Amino Acids (AA)

<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Bromophenylalanine is a chemical compound that can be used as a spectroscopic probe to study the dynamics of protein synthesis. It is derived from 4-bromobenzaldehyde, which is oxidized by hydrogen peroxide in the presence of cytochrome P450 reductase and NADPH, yielding 4-bromophenylalanine. This compound has been shown to inhibit protein synthesis by binding reversibly to the synthetase during its synthetic cycle. The binding of 4-bromophenylalanine inhibits the synthesis of peptides with a C-terminal amide group. This inhibition leads to a decrease in the amount of functional groups present in proteins and an increase in the amount of buffers. These effects have been demonstrated through modelling studies using both model organisms and buffer solutions.</p>

<p>H-AKKLSKDRMKKYMARRKWQKTG-NH2 peptide, corresponding to 480-501 amnino acids of Myosin Light Chain Kinase. Myosin Light Chain Kinase is a serine/threonine specific protein kinase that phosphorylates the myosin light chain.</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FA-Phe-Val-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Pro-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Tyr-Ala-OH is a peptidomimetic that has shown promising anti-inflammatory and anticancer properties. It has been found to inhibit the proliferation of human cancer cells and to suppress the growth of human tumor xenografts in mice. It also has shown an ability to cross the blood brain barrier, which may be due to its high lipophilicity. H-Ala-Tyr-Ala-OH inhibits the production of inflammatory cytokines, such as TNFα, IL1β, IL6, and IL8, by inhibiting NFκB activation in immune cells. This inhibition leads to decreased inflammation and fibrosis in various tissues. H-Ala-Tyr-Ala-OH is also active against bacteria and viruses, which may be due to its low molecular weight.</p>

<p>Z-Val-Ala-OMe is an anti-leishmanial agent that has been shown to be a more efficient method for the treatment of leishmaniasis than current treatments. It inhibits the growth of Leishmania by inhibiting serine proteases, which are involved in the formation of amorphous material on the surface of these parasites. Z-Val-Ala-OMe is active against both subtilis and licheniformis, with a residue half life of 3 hours at pH 5.5 and 20 degrees Celsius. This drug binds to the surface of Leishmania parasites and inhibits their ability to metabolize phosphite into ethyl esters.<br>The kinetic data obtained from Z-Val-Ala-OMe was measured using immobilized cells in a microtiter plate assay system. The data collected was used to generate a graph showing an initial burst phase followed by a linear phase for up to 72 hours post incubation with the drug</p>

<p>H-Gly-Phe-Ser-OH is a substrate for thermolysin, an enzyme that catalyzes the hydrolysis of peptides to amino acids. It is modified by glycerol, which influences its affinity and nature. The residue can be either modified or unmodified with a specific chain length. The modifications of the residue are important in determining the specificity of the enzyme. H-Gly-Phe-Ser-OH has a high degree of hydrophobicity, which influences the catalytic reaction. This substrate can be used to determine enzyme specificity because it is not cleaved by enzymes such as trypsin and chymotrypsin.</p>

<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>

<p>Fluorogenic substrate for proteosome II</p>

<p>Please enquire for more information about H-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>

<p>Please enquire for more information about pTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Phe-Phe-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Thr(tBu)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Phe-OH Acetate Salt is a peptide that has the amino acids H, Arg, Phe and OH. It is a stable complex with amines and is effective in reducing blood pressure. The binding constants are high, which means that it can be used as an antihypertensive agent. A study on the haemodynamic effects of H-Arg-Phe-OH Acetate Salt showed that it could inhibit the release of noradrenaline levels in the body. The reaction mechanism for H-Arg-Phe-OH Acetate Salt is functional groups plus fatty acids; kidney bean is one of its sources.</p>

<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys-CD36 (139-155) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Phe-OH is a peptide consisting of three amino acids, Valine, Phenylalanine and Hydroxyproline. It is a small molecule that has been shown to have an antihypertensive effect in rats. H-Val-Phe-OH binds to the dihydropyridine receptor on the cell membrane surface, which causes blood vessels to relax and contract. This action leads to decreased blood pressure. The high reactivity of H-Val-Phe-OH with other molecules makes it biodegradable, which means it can be broken down by water or enzymes into smaller molecules that are less harmful to the environment.</p>

