
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,461 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38244 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H51N11O7•C2HF3O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:839.86 g/molKemptide trifluoroacetate salt
CAS:<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>Formula:C32H61N13O9·xC2HF3O2Purity:Min. 95%Molecular weight:771.91 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N7O5Purity:Min. 95%Molecular weight:359.38 g/mol(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H30N4O4S2Purity:Min. 95%Molecular weight:550.69 g/mol([ring-D5]Phe6)-Somatostatin-14
<p>Please enquire for more information about ([ring-D5]Phe6)-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H99D5N18O19S2Purity:Min. 95%Molecular weight:1,642.91 g/molγ-L-Glutamyl-α-naphthylamide monohydrate
CAS:<p>Gamma-L-glutamyl-alpha-naphthylamide is an enzyme that catalyzes the conversion of L-glutamic acid to L-glutamate. It is expressed in red blood cells, human liver, and human serum. Gamma-L-glutamyl-alpha-naphthylamide has been shown to have various specificities for different tissues and isoenzymes. This enzyme also has immunoassay procedures that are used to detect it in tissues or cells. These assays use monoclonal antibodies or solubilized gamma-L-glutamyl-alpha-naphthylamide molecules as detection agents.</p>Formula:C15H16N2O3•H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:290.31 g/molH-Gly-Pro-Gly-NH2·HCl
CAS:<p>Please enquire for more information about H-Gly-Pro-Gly-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H16N4O3·HClPurity:Min. 95%Molecular weight:264.71 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H218N42O47SPurity:Min. 95%Molecular weight:3,381.65 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/molZ-Ile-Leu-aldehyde
CAS:<p>Please enquire for more information about Z-Ile-Leu-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N2O4Purity:Min. 95%Molecular weight:362.46 g/molH-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
CAS:<p>L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.</p>Formula:C21H42N6O5Purity:Min. 95%Molecular weight:458.6 g/molNecrostatin-1 5-(1
CAS:<p>Necrostatin-1 is a small molecule inhibitor that blocks the NF-κB signaling pathway. Necrostatin-1 is a potent inducer of apoptosis and has been shown to inhibit necroptosis in cell culture. It also blocks the Toll-like receptor 4 (TLR4), which is an important death receptor that causes inflammation. Necrostatin-1 has been found to be effective in reducing injury and death in low doses, but has not been tested for long periods of time or at high doses.</p>Formula:C13H13N3OSPurity:Min. 95%Molecular weight:259.33 g/molH-Val-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Val-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N3O2·HClPurity:Min. 95%Molecular weight:299.8 g/molBoc-Thr(Val-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Val-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/molNeuronostatin-13 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-13 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H112N20O17Purity:Min. 95%Molecular weight:1,445.71 g/molZ-Gly-Pro-bNA
CAS:<p>Z-Gly-Pro-bNA is a peptide that has been synthesized using recombinant DNA technology. It is a carboxyl peptidase inhibitor, which inhibits the enzyme aspartic proteases and metalloendopeptidases. Z-Gly-Pro-bNA has a specific substrate, namely tetrathionate, and it is efficient in hydrolyzing carboxyl groups. This inhibition of the catalytic activity of these enzymes leads to an increase in proline and calcitonin levels. The optimum pH for this reaction is 8.5 to 9.5 and the optimum concentration is 50 to 300 μM.</p>Formula:C25H25N3O4Purity:Min. 95%Molecular weight:431.48 g/mol2,2'-(Perchloro-1,2-phenylene)diacetonitrile
CAS:<p>Please enquire for more information about 2,2'-(Perchloro-1,2-phenylene)diacetonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H4Cl4N2Purity:Min. 95%Molecular weight:293.96 g/mol(D-Phe2·6,Pro3)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H80N14O13Purity:Min. 95%Molecular weight:1,193.35 g/molOsteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H42N10O7Purity:Min. 95%Molecular weight:618.69 g/molBiotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C148H223N43O42S3Purity:Min. 95%Molecular weight:3,372.82 g/molH-Asp-AMC
