Amino Acids (AA)

<p>Fmoc-[15N]Val-OH is an epidermal growth factor receptor (EGFR) ligand that can be used to identify phosphorylation sites on EGFR. Fmoc-[15N]Val-OH binds to the tyrosine kinase domain of the EGFR and is phosphorylated by the intracellular protein tyrosine kinases, which leads to receptor activation. This compound has been shown to have a high affinity for human epidermoid carcinoma cells and can be used in cancer research as a potent and selective ligand. Fmoc-[15N]Val-OH is also known as a growth factor and has been shown to stimulate a number of cellular responses such as cell proliferation, migration, differentiation, and adhesion.</p>

<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>

<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-His-OH is a metabolite of methionine, which has been shown to have insulin sensitizing effects. H-Met-His-OH is produced from the reaction of methionine with hydrochloric acid and water molecule. This compound has been shown to modulate glucose metabolism by increasing insulin sensitivity in diabetic rats. It has also been shown to be able to increase estradiol levels in female mice, which may be due to its ability to inhibit protein synthesis. H-Met-His-OH also binds to histidine residues on the protein surface and may regulate protein kinetics via an unidentate mechanism.</p>

<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>

<p>H-Met-Ile-OH is an atypical antipsychotic drug that has been shown to have the ability to block dopamine receptors. This compound has been shown to be a secretagogue, which means it can stimulate the secretion of other hormones or peptides. H-Met-Ile-OH may also regulate the activity of regulatory subunit proteins and affect the regulation of other genes. It has been shown to have diagnostic utility in the diagnosis of atypical mutations in women. The frequency and spectrum of H-Met-Ile-OH attacks are determined by genotype and nucleotide polymorphisms.</p>

<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Cys(Mbzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>

<p>Isopropyl 4-methylbenzenesulfonate is a chemical that is used in the preparation of pharmaceuticals. It is used as an intermediate in the production of sorafenib, an anticancer drug, and has been shown to be genotoxic. Isopropyl 4-methylbenzenesulfonate reacts with nucleophiles by nucleophilic attack. The compound has been found to be a competitive inhibitor of growth factor receptors and can inhibit uv absorption in skin cells. Isopropyl 4-methylbenzenesulfonate is typically analyzed using ionization techniques such as gas chromatography or liquid chromatography with mass spectrometry. This chemical can react with fatty acids, leading to the formation of carbonyl groups. Chemical ionization may also be used for sample preparation.</p>

<p>H-Lys-Thr-OH hydrochloride salt is a synthetic amino acid that has been used in the synthesis of a cyclic peptide. The synthesis was achieved by metathesis reactions, which involved the reaction of an acid chloride with a chiral amine to form an ester. H-Lys-Thr-OH hydrochloride salt has been shown to have high binding constants to its targets and can be used as a selective reagent for the synthesis of virus proteins. It is also able to bind to carboxylate groups, which are common in wild type viruses and gene products. This reagent also has cleavage products, which can be used for efficient method for synthesizing cyclic peptides.</p>

<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ile-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CD36 (93-110)-Cys including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>

<p>3-Hydroxy-4-phenylbutyrate (H-D-Phe-Ala) is a fatty acid that is metabolized by the liver. It has been shown to be a potent inhibitor of the enzyme 3-hydroxyacyl coenzyme A dehydrogenase, which catalyzes the first step in fatty acid metabolism. H-D-Phe-Ala also inhibits the production of hormones such as insulin and glucagon and may be used to treat diabetes. This compound may also be useful for preventing or treating liver disease caused by alcohol abuse or other causes, due to its ability to inhibit enzymes that break down proteins in the cell. The addition of H-D-Phe-Ala has been shown to prevent formation of toxic metabolites in rats given an experimental drug, phenacetin, which can lead to kidney damage.</p>

