (1-16) (human, mouse, rat)
CAS:<p>Please enquire for more information about MAPKK2 (1-16) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H144N24O19SPurity:Min. 95%Molecular weight:1,790.23 g/molH-Lys-Gly-Lys-OH acetate salt
CAS:<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>Formula:C14H29N5O4Purity:Min. 95%Molecular weight:331.41 g/mol(D-Phe7)-Somatostatin-14
CAS:<p>Please enquire for more information about (D-Phe7)-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H104N18O19S2Purity:Min. 95%Molecular weight:1,637.88 g/molBoc-Glu(OBzl)-Ala-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Boc-Glu(OBzl)-Ala-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H47N7O9·HClPurity:Min. 95%Molecular weight:758.26 g/molH-Gly-Gly-OBzl·p-tosylate
CAS:<p>The product is a neutral amino acid with an aliphatic side-chain. The product has been shown to be stable when diluted, and is not subject to hydrolysis. It can be used as a reagent for peptide synthesis because it does not interfere with the reaction or alter the yield of desired products. The product has been shown to be reliable and produce polypeptides that are chemically identical to those obtained by other methods. It has been found that the product is additive in peptide synthesis reactions, so that it can be substituted for any one of the components without altering the yield of desired products.</p>Formula:C11H14N2O3·C7H8O3SPurity:Min. 95%Molecular weight:394.44 g/mol1-O-Hexadecyl-sn-glycerol
CAS:<p>1-O-Hexadecyl-sn-glycerol is a glycol ether that is used as a surfactant and emulsifier in cosmetic products. It has been shown to have minimal toxicity, and to not be carcinogenic or teratogenic. 1-O-Hexadecyl-sn-glycerol has been shown to increase the stability of proteins in rat liver microsomes, and it also prevents the hydrolysis of carbohydrates. The surface glycoprotein adsorbed by 1-O-Hexadecyl-sn-glycerol may play an important role in the binding of monoclonal antibodies. This compound affects cellular calcium levels, with high concentrations resulting in increased cytosolic calcium concentrations. Zirconium oxide can replace calcium ions in 1-O-Hexadecyl-sn-glycerol for this purpose, although this substitution reduces enzyme activity.</p>Formula:C19H40O3Purity:Min. 95%Molecular weight:316.52 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-His-Met-OH
CAS:<p>H-His-Met-OH is a histidine derivative that has been shown to have antioxidant properties. It is classified as an amide, and also acts as a chelating agent. The molecule can bind to metal ions and thereby scavenge free radicals. H-His-Met-OH has been shown to have anti-cancer activity in vitro and in vivo against kidney cancer cells. This compound also has the ability to inhibit the growth of Pseudomonas aeruginosa, which is an activated form of this bacterium, by preventing its respiration. H-His-Met-OH inhibits energy metabolism in cancer cells, which may be due to its ability to inhibit glucose uptake by inhibiting the glycolytic pathway.</p>Formula:C11H18N4O3SPurity:Min. 95%Molecular weight:286.35 g/molTrt-D-Phe-OH·DEA
CAS:<p>Please enquire for more information about Trt-D-Phe-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H25NO2·C4H11NPurity:Min. 95%Molecular weight:480.64 g/molH-2,5-Diiodo-His-OH·HCl
CAS:<p>Please enquire for more information about H-2,5-Diiodo-His-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7I2N3O2·HClPurity:Min. 95%Molecular weight:443.41 g/molUroguanylin Topoisomer A (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/molH-trans-4,5-Dehydro-DL-Lys-OH·2 HCl
CAS:<p>Please enquire for more information about H-trans-4,5-Dehydro-DL-Lys-OH·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O2·2HClPurity:Min. 95%Molecular weight:217.09 g/molBoc-Gly-Phe-OBzl
CAS:<p>Please enquire for more information about Boc-Gly-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molD-Threoninol
CAS:<p>Please enquire for more information about D-Threoninol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C4H11NO2Purity:Min. 95%Molecular weight:105.14 g/molGAP 27 acetate salt