CAS:<p>Please enquire for more information about H-Asp-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H14N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:290.27 g/molFMoc-L-4-BroMophenylalanine
CAS:<p>FMoc-L-4-BroMophenylalanine is a cell culture substrate that is used to study the interaction between peptides and hydrogels. It can be used as a fluorescent probe in peptide binding assays as well as for studies of protein folding. This product has been shown to be efficient at inducing gelation with other amino acids, such as aspartic acid, glycine, and arginine. FMoc-L-4-BroMophenylalanine also has potential applications for use in classifying peptides based on their charge and size.</p>Formula:C24H20BrNO4Purity:Min. 95%Molecular weight:466.32 g/molH-D-Ser(SO3H)-OH
CAS:<p>Please enquire for more information about H-D-Ser(SO3H)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C3H7NO6SPurity:Min. 95%Molecular weight:185.16 g/molEndothelial-Monocyte-Activating Polypeptide II-Derived Peptide
CAS:<p>Please enquire for more information about Endothelial-Monocyte-Activating Polypeptide II-Derived Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H142N26O22Purity:Min. 95%Molecular weight:1,832.16 g/molBoc-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Boc-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23N3O6Purity:Min. 95%Molecular weight:317.34 g/molH-Ala-Tyr-Ala-OH
CAS:<p>H-Ala-Tyr-Ala-OH is a peptidomimetic that has shown promising anti-inflammatory and anticancer properties. It has been found to inhibit the proliferation of human cancer cells and to suppress the growth of human tumor xenografts in mice. It also has shown an ability to cross the blood brain barrier, which may be due to its high lipophilicity. H-Ala-Tyr-Ala-OH inhibits the production of inflammatory cytokines, such as TNFα, IL1β, IL6, and IL8, by inhibiting NFκB activation in immune cells. This inhibition leads to decreased inflammation and fibrosis in various tissues. H-Ala-Tyr-Ala-OH is also active against bacteria and viruses, which may be due to its low molecular weight.</p>Formula:C15H21N3O5Purity:Min. 95%Molecular weight:323.34 g/molH-Val-Pro-OtBu·HCl
CAS:<p>Please enquire for more information about H-Val-Pro-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H26N2O3·HClPurity:Min. 95%Molecular weight:306.83 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H222N38O49Purity:Min. 95%Molecular weight:3,161.43 g/molZ-Trp-Val-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about Z-Trp-Val-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N3O5•CF3CO2HPurity:Min. 95%Molecular weight:437.49 g/molH-Leu-Phe-NH2·HCl
CAS:<p>H-Leu-Phe-NH2·HCl is a peptide that has been shown to have antiviral and anticancer properties. It blocks the replication of viruses by interacting with the amino acid sequence on the virus’s outer layer, which prevents the virus from binding to cells. H-Leu-Phe-NH2·HCl has also been shown to have anticancer properties. This peptide stimulates cancer cells to produce proteins that are required for their growth and proliferation, leading to increased tumor size. The effectiveness of this drug is enhanced when combined with other cancer drugs, such as cisplatin or vinblastine. H-Leu-Phe-NH2·HCl also has an excellent safety profile and does not cause any toxicity in healthy cells or tissues.</p>Formula:C15H23N3O2·HClPurity:Min. 95%Molecular weight:313.82 g/molFA-Gly-Nva-NH2
CAS:<p>Please enquire for more information about FA-Gly-Nva-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/molSubstance P (2-11)
CAS:<p>Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a peptide that is the product of proteolytic cleavage of substance P. It binds to the neurokinin receptor and induces degranulation in mast cells and sensory neurons. It has been used as a diagnostic tool for mast cell degranulation. Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe has also been used to assess lung function in anesthetized animals, circulations in muscle, and changes in perfusion during surgical procedures.</p>Formula:C57H86N14O12SPurity:Min. 95%Molecular weight:1,191.45 g/molType A Allatostatin III