<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about BAM-12P (7-12) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Val-OH is a compound that has been shown to inhibit uptake of proton from the environment. It was found to be an effective inhibitor of both protein and lipid uptake in cell culture studies. These effects may be due to its ability to form hydrogen bonds with water molecules, which are required for transport across the membrane. FTIR spectroscopy data show that H-Val-Val-OH forms intermolecular hydrogen bonding with other molecules. Linear regression analysis of FTIR spectroscopic data on H-Val-Val-OH has revealed the presence of nitrogen atoms, which may play a role in its function as an inhibitor.</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>

<p>Please enquire for more information about Biotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-L-beta-homoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pyr-Trp-OEt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Asn-OH is a water-soluble drug that belongs to the group of serotonin reuptake inhibitors. It is a radical prostatectomy drug that has been shown to have disease-modifying effects in patients with benign prostatic hyperplasia. H-Leu-Asn-OH has also been shown to be effective in treating HIV infection and cancer, as well as inhibiting the growth of cancer cells in cell culture. This compound is chemically stable and can be transported across the blood brain barrier. Clinical studies on H-Leu-Asn-OH have found it to be safe for use in humans.</p>

<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>

<p>Ac-Asp-Glu-Val-Asp-aldehyde (pseudo acid) is a pro-apoptotic protein that belongs to the group of pseudo acids. It is able to induce apoptosis. Ac-Asp-Glu-Val-Asp-aldehyde (pseudo acid) can induce neuronal death by activating caspases and apoptosis pathway, which are involved in the process of programmed cell death. This protein also has anti-inflammatory properties, which may be due to its ability to inhibit cyclase activity. Ac-Asp-Glu-Val-Asp (pseudo acid) has been shown to be present at physiological levels in the brain and heart, where it may play an important role in maintaining cell viability.</p>

<p>Z-Ala-Ala-NH2 is a peptide that has been modified. Z-Ala-Ala-NH2 is a hydrolase and has the ability to hydrolyze peptides. It can be used in organic solvents as an unmodified hydrolase, or it can be modified with a nucleophile (such as an amine) to produce an active hydrolase. The unmodified form of Z-Ala-Ala-NH2 has been shown to have high yields and specificity for peptidyl substrates. This modification is also useful for the synthesis of amide bonds in peptides, which are more stable than ester bonds.</p>

<p>Necrostatin-1 is a small molecule inhibitor that blocks the NF-κB signaling pathway. Necrostatin-1 is a potent inducer of apoptosis and has been shown to inhibit necroptosis in cell culture. It also blocks the Toll-like receptor 4 (TLR4), which is an important death receptor that causes inflammation. Necrostatin-1 has been found to be effective in reducing injury and death in low doses, but has not been tested for long periods of time or at high doses.</p>

L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.

<p>Please enquire for more information about Z-Ile-Leu-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Pro-Gly-OH is a glycan molecule. It is an artificially synthesized glycan that was designed to act as a neutralizing agent for HIV. It binds to the envelope protein gp120 and prevents it from binding to CD4 receptors on cells, thereby preventing viral entry into the cell. H-Gly-Pro-Gly-OH has also been shown to be effective in neutralizing collagenase activity, which may be useful in treating arthritis and other autoimmune disorders.<br>H-Gly-Pro-Gly-OH has been shown to bind to monoclonal antibodies that are used in the development of cancer treatments, such as Herceptin and Erbitux. This binding is thought to be due to sequences within the antibody that correspond with those found on gp120, the envelope protein of HIV.</p>

<p>Please enquire for more information about (D-Phe5,Cys6·11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-beta-(7-Methoxycoumarin-4-yl)-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6-Bromo-1-methylindazole is an industrial chemical that can be synthesized by the reaction of formate, methanol, and indazole. The synthesis method involves the esterification of methyl formate with indazole to produce 6-bromo-1-methylindazole. It can also be synthesized by the annulation of methyl formate and cyclopentadiene followed by hydrolysis. This chemical has several isomers that are distinguished from each other based on their synthesis methods. 6-Bromo-1-methylindazole has been shown to have a hydrolysis reaction when it reacts with water, producing methyl bromide and hydrogen bromide.</p>

<p>Z-Phe-Cit-AMC is a fluorescent substrate for the enzymes cysteine and peptide aminopeptidases. It has been synthesized by conjugating 7-amino-4-methylcoumarin with L-phenylalanine. The product is useful in assays to measure the activity of these enzymes, which are involved in protein digestion and wound healing. Z-Phe-Cit-AMC can be hydrolyzed by bromelain, ficin, or papain and it can be used as a substrate for enzyme reactions.</p>