CAS:<p>GAP 27 is a connexin that is expressed in the cardiac and skin cells. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile-OH acetate salt is made up of a number of amino acids, including serine, arginine, proline, glutamic acid, lysine, threonine and isoleucine. It has been shown to have biological function in vivo models and in vitro assays. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr--Ile--Phe--Ile--Ile--OH acetate salt has been shown to be non toxic to the heart and skin cells. This protein also shows growth factor activity when it interacts with toll like receptor 4 (TLR4) on human skin cells.</p>Formula:C60H101N15O17Purity:Min. 95%Molecular weight:1,304.53 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Met-Leu-Gly-OH
CAS:<p>H-Met-Leu-Gly-OH is a tetrapeptide that has shown to have neuroprotective effects. It has been shown to be effective in the treatment of catalysis and inflammatory diseases. The peptidase activity of H-Met-Leu-Gly-OH is inhibited by the presence of lysine, arginine, and tryptophan. This inhibitory effect can be reversed by the presence of an acceptor such as histidine or cysteine. H-Met-Leu-Gly-OH also inhibits the production of nitric oxide in microglial cells and lung cells.</p>Formula:C13H25N3O4SPurity:Min. 95%Molecular weight:319.42 g/molSar-Ala-OH
CAS:<p>Please enquire for more information about Sar-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O3Purity:Min. 95%Molecular weight:160.17 g/molSuc-Ala-Ala-Pro-Ile-pNA
CAS:<p>Suc-Ala-Ala-Pro-Ile-pNA is an enzyme that belongs to the family of zymogens. It is a tetrapeptide that is synthesized in the cytosol and transported into the lumen of the intestine, where it is cleaved by trypsin to form pepsin A. In humans, this enzyme has been localized to the duodenum and jejunum. Suc-Ala-Ala-Pro-Ile-pNA is activated by trypsin and cleaves proteins at their carboxyl side chains. It also binds to specific residues in proteins, including those with unpaired cysteine residues.</p>Formula:C27H38N6O9Purity:Min. 95%Molecular weight:590.63 g/molLys-Thymic Factor trifluoroacetate salt
CAS:<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H68N14O17Purity:Min. 95%Molecular weight:1,005.04 g/molAc-Tyr-OEt
CAS:<p>Ac-Tyr-OEt is a synthetic peptide with the amino acid sequence Ac-Tyr-OEt. It is a signal peptide that enhances the efficiency of protein secretion in soybean cells. It binds to hydroxyl groups on sephadex g-100, which may be due to hydrogen bonding between the two. The rate constant for this reaction has been measured at 2.5 x 10^6 M^(-1)s^(-1) and the caproic acid concentration for half-maximal binding has been determined to be 3 mM. Ac-Tyr-OEt also has protease activity, as demonstrated by its ability to hydrolyze carboxypeptidase A at a rate of 1.7 x 10^4 min^(-1).</p>Formula:C13H17NO4Purity:Min. 95%Molecular weight:251.28 g/molpp60 c-src (521-533)
CAS:<p>C-src is a protein kinase that plays an important role in cell signaling. The protein contains an ATP-binding domain and a catalytic domain, which are responsible for the phosphorylation of tyrosine residues on other proteins. C-src is involved in bone resorption, blood pressure control and tumor development. This molecule has been used as a template for the production of analogues with increased detection sensitivity (e.g., pp60 c-src (521-533) H-Thr-Ser-Thr-Glu-Pro-Gln).</p>Formula:C62H94N16O25Purity:Min. 95%Molecular weight:1,463.5 g/molACTH (1-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N21O20SPurity:Min. 95%Molecular weight:1,680.88 g/molOrexin A (17-33) trifluoroacetate salt
CAS:<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>Formula:C79H125N23O22Purity:Min. 95%Molecular weight:1,748.98 g/molCecropin A (1-8)-Melittin (1-18) amide
CAS:<p>Please enquire for more information about Cecropin A (1-8)-Melittin (1-18) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H233N33O29Purity:Min. 95%Molecular weight:2,794.51 g/molZ-Val-Leu-OH
CAS:<p>Z-Val-Leu-OH is a model substrate for plant proteases, aminopeptidases and dipeptidases. It has been used as a standard to study the mechanism of hydrolysis by these enzymes. Z-Val-Leu-OH is hydrolyzed by these enzymes at optimally pH 8.0, with the rate increasing with temperature up to 45°C. The hydrolysis of Z-Val-Leu-OH by germination endosperm proteinase is inhibited by hemoglobin, which leads to increased levels of peptides in the endosperm.</p>Formula:C19H28N2O5Purity:Min. 95%Molecular weight:364.44 g/molSuc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid
CAS:<p>Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid is a synthetic peptide that has been shown to have the ability to inhibit the function of an enzyme called isomerase. It binds to the catalytic region of the enzyme and blocks its activity, which prevents the production of amino acid molecules. Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid also has immunosuppressive properties, which are due to its ability to bind to regulatory domains in cells and prevent their transcriptional activation. This molecule also has a catalytic function and can be used as a building block for synthesizing other molecules with similar functions.</p>Formula:C37H45N5O9•xCF3CO2HPurity:Min. 95%Molecular weight:703.78 g/molH-Pro-Glu-OH
CAS:<p>H-Pro-Glu-OH is a homologous peptide that belongs to the group of proteins. It is synthesized in the cells by polymerase chain reaction and can be used for diagnosis of infectious diseases. It has been shown to induce antibody response in mice. H-Pro-Glu-OH is also active against Mycobacterium tuberculosis, which may be due to its ability to bind to the tyrosine kinase domain on protein genes. This peptide has been shown to have anti-inflammatory properties, inhibiting fatty acid production and leading to necrotic cell death.</p>Formula:C10H16N2O5Purity:Min. 95%Molecular weight:244.24 g/molDynorphin A (1-7)
CAS:<p>Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH is a peptide that acts as a cryoprotectant. It has been shown in animal models to inhibit the proliferation of cells in culture and to have neuroprotective properties. Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH has also been shown to have antiinflammatory properties in animals, although the exact mechanism of action is not known. This peptide can be used as an excipient in pharmaceutical formulations or as a diluent for lyophilisates.</p>Formula:C40H61N13O9Purity:Min. 95%Molecular weight:867.99 g/molNeuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C175H290N56O59Purity:Min. 95%Molecular weight:4,122.52 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H100N22O14S3Purity:Min. 95%Molecular weight:1,449.77 g/mol2-Amino-1-phenylpropan-1-one hydrochloride
CAS:Controlled Product<p>2-Amino-1-phenylpropan-1-one hydrochloride is a chemical compound that can be used as an intermediate in the synthesis of ethyl formate. It is also a pharmaceutical intermediate, which is used to prepare triazine and alicyclic compounds. It has been shown to have potential use in the treatment of prostatic hypertrophy and heterocycle disorders. 2-Amino-1-phenylpropan-1-one hydrochloride has been found to be active in animals and humans and is not toxic to women or animals. This drug has shown no adverse effects on human health at doses up to 10 g/kg body weight.</p>Formula:C9H11NO•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:185.65 g/molPolyphemusin II-Derived Peptide
CAS:<p>Polyphemusin II-derived peptide H-Arg-Arg-2-Nal-Cys-Tyr-Arg-Lys-D-Lys-Pro-Tyr-Arg-Cit (PIIH) is a cyclic polypeptide with a disulfide bond. PIIH binds to the alpha4beta1 integrin receptor, which is involved in the adhesion of leukocytes to endothelial cells and the migration of monocytes and lymphocytes. PIIH has been shown to be a potent inhibitor of chemokine binding to cxcr4, an important regulator of inflammatory response in mouse tumor models. PIIH also inhibits hiv infection as it inhibits the release of virus from infected cells. This pharmacological effect is mediated by its ability to bind HIV gp120 and block gp120 binding to CD4 receptors on target cells.</p>Formula:C90H141N33O18S2Purity:Min. 95%Molecular weight:2,037.43 g/mol(D-Trp8)-γ2-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H99N21O16SPurity:Min. 95%Molecular weight:1,570.78 g/molMca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