CAS:<p>Please enquire for more information about Type A Allatostatin III including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H62N10O12Purity:Min. 95%Molecular weight:899 g/molH-Gly-Gly-His-OH
CAS:<p>H-Gly-Gly-His-OH is a molecule that is found in human serum. It is a ligand with coordination properties and has been shown to bind to copper. H-Gly-Gly-His-OH has been studied spectroscopically in the presence of human serum albumin, and it has been observed that the protonation state and interaction of this molecule are dependent on the speciation and concentration of copper.</p>Formula:C10H15N5O4Purity:Min. 95%Molecular weight:269.26 g/molZ-Ala-Pro-OH
CAS:<p>Z-Ala-Pro-OH is a synthetic, analog substrate for serine proteases. It is used as a target cell for schistosomiasis, which are parasitic worms that infect humans and cause the disease. The molecule is localized in the digestive tract of the parasite, where it has biochemical properties that are analogous to those found in the natural substrate (serine protease) of this organism. Z-Ala-Pro-OH has been shown to inhibit the growth of various species of schistosomes, including Schistosoma mansoni. It also has immunoregulatory properties and can be used to stimulate antibody production by B cells when combined with an antigen.</p>Formula:C16H20N2O5Purity:Min. 95%Molecular weight:320.34 g/molLauroyl lysine
CAS:<p>Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.</p>Formula:C18H36N2O3Purity:99.18%Color and Shape:White To Off-White Solid With Characteristic Faint OdorMolecular weight:328.49Endomorphin-2 trifluoroacetate salt
CAS:<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS:<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>Formula:C54H56N6O13Purity:Min. 95%Molecular weight:997.06 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/molBradykinin (1-3) sulfate salt
CAS:<p>Bradykinin (BK) is a peptide hormone that is released by the endothelium of blood vessels in response to injury. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is a synthetic version of the BK sequence with sulfate groups on the amino acids and an additional acid substitution. This molecule has been shown to be fully functional as a copolymer in thrombin activation, oligopeptide, and angiotensin production. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is stable at pH 3 and above, which makes it suitable for use in nutrient media, such as media for growing bacteria or yeast. It also has been shown to have platelet aggregation properties similar to those found in natural BK.</p>Formula:C16H28N6O4Purity:Min. 95%Molecular weight:368.43 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H78N14O11Purity:Min. 95%Molecular weight:1,111.3 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/mol(p-Amino-Phe6)-Angiotensin II
CAS:<p>Please enquire for more information about (p-Amino-Phe6)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H74N12O12Purity:Min. 95%Molecular weight:1,071.23 g/molCyclo(-Pro-Gly)3
CAS:<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O6Purity:Min. 95%Molecular weight:462.5 g/molH-Gly-Arg-Asp-Gly-Ser-OH
CAS:<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molHirudin (54-65) (sulfated)
CAS:<p>Hirudin is a protein that functions as an anticoagulant by binding to the active site of thrombin, preventing it from converting fibrinogen into fibrin. It has a high affinity for the thrombin receptor and can be modified in various ways. Hirudin's most common modification is sulfation, which enhances its anticoagulant activity. Hirudin is a proteolytic enzyme that can be synthesized using solid-phase chemistry. Its biological function is to inhibit blood coagulation by inhibiting the conversion of fibrinogen to fibrin. Hirudin binds to thrombin, preventing it from converting fibrinogen into fibrin and thus inhibits coagulation. It also prevents clot formation by inhibiting platelet aggregation, which may result from interactions with other proteins such as prothrombin and factor VIII.</p>Formula:C66H93N13O28SPurity:Min. 95%Molecular weight:1,548.58 g/molNeurotensin (1-8) Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-OH