<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Proctolin is a peptide hormone that regulates the growth of the ovary. Proctolin has been found to be a proteolytic molecule that specifically cleaves at the carboxy-terminal end of the protein substrate. It also has inhibitory effects on the activity of carboxypeptidase, an enzyme involved in the digestion and absorption of proteins. Proctolin has been shown to modulate biological studies, such as nitrogen atoms and sequences, which may be due to its ability to regulate and stimulate biosynthesis.</p>

<p>Z-Ala-His-OH is a peptide consisting of three amino acids. It has been shown to have an optimal activity at pH 4.5, and can be recycled. Z-Ala-His-OH is synthesized by introducing the amino acid building blocks into a reaction system, where they are systematically introduced at different positions in order to produce the desired peptide sequence. Z-Ala-His-OH is an ionizable molecule that shows high affinity for the active site of its target enzyme. This property makes it useful in solvents with low dielectric constants, such as water or organic solvents with acidic properties. The kinetic behavior of this molecule has been studied systematically by measuring its rate of reaction in different solvents with different pH values and concentrations of reactants.END&gt;</p>

<p>3-Amino-4-methoxybenzyl sulphone is a high quality, versatile building block that is used in the synthesis of complex compounds. It is a reagent that can be used for reactions such as the coupling of amines and carboxylic acids. 3-Amino-4-methoxybenzyl sulphone is also useful in the synthesis of pharmaceuticals and speciality chemicals. The compound has been shown to react with other substances, such as thiols and alcohols, to form new materials with interesting properties.</p>

<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys is a peptide that is found in the brain and spinal cord. It is an agonist of opioid receptors, which are involved in pain relief, as well as motor control. Dynorphin A (1-13) H has been shown to inhibit acetylcholine release, which may be due to its ability to bind to kappa opioid receptors. Dynorphin A (1-13) H is also known to bind to κ opioid receptors, where it inhibits locomotor activity and induces analgesia.</p>

<p>Please enquire for more information about 2-Chloro-3-methoxyphenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Sar 1)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FA-Gly-Leu-OH is a peptidase that catalyzes the hydrolysis of an amide bond in a peptide or protein. It has been shown to be active with acid sequences, as well as transpeptidation, which involves the transfer of a terminal amino acid from one peptide chain to another. FA-Gly-Leu-OH is also involved in the synthesis of proteins and peptides. This enzyme has high hydrolase activity and can hydrolyze most substrates at neutral pH values.</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACTH is a hormone that belongs to the class of endogenous peptides. It is synthesized and secreted by the anterior pituitary gland in response to adrenocorticotropic hormone (ACTH) from the hypothalamus. ACTH has a high affinity for cells with receptors for ACTH and has been shown to stimulate cyclase activity, leading to increased production of cAMP. ACTH also binds to membranes and micelles, which are lipid bilayers with hydrophobic regions. The binding of ACTH at these sites alters the physical properties of these structures by increasing their permeability or solubility. This leads to changes in their functions, including modulation of membrane-bound enzymes such as adenylate cyclase activity.</p>

<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>

<p>Please enquire for more information about Cyclo(-D-Ala-Val) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-(Boc-Aminomethyl)pyrrolidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt is a potent inhibitor of the enzyme kallikrein, which is involved in the production of kinins. It has been shown to inhibit bradykinin breakdown by inhibiting kallikrein and thus prolonging the effects of this hormone. Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt also inhibits aldosterone levels in plasma and reduces glucocorticoid levels, which may be due to its ability to inhibit plasma renin concentrations.</p>

<p>Z-Val-Leu-OH is a model substrate for plant proteases, aminopeptidases and dipeptidases. It has been used as a standard to study the mechanism of hydrolysis by these enzymes. Z-Val-Leu-OH is hydrolyzed by these enzymes at optimally pH 8.0, with the rate increasing with temperature up to 45°C. The hydrolysis of Z-Val-Leu-OH by germination endosperm proteinase is inhibited by hemoglobin, which leads to increased levels of peptides in the endosperm.</p>