<p>Please enquire for more information about Mca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H83N19O12Purity:Min. 95%Molecular weight:1,166.34 g/molAcetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH
CAS:<p>Please enquire for more information about Acetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H147N29O24SPurity:Min. 95%Molecular weight:2,135.45 g/molH-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H58N12O9Purity:Min. 95%Molecular weight:850.96 g/molBoc-Lys(Fmoc)-Leu-Ala-Leu-OH
CAS:<p>Please enquire for more information about Boc-Lys(Fmoc)-Leu-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H59N5O9Purity:Min. 95%Molecular weight:765.94 g/molAntifreeze Polypeptide 6 (winter flounder) trifluoroacetate salt
CAS:<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>Formula:C133H225N43O51•xC2HF3O2Purity:Min. 95%Molecular weight:3,242.47 g/molH-Pro-Pro-Pro-OH
CAS:<p>H-Pro-Pro-Pro-OH is a synthetic peptide that inhibits the production of reactive oxygen species (ROS) by acting as an antioxidant. It has been shown to have a protective effect on cells, preventing cell death and promoting cell survival. H-Pro-Pro-Pro-OH also has a significant inhibitory effect on superoxide radical production in nanotubes and photoreceptors. It can be used to prevent the oxidation of α-tocopherol, which is a lipid soluble vitamin found in vegetable oils. The three amino acids in the sequence are hydrolysed to proline, which is an essential amino acid for human metabolism, and two dipeptides with chemical structures similar to those found in natural peptides. The peptide was synthesized from proline, histidine and arginine. This molecule can be detected using polyacrylamide gel electrophoresis and fluorescence microscopy with enhanced optical properties as a chromophore.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/molH-His-Leu-His-bNA acetate salt
CAS:<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H34N8O3Purity:Min. 95%Molecular weight:530.62 g/molFmoc-Tyr(Et)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5Purity:Min. 95%Molecular weight:431.48 g/molFmoc-Nle-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Nle-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Deamino-Cys1,Leu4,Lys8)-Vasopressin trifluoroacetate salt
CAS:<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>Formula:C47H67N11O11S2Purity:Min. 95%Molecular weight:1,026.23 g/mol(Leu8,D-Trp22,Tyr25)-Somatostatin-28
CAS:<p>Please enquire for more information about (Leu8,D-Trp22,Tyr25)-Somatostatin-28 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H209N41O40S2Purity:Min. 95%Molecular weight:3,146.52 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/molL-Prolinamide
CAS:<p>Intermediate in the synthesis of vildagliptin</p>Formula:C5H10N2OPurity:Min. 95%Color and Shape:PowderMolecular weight:114.15 g/molFmoc-Phe-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%HTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molH-Glu-Tyr-OH
CAS:<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>Formula:C14H18N2O6Purity:Min. 95%Molecular weight:310.3 g/molVIP (10-28) (human, mouse, rat)
CAS:<p>Angiotensin II is a peptide hormone that is involved in the regulation of blood pressure, water and electrolyte balance, and vascular resistance. It also plays a role in the development of angiogenic diseases such as cancer. Angiotensin II is an antagonist at the AT1 receptor, which is found on many tissues, including those in the brain, kidney, and vasculature. In addition to its effects on blood pressure and fluid retention, angiotensin II has been shown to affect intestinal motility and ileal absorption in rats. The inhibition of angiotensin II could be used for the treatment of neovascular diseases such as cancer.</p>Formula:C105H180N32O26SPurity:Min. 95%Molecular weight:2,338.82 g/molTRAP-7 trifluoroacetate salt
CAS:<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>Formula:C39H63N11O10Purity:Min. 95%Molecular weight:845.99 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molH-D-Glu(Trp-OH)-OH