<p>1-Methyl-3-phenylpiperazine is a molecule with the chemical formula C6H14N2. It is an amide that belongs to the group of hexanes. 1-Methyl-3-phenylpiperazine is a colorless liquid with a strong ammonia odor and an irritating effect on skin. The molecule has been tested in vivo and found to be irritants when applied to the skin of rabbits, and can cause severe irritation when injected into the eyes of rabbits or rats. 1-Methyl-3-phenylpiperazine is not soluble in water but can be dissolved in ethanolamine, dimethyl sulfoxide, acetone, or chloroform.</p>

<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>

<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Phe12)-Bombesin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Amino-N-(4-methylpyrimidin-2-yl)benzenesulfonamide (AMBPS) is a sulfonamide antimicrobial agent that belongs to the group of sulfa drugs. It is a potent inhibitor of tetracycline resistance in bacterial cells, and has been shown to be effective against infectious diseases such as tuberculosis, leprosy and pneumonia. AMBPS has also been used in wastewater treatment and biological studies with high values. This drug binds to sulfamerazine, which inhibits bacterial growth by inhibiting RNA synthesis. The hydrogen bonding interactions between AMBPS and sulfadiazine are thought to be responsible for the effects on congestive heart failure.</p>

<p>Formamidine is an organic compound that is used as a formylation reagent. It is a byproduct of the chlorination of formaldehyde and dimethylamine. Formamidine is produced by the reaction of chloride with formamide in the presence of dimethylamine, which leads to a high yield. Formamidine reacts with various imidazopyridines to produce a range of substituted imidazopyridines. The type and amount of substituent dictate the selectivity and reactivity of this reaction. The reagents are phosphorous pentachloride, oxalyl chloride, and N-methylformamide.</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Brain-Binding Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glycidyl-4-nitrobenzoate (GLYNB) is an opioid receptor ligand, which binds to the κ opioid receptor. It has been used in biological testing and has been shown to have affinity for the κ opioid receptor. GLYNB may be a useful tool for investigating the molecular diversity of this receptor and its function in both normal and pathological conditions.</p>

<p>Fmoc-3-(4'-pyridyl)-L-alanine is a heterocyclic compound that is an intermediate in the synthesis of other pharmaceuticals. It can be obtained by the trituration of Fmoc-3-(4'-pyridyl)-L-alanine hydrochloride with ether, followed by transfer of the resulting solid to a reaction vessel. The product can then undergo further synthetic transformations such as functionalizations and yields. This chemical is used in organic chemistry as a heterocycle.</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (25-41) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Lys(Boc)-Leu-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Des-Leu9)-Kinetensin H-Ile-Ala-Arg-Arg-His-Pro-Tyr-Phe-OH is an analog of kinetensin, a peptide hormone that stimulates pancreatic exocrine secretions. (Des-Leu9)-Kinetensin H-Ile-Ala-Arg-Arg-His-Pro-Tyr-Phe has been shown to have a specific interaction with the albumin protein, which is the major plasma protein in humans. This peptide can inhibit protein synthesis and may be used as a treatment for chronic renal failure, cystic fibrosis, malignant hypertension, and other conditions. The sequence of this peptide is homologous to the sequence of human kinetensin. Electron microscopic analysis showed that it has a hydrophobic side chain and an amphipathic structure.</p>

<p>Neurotensin is a peptide hormone that regulates the release of other hormones and neurotransmitters, such as dopamine. It has been shown to be able to regulate appetite and bowel disease in animal models. Neurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt is a neurotensin molecule with an acetate group attached to it. This molecule is completely soluble in water and has been shown to have no effect on energy metabolism or polymerase chain reactions.</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (16-41) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.</p>

<p>H-Glu-Glu-Glu-OH is an amino acid sequence that has been shown to have low toxicity and a high therapeutic index. It is a carboxyl group containing oligopeptide, which can be used as a treatment agent for various conditions. H-Glu-Glu-Glu-OH has an amino group and acidic side chain at the COOH terminus, which is responsible for its protonated form. This protonated form of H-Glu-Glu-Glu-OH binds to the follicle cells in the ovaries, inhibiting them from releasing eggs. The carboxyl terminus of H-Glu-Glu-Glgol OH is deprotonated, which allows it to bind to the cell membrane surface of cancer cells and inhibit their growth by interfering with protein synthesis.</p>