CAS:<p>Neurotensin (NT) is a peptide that has been implicated in the regulation of feeding behavior, cardiovascular function, and pain perception. The neurotensin receptor is a G-protein coupled receptor with seven transmembrane domains. Neurotensin binds to the receptor and activates it by inducing intracellular calcium mobilization and neurotransmitter release. This activation can be dose-dependent, as seen in experiments using rat brain slices incubated with different concentrations of NT. Neurotensin also induces maximal activation at low concentrations, which may be due to its ability to bind to both extracellular and intracellular receptors. NT binds selectively to ventral tegmental area neurons from rats, leading to increased spontaneous firing rates. Cancer cells have been shown to express high levels of neurotensin receptors on their surface membrane, which may contribute to tumorigenesis and metastasis. Neurodegenerative diseases such as Alzheimer’s disease are thought to involve alterations in the expression or</p>Formula:C46H71N13O14Purity:Min. 95%Molecular weight:1,030.14 g/molBoc-Ser(Ala-Fmoc)-OH
CAS:<p>Boc-Ser(Ala-Fmoc)-OH is a synthetic amino acid that is used in peptide synthesis. It is typically prepared by the condensation of Serine with diethyl Fmoc-amino acid and hydrochloric acid. This molecule has an efficient epimerization process, which allows for the synthesis of the other enantiomer, L-Ser(Ala-Fmoc)-OH. The synthetic method for Boc-Ser(Ala-Fmoc)-OH can be used to synthesize peptides from amino acids.</p>Formula:C26H30N2O8Purity:Min. 95%Molecular weight:498.53 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molRetrocyclin-1 trifluoroacetate salt
CAS:<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/molBoc-Arg-SBzl·HCl
CAS:<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N4O3S·HClPurity:Min. 95%Molecular weight:416.97 g/molAc-Ser-Gly-OH
CAS:<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molZ-Arg-Arg-pNA·2 HCl
CAS:<p>Please enquire for more information about Z-Arg-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H36N10O6·2HClPurity:Min. 95%Molecular weight:657.55 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H86N18O12Purity:Min. 95%Molecular weight:1,239.43 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS:<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>Formula:C15H23N3O10Purity:Min. 95%Molecular weight:405.36 g/molBoc-Ala-Gly-Sar-OH
CAS:<p>Please enquire for more information about Boc-Ala-Gly-Sar-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23N3O6Purity:Min. 95%Molecular weight:317.34 g/molExtracellular Death Factor trifluoroacetate salt
CAS:<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>Formula:C27H36N10O10Purity:Min. 95%Molecular weight:660.64 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/molHCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H99N15O14SPurity:Min. 95%Molecular weight:1,214.52 g/molMet-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H47N9O8SPurity:Min. 95%Molecular weight:729.85 g/molAdrenomedullin (11-50) (rat)
CAS:<p>Please enquire for more information about Adrenomedullin (11-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H304N58O59S4Purity:Min. 95%Molecular weight:4,521.11 g/molAc-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2
CAS:<p>Please enquire for more information about Ac-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H116N24O17Purity:Min. 95%Molecular weight:1,721.96 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Homoarg-OH·HCl
CAS:<p>Please enquire for more information about Boc-Homoarg-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H24N4O4·HClPurity:Min. 95%Molecular weight:324.8 g/molH-Asp-Gly-OH
CAS:<p>H-Asp-Gly-OH is a peptide hormone that belongs to the group of hydroxylated aspartic acid. This peptide hormone has been shown to be a lymphocyte transformation factor in vitro and stimulates the production of collagen and other proteins. It has also been shown to have anticarcinogenic effects on bone cancer cells, which may be due to its ability to induce apoptosis. H-Asp-Gly-OH has a neutral pH and forms stable complexes with metal ions, such as copper and zinc, which are important for a variety of biological functions.</p>Formula:C6H10N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:190.15 g/molBIM-23127