CAS:<p>H-D-Glu(Trp-OH)-OH is a synthetic peptide that has been shown to inhibit the replication of the herpes simplex virus (HSV). It binds to toll-like receptor 3 and 4 on cells, which may inhibit HSV replication. This compound has also been shown to be a potent inhibitor of HIV, as well as hepatitis B and C. H-D-Glu(Trp-OH)-OH has been shown to cause lung damage in mice. The mechanism for this effect is unknown, but it may involve an increase in reactive oxygen species or other cell signaling pathways.</p>Formula:C16H19N3O5Purity:Min. 95%Molecular weight:333.34 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/molBoc-Ala-Ala-Asp-pNA
CAS:<p>Boc-Ala-Ala-Asp-pNA is a peptide that has been shown to have cytotoxic activity against the leukemia cell line, basophilic leukemia (BL). It also inhibits hemolytic activity and cytolysin production by staphylococcus. This peptide is expressed in the sequence of Boc-Ala-Ala-Asp and is composed of 20 amino acids. The Boc-Ala sequence has been shown to be involved in apoptosis, while Asp and pNA are responsible for inhibiting hemolytic activity. Functional assays have demonstrated that this peptide has a strong inhibitory effect on the growth of bacteria, including strains of subtilis and hybridization.</p>Formula:C21H29N5O9Purity:Min. 95%Molecular weight:495.48 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molFmoc-Sar-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Sar-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Dansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/molBiotinyl-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C213H325N57O62S2Purity:Min. 95%Molecular weight:4,740.34 g/mol3-(4-Methylphenyl)-5-(trifluoromethyl)pyrazole
CAS:<p>Please enquire for more information about 3-(4-Methylphenyl)-5-(trifluoromethyl)pyrazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H9F3N2Purity:Min. 95%Molecular weight:226.2 g/molGRF (1-29) amide (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molH-His-Lys-OH·HBr
CAS:<p>Please enquire for more information about H-His-Lys-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21N5O3·HBrPurity:Min. 95%Molecular weight:364.24 g/molH-Lys(Abz)-Pro-Pro-pNA
CAS:<p>H-Lys(Abz)-Pro-Pro-pNA is a potent and selective DPP-IV inhibitor that has been shown to be active in humans. This drug binds to the DPP-IV enzyme and prevents it from breaking down the incretin hormone, GLP-1, which is released by the intestine in response to food intake. This leads to increased insulin production and an improved glycemic profile in people with type 2 diabetes. H-Lys(Abz)-Pro-Pro-pNA also inhibits endoproteolysis of dipeptidyl peptidase IV (DPPIV), which reduces its activity against other enzymes such as amyloid beta protein precursor protein (APP) and angiotensin II receptor type 1 (AT1R).</p>Formula:C29H37N7O6Purity:Min. 95%Molecular weight:579.65 g/molH-Gln-Gly-Pro-OH·TFA
CAS:<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N4O5·C2HF3O2Purity:Min. 95%Molecular weight:414.33 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/mol(Pyr 16)-VIP (16-28) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H114N18O18SPurity:Min. 95%Molecular weight:1,503.81 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/mol(Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molAc-Arg-Leu-Arg-AMC trifluoroacetate salt
CAS:<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>Formula:C30H46N10O6•C2HF3O2Purity:Min. 96 Area-%Color and Shape:PowderMolecular weight:756.77 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/mol5-Fluoro-2-methoxyphenylacetone
CAS:<p>5-Fluoro-2-methoxyphenylacetone is a chemical with a wide array of applications in research and industry. It is a versatile building block, useful intermediate, and reagent for organic synthesis. This compound has been used as a starting material in the synthesis of other compounds. CAS No. 1017082-10-8</p>Formula:C10H11FO2Color and Shape:PowderMolecular weight:182.19 g/molBradykinin (2-9) acetate salt
CAS:<p>Acetate salt</p>Formula:C44H61N11O10Purity:Min. 95%Molecular weight:904.02 g/molAc-Ser-Asp-Lys-Pro-OH
CAS:<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>Formula:C20H33N5O9Purity:Min. 95%Molecular weight:487.5 g/molFurin Inhibitor II trifluoroacetate salt
CAS:<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/molpTH (1-44) (human)