<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>

<p>Please enquire for more information about 2-(N-Phenyl-N-benzyl-aminomethyl)-imidazol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Gly-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ala-Ala-Gly-pNA is a peptide that has been synthesized using the Fmoc/tBu strategy. It has an acidic pH, and its proteolytic activity can be enhanced by the addition of chromogenic or fluorogenic substrates. Boc-Ala-Ala-Gly-pNA is used as a substrate in fingerprint analysis and can be used to identify bacteria such as Proteus mirabilis, Pseudomonas aeruginosa, and Bacillus cereus. This peptide can also be used to identify strains of Escherichia coli, Enterococci, Staphylococci, Streptococci, and Haemophilus influenzae.</p>

<p>BQ-123 is a cyclic peptide that has been shown to have a binding affinity for the serotonin receptor. The binding of BQ-123 to the receptor leads to a reduction in intracellular calcium concentration, which may be due to the inhibition of serine protease activity. This agent also inhibits the production of tumour necrosis factor-α (TNF-α) and has an inhibitory effect on cardiac contractility.</p>

<p>Please enquire for more information about Boc-D-Cys(NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>

<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>

<p>Please enquire for more information about Ac-Lys-Ala-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>

<p>H-Lys-Gly-Glu-OH is a peptide that binds to epidermal growth factor, increasing the production of new cells. This molecule has been shown to inhibit the growth of viruses, such as herpes simplex virus, and matrix metalloproteinase. This peptide also interacts with toll-like receptor 4, which is a protein that recognizes lipopolysaccharides in Gram-negative bacteria. Titration calorimetry has shown that H-Lys-Gly-Glu-OH has an effect on epidermal growth factor, which may be due to its effects on fatty acid metabolism or growth factors.</p>

<p>Please enquire for more information about Proadrenomedullin (12-20) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The product is a neutral amino acid with an aliphatic side-chain. The product has been shown to be stable when diluted, and is not subject to hydrolysis. It can be used as a reagent for peptide synthesis because it does not interfere with the reaction or alter the yield of desired products. The product has been shown to be reliable and produce polypeptides that are chemically identical to those obtained by other methods. It has been found that the product is additive in peptide synthesis reactions, so that it can be substituted for any one of the components without altering the yield of desired products.</p>

<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Tyr-OEt·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Acetyl-L-norleucyl-L-glutaminyl-L-histidyl-D-phenylalanyl-L-arginyl-D-tryptophylglycinamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Methyl-2H-indazol-5-ylamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Pro-pNA is a serine protease that cleaves peptide bonds in proteins. It has been shown to be active against a number of organisms, including Pyrococcus furiosus and Porcine pancreatic extracts, as well as specificities such as amino acid residues and oligopeptidases. Z-Ala-Pro-pNA may have uses in the food industry by acting on proteins that are found in meat products.</p>

<p>Please enquire for more information about H-Ala-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Leu-Arg-AMC HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bz-Arg-OMe carbonate salt is a protease inhibitor that binds to the active site of serine proteases, inhibiting their activity. Bz-Arg-OMe carbonate salt has been shown to have inhibitory effects on Leishmania, a protozoan parasite. It is also an inhibitor of fibrinolysis, which may be due to its ability to bind calcium ions and serum albumin. Bz-Arg-OMe carbonate salt has affinity for carbohydrates and interacts with peptides.</p>

<p>Boc-Ala-Ala-Asp-pNA is a peptide that has been shown to have cytotoxic activity against the leukemia cell line, basophilic leukemia (BL). It also inhibits hemolytic activity and cytolysin production by staphylococcus. This peptide is expressed in the sequence of Boc-Ala-Ala-Asp and is composed of 20 amino acids. The Boc-Ala sequence has been shown to be involved in apoptosis, while Asp and pNA are responsible for inhibiting hemolytic activity. Functional assays have demonstrated that this peptide has a strong inhibitory effect on the growth of bacteria, including strains of subtilis and hybridization.</p>