CAS:<p>Please enquire for more information about BIM-23127 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H71N11O9S2Purity:Min. 95%Molecular weight:1,178.43 g/molFmoc-D-Cys(Mob)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Cys(Mob)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5SPurity:Min. 95%Molecular weight:463.55 g/molH-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH
CAS:<p>H-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH is a synthetic peptide that has been shown to have a homologous sequence with the amino acid sequence of a primary tumor. This peptide has strong binding affinity to tyrosine kinase, which is an enzyme involved in cellular signal transduction. H-Arg-Arg-Leu-Ile-Glu-Asp-Asn Glu Tyr Thr Ala Arg Gly OH has been shown to inhibit the growth of tumors and can be used as an analytical method for identifying carcinoma cells in vitro. HAAGLTEIGDATASNTTAHARGLTRALAGRGGYOH is also a potential drug for cardiovascular diseases, as it can be taken up intracellularly and may inhibit the proliferation of vascular smooth muscle cells.</p>Formula:C66H109N23O23Purity:Min. 95%Molecular weight:1,592.71 g/molH-Ala-Pro-Ala-OH
CAS:<p>H-Ala-Pro-Ala-OH is a fluorescent amino acid residue that can be used to study the structures of proteins. This amino acid is derived from histidine, and its fluorescence intensity increases when it binds to tryptophan residues near the active site of an enzyme. H-Ala-Pro-Ala-OH has been used for the structural analysis of mutant enzymes that have been engineered to show differences in substrate binding sites. This molecule also has a fluorogenic substrate, which can be used as a replacement for traditional substrates in order to highlight specific regions of a protein or enzyme. The quantum theory was used to calculate the x-ray diffraction data, which were then analyzed using software programs such as MOLMOL and XPLOR. These datasets were then used to create molecular models of H-Ala-Pro-Ala-OH.</p>Formula:C11H19N3O4Purity:Min. 95%Molecular weight:257.29 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/molH-Ser-Gln-OH
CAS:<p>H-Ser-Gln-OH is an analog of the amino acid serine. It is a programmed protein that is responsible for DNA damage and is incrementally produced during radiation therapy. This protein phosphorylates at the end of a homologous sequence, which damages the DNA strand. H-Ser-Gln-OH can also phosphorylate other proteins, leading to cell death by apoptosis or necrosis. The rate of H-Ser-Gln-OH production may be increased in plants by photorespiration and endoreduplication, as well as by reactive oxygen species (ROS). The production of H-Ser-Gln-OH can be inhibited by hydrogen peroxide scavengers such as catalase or superoxide dismutase.</p>Formula:C8H15N3O5Purity:Min. 95%Molecular weight:233.22 g/molGalanin (mouse, rat)
CAS:<p>Structure/Function: mouse, rat</p>Formula:C141H211N43O41Purity:Min. 95%Molecular weight:3,164.45 g/molH-D-ASN-L-ASP-OH
<p>Please enquire for more information about H-D-ASN-L-ASP-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Color and Shape:PowderAcetyl-Hirudin (54-65) (sulfated)
CAS:<p>Please enquire for more information about Acetyl-Hirudin (54-65) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H95N13O29SPurity:Min. 95%Color and Shape:PowderMolecular weight:1,590.62 g/molH-Lys(Z)-AMC·HCl
CAS:<p>Please enquire for more information about H-Lys(Z)-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N3O5·HClPurity:Min. 95%Molecular weight:473.95 g/molFmoc-Val-Pro-OH
CAS:<p>Fmoc-Val-Pro-OH is a low molecular weight amino acid that has anticoagulant properties. It is synthesized by activating the carboxylic acid group of pipecolic acid with an N,N'-dicyclohexylcarbodiimide (DCC) activated ester of thiazolidinecarboxylic acid and then reacting it with a basic amino acid. The resulting product is a peptide consisting of Val, Pro, and OH groups. This compound has been shown to inhibit blood clotting in rats and rabbits. Fmoc-Val-Pro-OH also has been shown to be effective in preventing postoperative blood clots in dogs undergoing surgery for repair of cranial cruciate ligament rupture.</p>Formula:C25H28N2O5Purity:Min. 95%Molecular weight:436.5 g/molL-m-Tyrosine