CAS:<p>Please enquire for more information about pTH (1-44) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C225H366N68O61S2Purity:Min. 95%Molecular weight:5,063.87 g/molNeuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H170N30O40SPurity:Min. 95%Molecular weight:2,656.84 g/molAc-Leu-pNA
CAS:<p>Ac-Leu-pNA is a peptide that is isolated from pyrococcus furiosus. It has the ability to inhibit serine proteases, including trypsin and chymotrypsin, by forming hydrogen bonds with their active site. Ac-Leu-pNA also inhibits the activity of the enzyme proteasome, which breaks down proteins in cells. This inhibition is due to its ability to bind to the ubiquitin-proteasome system (UPS) and block the enzymatic reaction. Ac-Leu-pNA has been shown to have a blood pressure lowering effect in humans.</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/molFmoc-D-Asn(Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Asn(Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Neuromedin U-25 (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C144H217N43O37Purity:Min. 95%Molecular weight:3,142.53 g/molBoc-Pro-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%N-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/mol(Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt
<p>Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H276N46O45Purity:Min. 95%Molecular weight:3,768.37 g/molAcetyl-Pepstatin Ac-Val-Val-Sta-Ala-Sta-OH
CAS:<p>Acetyl-Pepstatin is a protein data inhibitor that binds to the active site of enzymes, inhibiting their function. Acetyl-pepstatin has been shown to inhibit cathepsin D, chymotrypsin, and trypsin. It also inhibits the activity of proteases in the stomach and intestinal tract. Acetyl-Pepstatin is used as an anti-inflammatory drug for the treatment of chronic obstructive pulmonary disease (COPD) and congestive heart failure (CHF). The inhibition of these enzymes reduces inflammation by preventing the activation of inflammatory cytokines. It also prevents collagen from being degraded by proteases, which leads to decreased degradation of cartilage by chondrocytes. This drug's mechanism is similar to that of acetylsalicylic acid (aspirin), in that it inhibits prostaglandin synthesis.br></p>Formula:C31H57N5O9Purity:Min. 95%Molecular weight:643.81 g/molAcetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H193N37O26SPurity:Min. 95%Molecular weight:2,638.15 g/molH-Glu-Gly-Phe-OH
CAS:<p>H-Glu-Gly-Phe-OH is a labile tripeptide molecule that has been synthesized. The tripeptide is synthesized by coupling the amino acid H-Glu to Gly-Phe and then adding an amide bond to form the peptide. This study of the structure of H-Glu-Gly-Phe-OH was done using techniques such as electrospray ionization, chromatographic methods, and proton nuclear magnetic resonance spectroscopy. The compound was found to be neutral in charge and stable at room temperature, but unstable under acidic conditions. It is also soluble in any buffer with a pH range from 2.0 to 12.0 and can be purified by column chromatography or preparative HPLC.</p>Formula:C16H21N3O6Purity:Min. 95%Molecular weight:351.35 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/mol5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H128N32O20Purity:Min. 95%Molecular weight:1,918.13 g/mol(d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H78N13O10S2Purity:Min. 95%Molecular weight:1,121.4 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molH-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23IN4O4Purity:Min. 95%Molecular weight:534.35 g/molBiotinyl-ε-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone
CAS:<p>Please enquire for more information about Biotinyl-epsilon-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56ClN9O6SPurity:Min. 95%Molecular weight:790.42 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molZ-His-Gly-OH
CAS:<p>Please enquire for more information about Z-His-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molFmoc-Tyr(PO3(MDPSE)2)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H54NO8PSi2Purity:Min. 95%Molecular weight:932.15 g/molLeu-Enkephalin (sulfated)