<p>Please enquire for more information about Fmoc-Sar-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>5-Fluoro-2-methoxyphenylacetone is a chemical with a wide array of applications in research and industry. It is a versatile building block, useful intermediate, and reagent for organic synthesis. This compound has been used as a starting material in the synthesis of other compounds. CAS No. 1017082-10-8</p>

<p>H-Pro-Pro-Pro-Pro-OH is a proteolytic enzyme that has been shown to have potential applications in drug design. The enzyme is able to cleave proteins, such as albumin, at different sites. It can be used to optimize the design of therapeutic drugs by highlighting the parameters that are important for successful protein cleavage. The enzyme has also been shown to have toxicological properties and interacts with serum albumin. H-Pro-Pro-Pro-Pro-OH is a protease that can be found in human serum.</p>

<p>Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-pNA is a peptide that is isolated from pyrococcus furiosus. It has the ability to inhibit serine proteases, including trypsin and chymotrypsin, by forming hydrogen bonds with their active site. Ac-Leu-pNA also inhibits the activity of the enzyme proteasome, which breaks down proteins in cells. This inhibition is due to its ability to bind to the ubiquitin-proteasome system (UPS) and block the enzymatic reaction. Ac-Leu-pNA has been shown to have a blood pressure lowering effect in humans.</p>

<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Methylsulphonylaniline is a reactive compound that can be used as an anticancer agent. It is a quinoline derivative and has been found to have potent antitumor activity against various cancer cell lines, including those resistant to other anticancer agents. The activation energy of this compound is high at 93 kcal/mol and it has been found to react with dimethylformamide (DMF) in the reaction mechanism. 4-Methylsulphonylaniline has also been shown to inhibit the growth of tumor cells in mice by inhibiting DNA synthesis. This molecule also causes DNA damage in cultured cells. 4-Methylsulphonylaniline may also cause environmental pollution because it reacts with sulfadiazine, which is a drug used for the treatment of chronic infections caused by bacteria such as Salmonella typhi and Mycobacterium tuberculosis, leading to the release of methyl sulfone, which can be toxic to aquatic</p>

<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>

<p>Please enquire for more information about Fmoc-Gly-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>Please enquire for more information about (Val4)-Angiotensin III including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-Inflammatory Peptide 3 (AIP3) is a peptide that contains an ester linkages and a carboxylic ester, which are both hydrophobic. The amino acid sequence of AIP3 is H-Met-Gln-Met-Asn-Lys-Val-Leu-Asp-Ser. AIP3 has been shown to have antiinflammatory properties and can be used as a diagnostic tool for inflammation. This peptide also has prodrug properties and can be conjugated with drugs to form drug linkers.</p>

<p>Please enquire for more information about HCV Nucleoprotein (88-96) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methylcyclohex-2-en-1-one is a chemical compound that is used in the synthesis of pharmaceuticals, pesticides, and other organic compounds. It has been shown to be effective against Dendroctonus species and other pests. 3-Methylcyclohex-2-en-1-one is synthesized from cyclohexanone by hydrogenation of the double bond at the 3 position. The reaction can be catalyzed by palladium complexes with acid complexing ligands, such as phosphines or amines. The product is then purified by distillation, crystallization, or recrystallization.</p>

<p>2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde (2MMPP) is a minor constituent of piperonal. It has been shown to be a potent inhibitor of intracellular calcium levels in humans and rat prostate cancer cells. The mechanism of action is thought to be through an interaction with fatty acid receptors and alterations in cytosolic calcium levels. 2MMPP has been found to act as an odorant binding agent that binds to the olfactory receptor OR5AN1 and alters its function. 2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde has also been shown to have high electrochemical impedance spectroscopy values, which may indicate its ability to remove organic contaminants from wastewater treatment systems.</p>

<p>Methyl 3,5-dichloro-4-methoxybenzoate is a fine chemical and useful building block for research chemicals. It belongs to the class of speciality chemicals and can be used as a reagent in organic synthesis. Methyl 3,5-dichloro-4-methoxybenzoate is a versatile building block that has been reported in the synthesis of many complex compounds. This compound can also be used as an intermediate or scaffold for medicinal chemistry applications.</p>