<p>Please enquire for more information about D-(-)-2-Chlorophenylglycine methyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Histidine is a non-essential amino acid that is found in all living cells. It is a precursor of histamine and can be converted to tryptophan by decarboxylation. Histidine has been found to be essential for growth in some bacteria and yeast, but not in higher plants or animals. The formyl group of histidine can be oxidized to a sulfoxide or reduced to a formyl group. Histidine residues are often found in the protein matrix of proteomic samples, but can also be used as an analyte. The two most common methods for the detection of histidine are matrix-assisted laser desorption/ionization mass spectrometry (MALDI MS) and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI TOF MS). These methods allow for the minimization of background interference from other molecules present in the sample, such as tryptophan residues.</p>

<p>Ac-Tyr-Val-Lys(biotinyl)-Asp-2,6-dimethylbenzoyloxymethylketone belongs to a group of active compounds and is a cleavage product of the caspase family. It has been shown to induce apoptosis in kidney cells by cleaving the polymeric form of the protein caspase 3, which is induced by viral infection or bacterial infection. This compound is used for coinfection with HIV and HCV. Ac-Tyr-Val-Lys(biotinyl)-Asp-2,6-dimethylbenzoyloxymethylketone can also be used for detecting apoptosis in other types of cells such as erythrocytes and neutrophils.</p>

<p>Please enquire for more information about Fmoc-Gly-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Arg(Pmc)-OPfp is an amino acid that belongs to the group of l-amino acids. It has a molecular weight of 121.12 g/mol and a pKa of 9.78, and it can be used in the synthesis of oligopeptides. Fmoc-Arg(Pmc)-OPfp is also a positional isomer, which means that it has the same chemical formula but different spatial arrangements within the molecule. The position for this amino acid is on the N-terminal side of an alpha carbon atom, meaning that there are two chiral centers at this position on either side of the molecule. These two chiral centers are opposite each other, so they are called enantiomers. The conformation of this amino acid is L-amino acid because its amine group faces towards the right when looking at it from below. In addition, Fmoc-Arg(Pmc)-OPfp contains one specific mon</p>

<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of vildagliptin</p>

<p>Please enquire for more information about H-Gly-Gly-bNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>

<p>Please enquire for more information about H-Gly-Arg-Gly-Leu-Ser-Leu-Ser-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ala-Ala-Asp-pNA is a peptide that has been shown to have cytotoxic activity against the leukemia cell line, basophilic leukemia (BL). It also inhibits hemolytic activity and cytolysin production by staphylococcus. This peptide is expressed in the sequence of Boc-Ala-Ala-Asp and is composed of 20 amino acids. The Boc-Ala sequence has been shown to be involved in apoptosis, while Asp and pNA are responsible for inhibiting hemolytic activity. Functional assays have demonstrated that this peptide has a strong inhibitory effect on the growth of bacteria, including strains of subtilis and hybridization.</p>

<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>

<p>Fmoc-Phe-Ser(tBu)-OH is a pentafluorophenyl ester of the amino acid phenylalanine. It is used in solid-phase peptide synthesis to link amines and carboxylic acids. Fmoc-Phe-Ser(tBu)-OH is used as an intermediate in the synthesis of peptides with a C-terminal amidated or methyl esters. The coupling reaction is catalyzed by 1-hydroxybenzotriazole (HOBT) and N,N'-dicyclohexylcarbodiimide (DCC). HOBT reacts with the hydroxyl group on the β carbon of the ester to form an acetoxy group, which reacts with the amine on the opposite side of the peptide chain to form a new amide bond. DCC reacts with both reactive groups, forming an iminoester intermediate. This intermediate can be hydroly</p>

<p>Please enquire for more information about Fmoc-b-cyano-L-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-Fmoc-amino-10,11-dihydro-5H-dibenzo[a,d]-cycloheptenyl-2-oxyacetyl-DL-Nle-4- methyl-benzhydrylamide resin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Pen (NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I/II (3-7) H-Val-Tyr-Ile-His-Pro-OH is an antagonist of the angiotensin II receptor. It has been shown to be a cognitive enhancer by statistically improving treatments for behavioural problems in rats and mice. Angiotensin I/II (3-7) H-Val-Tyr-Ile-His-Pro-OH has also been shown to inhibit nicotinic acetylcholine receptors, which are involved in mediating the effects of neurotransmitters on muscle cells. This agent also inhibits angiotensin II receptors, leading to vasodilation and reduced blood pressure. The mechanism of action is not yet clear but may involve inhibition of protein kinase C. In preclinical studies, it has been shown that this drug facilitates behavioural effects such as memory retention and motor performance in rats when given before treatment with peptides such as substance P or calcitonin gene related pept</p>

<p>Please enquire for more information about Fmoc-D-Pen (Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>