CAS:<p>Leu-Enkephalin (sulfated) H-Tyr(SO3H)-Gly-Gly-Phe-Leu-OH is an endogenous opioid peptide that has been found in the central nervous system. It was first discovered by radioimmunoassays of brain tissue and then later found to be present in other tissues. Leu-enkephalin is not acidic, but it can form a salt with sulfonic acid or carboxylate, which may account for its ability to bind to receptors on cell membranes. The molecular weight of leu-enkephalin is 921.5 daltons and it contains one sulfonation group and one glycosylation site. Leu-enkephalin (sulfated) H-Tyr(SO3H)-Gly-Gly-Phe-Leu-OH can be synthesized from the amino acids Glycine, Tyr(SO</p>Formula:C28H37N5O10SPurity:Min. 95%Molecular weight:635.69 g/molZ-Val-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H36N8O7Purity:Min. 95%Molecular weight:584.62 g/molH-Asp-Asp-Asp-Asp-OH
CAS:<p>Please enquire for more information about H-Asp-Asp-Asp-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N4O13Purity:Min. 95%Molecular weight:478.37 g/molH-Hyp (Bzl)-OH·HCl
CAS:<p>Please enquire for more information about H-Hyp (Bzl)-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H15NO3·HClPurity:Min. 95%Molecular weight:257.71 g/molH-Gly-Gly-His-OH
CAS:<p>H-Gly-Gly-His-OH is a molecule that is found in human serum. It is a ligand with coordination properties and has been shown to bind to copper. H-Gly-Gly-His-OH has been studied spectroscopically in the presence of human serum albumin, and it has been observed that the protonation state and interaction of this molecule are dependent on the speciation and concentration of copper.</p>Formula:C10H15N5O4Purity:Min. 95%Molecular weight:269.26 g/molBoc-Phe-Phe-OH
CAS:<p>Boc-Phe-Phe-OH is a linker that is used to create homologues. It has been shown to be able to form supramolecular structures and encapsulate biomolecules, such as amino acids. The ester linkage of Boc-Phe-Phe-OH can be modified by the addition of a carboxylic acid, which can lead to changes in its fluorescence and magnetic properties. Boc-Phe-Phe-OH is primarily used as an intermediate for fluorescent probes or other molecules.</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molH-Val-Lys-Lys-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H47N9O5Purity:Min. 95%Molecular weight:529.68 g/molH-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Glu-Tyr-OH
CAS:<p>Z-Glu-Tyr-OH is a disulfide bond with a cavity. It is soluble in acidic solutions and has a cationic surface. Z-Glu-Tyr-OH is an enzyme inhibitor that blocks the activity of α subunit of protein kinase C, which is involved in intracellular signal transduction pathways. The inhibition of this enzyme may lead to apoptosis, or programmed cell death. Z-Glu-Tyr-OH also inhibits fatty acid synthesis by blocking the activity of hydroxylase enzymes, such as 3β-hydroxysteroid dehydrogenase and 17α-hydroxylase. This compound has been shown to inhibit indole-3-propionic acid production by inhibiting the kinetic and sephadex g-100 activities of the enzyme indoleamine 2,3 dioxygenase.</p>Formula:C22H24N2O8Purity:Min. 95%Molecular weight:444.43 g/molS-(1,2-Dicarboxyethyl)glutathione
CAS:<p>S-(1,2-Dicarboxyethyl)glutathione is a glutathione analogue that has been shown to prevent acetaminophen-induced hepatotoxicity in mice. It inhibits the reaction between acetaminophen and hepatic microsomal cytochrome P450 enzymes, which prevents the formation of toxic metabolites. S-(1,2-Dicarboxyethyl)glutathione also inhibits the production of serotonin by inhibiting the enzyme tryptophan hydroxylase. This drug has an anticoagulant effect by preventing the conversion of prothrombin to thrombin. S-(1,2-Dicarboxyethyl)glutathione also affects growth factors and collagen synthesis by affecting both epidermal growth factor (EGF) and fibroblast growth factor (FGF). The optimum pH for this drug is at 7.0.</p>Formula:C14H21N3O10SPurity:Min. 95%Molecular weight:423.4 g/molH-Gly-Gly-Met-OH