CAS:<p>L-m-Tyrosine is a nonessential amino acid that is synthesized from phenylalanine. It has been shown to have antioxidant properties and protects against oxidative injury by scavenging reactive oxygen species such as hydrogen fluoride. L-m-Tyrosine has also been shown to modulate dopamine levels in the brain and may be used in the treatment of Parkinson's disease. The biological effects of L-m-Tyrosine are mediated through the transcriptional regulation of genes encoding proteins involved in dopamine β-hydroxylase and hydrogen fluoride detoxification. L-m-Tyrosine is also an experimental model for studying drug resistance in bacteria, including methicillin resistant Staphylococcus aureus (MRSA).</p>Formula:C9H11NO3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:181.19 g/molH-Phe-Phe-Phe-Phe-Phe-OH
CAS:<p>H-Phe-Phe-Phe-Phe-Phe-OH is a peptide that inhibits the protease dpp-iv. It is a potent inhibitor of dpp-iv, with an IC50 value of 0.2 μM. H-Phe-Phe-Phe-Phe-Phe-OH is not active against other proteases, such as papain and cathepsin B, and it does not inhibit the activity of pepsin. The inhibition effect of HFPHP has been shown to be dose dependent. Inhibition of dpp-IV by HFPHP leads to inhibition of the activation of other proenzymes such as trypsin and chymotrypsin, which are required for protein digestion in the stomach.</p>Formula:C45H47N5O6Purity:Min. 95%Molecular weight:753.88 g/molDynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H95ClN20O12Purity:Min. 95%Molecular weight:1,323.98 g/mol(His(1-Me)2)-TRH Pyr-His(1-Me)-Pro-NH2
CAS:<p>Please enquire for more information about (His(1-Me)2)-TRH Pyr-His(1-Me)-Pro-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H24N6O4Purity:Min. 95%Molecular weight:376.41 g/molAc-Phg-OMe
CAS:<p>Please enquire for more information about Ac-Phg-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H13NO3Purity:Min. 95%Molecular weight:207.23 g/molBoc-(Asp(OBzl)16)-Gastrin I (13-17) (human)
CAS:<p>Please enquire for more information about Boc-(Asp(OBzl)16)-Gastrin I (13-17) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H53N7O9SPurity:Min. 95%Molecular weight:843.99 g/molAc-Ala-Pro-Ala-pNA
CAS:<p>Ac-Ala-Pro-Ala-pNA is a transition-state analog inhibitor of serine proteases. In the catalytic cleft, Ac-Ala-Pro-Ala-pNA mimics the carbonyl group and minimizes the active site serine. The hydroxyl group in this compound is responsible for its transition state buildup that leads to hydrolytic reactions. Acetal formation can be observed as an intermediate step in this reaction. Acetal formation occurs when a hydroxylic oxygen atom reacts with a terminal alkoxy or thiohydroxylic carbon atom on the reactant molecule. This reaction is catalyzed by enzymes such as alcohol dehydrogenase, acetaldehyde dehydrogenase, and acetyl transferase.</p>Formula:C19H25N5O6Purity:Min. 95%Molecular weight:419.43 g/molH-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H301N55O56S3Purity:Min. 95%Molecular weight:4,408.01 g/mol(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)
CAS:<p>Please enquire for more information about (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C148H221N41O47SPurity:Min. 95%Molecular weight:3,358.65 g/molZ-Glu-Leu-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Z-Glu-Leu-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N2O7·C12H23NPurity:Min. 95%Molecular weight:575.74 g/molBrain Injury Derived Neurotrophic Peptide
CAS:<p>Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala-Arg-Gly-Ala-Ile-Phe-Gln-Ala-NH2 is a growth factor that has been shown to have antiinflammatory and immunosuppressive effects in autoimmune diseases. It also has the ability to bind to peptides, proteins, and particle surfaces. This peptide has been shown to be effective against cancer cells by inhibiting tumor growth and increasing the effectiveness of radiation therapy. Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala Arg Gly Ala Ile Phe Gln Ala NH2 is also an immunosuppressant that can reduce inflammation caused by infectious diseases such as HIV/AIDS.</p>Formula:C62H102N18O18Purity:Min. 95%Molecular weight:1,387.58 g/molHIV-1 gag Protein p17 (76-84) acetate salt
CAS:<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>Formula:C44H72N10O15Purity:Min. 95%Molecular weight:981.1 g/molFmoc-α-Me-Ser(tBu)-OH
CAS:<p>Please enquire for more information about Fmoc-α-Me-Ser(tBu)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27NO5Purity:Min. 95%Color and Shape:White PowderMolecular weight:397.46 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H37F3N8O11Purity:Min. 95%Molecular weight:838.74 g/molFmoc-Gly-(Dmb)Gly-OH
CAS:<p>Fmoc-Gly-(Dmb)Gly-OH is a synthetic peptide that modulates cellular activity. It encompasses a wide range of activities, such as cancer cell growth and restenosis, fibroid tumors and bowel disease. Fmoc-Gly-(Dmb)Gly-OH has been shown to be an effective chemotherapeutic agent in the treatment of age-related macular degeneration and retinopathy. It also inhibits inflammatory bowel disease and infarction by restricting the production of inflammatory cytokines, such as TNFα, IL1β, and IL6. Fmoc-Gly-(Dmb)Gly-OH can be used to treat endometriosis by inhibiting angiogenesis in the uterus.</p>Formula:C28H28N2O7Purity:Min. 95%Molecular weight:504.53 g/molMetorphamide (free acid)
CAS:<p>Please enquire for more information about Metorphamide (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N14O10SPurity:Min. 95%Molecular weight:985.17 g/mol2-Cyclohexyl-2-hydroxy-phenylacetic acid
CAS:<p>2-Cyclohexyl-2-hydroxy-phenylacetic acid is a potent inhibitor of the cholinergic muscarinic receptors. It has been used as an anticholinergic drug and in pharmaceutical preparations for the treatment of inflammatory diseases. 2-Cyclohexyl-2-hydroxy-phenylacetic acid is used to treat urinary incontinence, although it can also cause constipation. Side effects of 2-cyclohexyl-2-hydroxy phenylacetic acid include headache, drowsiness, dry mouth, and blurred vision. 2 CPHPA is an inorganic acid that reacts with phosphorus pentachloride to form an organic phosphate ester called pentachlorophosphoric acid (PCPA). This reaction can be reversed by adding hydrochloric acid. The PCPA salt of 2 CPHPA is called diethylamine salt.</p>Formula:C14H18O3Purity:Min. 95%Molecular weight:234.29 g/mol3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride
CAS:<p>3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride is a chlorinated, thermosetting emulsifier that is used in the production of pressure sensitive adhesives. This compound has a high viscosity and is used as a retardant and an emulsifier. It is also used as a trichloride to produce vinyl chloride monomer. 3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride inhibits the growth of bacteria by acting as an antimicrobial agent. The mechanism of action for this compound is not fully understood but it has been shown to inhibit protein synthesis in bacteria.</p>Formula:C11H6Cl3NO2Purity:Min. 95%Molecular weight:290.53 g/molH-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H82N10O14Purity:Min. 95%Molecular weight:1,047.25 g/mol(Deamino-Cys1,b-cyclohexyl-Ala4,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>Formula:C50H71N13O11S2Purity:Min. 95%Molecular weight:1,094.31 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molH-Arg-Trp-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O2·2HClPurity:Min. 95%Molecular weight:432.35 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molFmoc-[D4]Ala-OH
CAS:Controlled Product<p>Please enquire for more information about Fmoc-[D4]Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H13D4NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:315.35 g/molH-Gly-Gly-Glu-Ala-OH