CAS:<p>H-Gly-Gly-Met-OH is a hydrophobic amino acid with a decelerated reaction. It has been shown to modulate the growth of organisms, such as Staphylococcus aureus and Streptococcus pneumoniae. This molecule also has aspirin-like activity against S. aureus and can be used for cavity prevention. H-Gly-Gly-Met-OH is effective in inhibiting the growth of S. aureus, but not against Streptococcus pneumoniae. The test organism used in this study was Escherichia coli K12. H-Gly-Gly-Met-OH has been shown to have sequences that are similar to those found in kinetically slow peptides and tripeptides, which may explain its stability when encapsulated in liposomes for oral administration.</p>Formula:C9H17N3O4SPurity:Min. 95%Molecular weight:263.32 g/molDynorphin A (1-8) acetate salt
CAS:<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>Formula:C46H72N14O10Purity:Min. 95%Molecular weight:981.15 g/molAc-Ala-Ala-Pro-Ala-AMC
CAS:<p>Ac-Ala-Ala-Pro-Ala-AMC is a substrate for acetylcholinesterase and its structural analogues, including Ac-Ala-Glu-Phe. It has been found to be an isomerase that catalyzes the conversion of L-serine to D-serine in human cells. The enzyme displays a high resolution crystal structure with water molecules bound at the active site. The enzyme is a dimer composed of two identical monomers. The enzyme binds two substrates through hydrogen bonding interactions and then undergoes a conformational change, which releases the products as water molecules are released from the active site.</p>Formula:C26H33N5O7Purity:Min. 95%Molecular weight:527.57 g/molH-Gly-2-chlorotrityl resin (200-400 mesh)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Val-Val-Val-Val-OH
CAS:<p>Please enquire for more information about H-Val-Val-Val-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H38N4O5Purity:Min. 95%Molecular weight:414.54 g/molBoc-4-carboxymethyl-piperidine
CAS:<p>Boc-4-carboxymethyl-piperidine is a novel drug that has been shown to have significant correlations with the inhibition of fibrinogen and cellulose. It also has the ability to inhibit arsenite, which may be due to its dithiocarbamate group. Boc-4-carboxymethyl-piperidine has been shown to have significant biological activity in vitro. This molecule has been synthesized and crystallized, and x-ray data have been collected. The molecular structure of this molecule is shown below:</p>Formula:C12H21NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:243.3 g/mol1-O-Octadecyl-sn-glycerol
CAS:<p>1-O-Octadecyl-sn-glycerol (1ODG) is a dietary lipid that is absorbed by the gastrointestinal tract and transported to the liver. It is used in cell culture as a substitute for lipids that are not available or cannot be used for experiments. 1ODG is also found in human lung and colon tissues, where it may act as a growth factor. 1ODG has been shown to inhibit herpes simplex virus type I (HSV-1) replication in cultured cells by increasing intracellular calcium levels and inhibiting viral DNA synthesis. It can also increase fatty acid synthesis and induce cellular proliferation of tissue culture cells, such as lung fibroblasts.</p>Formula:C21H44O3Purity:Min. 95%Molecular weight:344.57 g/molH-Gly-b-Ala-b-Ala-OH
CAS:<p>Please enquire for more information about H-Gly-b-Ala-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molAloc-Ala-OH·DCHA
CAS:<p>Aloc-Ala-OH·DCHA is a linker that can be utilized in nucleotide synthesis. It is synthesized by reacting the amine group of alanine with the acid chloride of DCHA. The product of this reaction, Aloc-Ala-OH·DCHA, is an amide bond with a free hydroxyl group on one end and a free amino group on the other end. The C-terminal carboxylic acid function of this compound reacts with phosphoramidite to yield the desired n-terminal threonine residue. This linker can also be used to conjugate other compounds such as nucleosides or phosphodiester bonds.</p>Formula:C7H11NO4·C12H23NPurity:Min. 95%Color and Shape:SolidMolecular weight:354.48 g/molH-Trp-Ala-OH
CAS:<p>H-Trp-Ala-OH is a synthetic amino acid that has been used as an analytical reagent. The compound has shown antihypertensive activity in animal studies and can be used to prepare samples for chromatography or spectrophotometry. H-Trp-Ala-OH is soluble in water, but not in ethanol or ether. It has a neutral pH, and the carbonyl group makes it spontaneously fluorescent.</p>Formula:C14H17N3O3Purity:Min. 95%Molecular weight:275.3 g/mol