CAS:<p>H-Gly-Gly-Glu-Ala-OH is a carboxylate. It has been shown to be an ionizable molecule with a proton that can exist in either the hydrated or dehydrated form. The proton of the carboxylate group can move between the two forms and the ionization state depends on pH and temperature. H-Gly-Gly-Glu-Ala-OH is a linear peptide, which means it has an amide group and a residue at each end of the chain. Each of these residues has specific conformations, which are impacted by intramolecular hydrogen bonds. These conformations play a role in determining its pharmacological properties, as well as its function in structural biology and magnetic resonance techniques. H-Gly-Gly-Glu-Ala-OH also has population distribution studies that have been used for diffraction analyses, as well as for titration experiments.</p>Formula:C12H20N4O7Purity:Min. 95%Molecular weight:332.31 g/molAc-Asp(Glu-OH)-OH
CAS:<p>Ac-Asp(Glu-OH)-OH is a low potency, but potentiating compound that binds to the cell cytoplasm. It inhibits the uptake of glutamate into the synaptic cleft by binding to acidic granules. This compound may be neuroprotective and inhibit prostate carcinoma growth. Ac-Asp(Glu-OH)-OH has also been shown to inhibit postsynaptic potentials and decrease glutamate release in cerebellar granule cells.</p>Formula:C11H16N2O8Purity:Min. 95%Molecular weight:304.25 g/molOxyntomodulin (bovine, dog, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C192H295N59O60SPurity:Min. 95%Molecular weight:4,421.82 g/molH-Val-Asn-OH
CAS:<p>H-Val-Asn-OH is a polyhydroxyamine that is soluble in water and has a low freezing point. It can be used as a coating material, sectioning medium, or to study the thermal expansion of materials. H-Val-Asn-OH has been shown to have no significant effect on the growth rate of bacteria and spores. H-Val-Asn-OH is made up of nitrogen atoms, ferrite, and strain. The microstructure of H-Val-Asn-OH includes a phase equilibrium with ferrite and strain morphology.</p>Formula:C9H17N3O4Purity:Min. 95%Molecular weight:231.25 g/molL-Lysine acetate
CAS:Controlled Product<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>Formula:C8H18N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.24 g/molH-Ala-Met-OH
CAS:<p>H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.</p>Formula:C8H16N2O3SPurity:Min. 95%Molecular weight:220.29 g/molH-Pro-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Pro-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O2·HClPurity:Min. 95%Molecular weight:297.78 g/molH-Lys-Pro-Tyr-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molFmoc-D-Leu-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Leu-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%RF9 trifluoroacetate salt
CAS:<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>Formula:C26H38N6O3Purity:Min. 95%Molecular weight:482.62 g/molCionin
CAS:<p>Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.</p>Formula:C53H63N11O19S3Purity:Min. 95%Molecular weight:1,254.33 g/molBoc-Gly-Gly-Leu-pNA
CAS:<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molDnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2
CAS:<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>Formula:C38H57N15O11SPurity:Min. 95%Molecular weight:932.02 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C134H207N41O36SPurity:Min. 95%Molecular weight:3,000.4 g/molH-Cys(farnesyl)-Val-Ile-Ser-OH
CAS:<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H56N4O6SPurity:Min. 95%Molecular weight:624.88 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molH-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH
CAS:<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H77N13O11Purity:Min. 95%Molecular weight:1,156.33 g/molAcetyl-Pepstatin Ac-Val-Val-Sta-Ala-Sta-OH
CAS:<p>Acetyl-Pepstatin is a protein data inhibitor that binds to the active site of enzymes, inhibiting their function. Acetyl-pepstatin has been shown to inhibit cathepsin D, chymotrypsin, and trypsin. It also inhibits the activity of proteases in the stomach and intestinal tract. Acetyl-Pepstatin is used as an anti-inflammatory drug for the treatment of chronic obstructive pulmonary disease (COPD) and congestive heart failure (CHF). The inhibition of these enzymes reduces inflammation by preventing the activation of inflammatory cytokines. It also prevents collagen from being degraded by proteases, which leads to decreased degradation of cartilage by chondrocytes. This drug's mechanism is similar to that of acetylsalicylic acid (aspirin), in that it inhibits prostaglandin synthesis.br></p>Formula:C31H57N5O9Purity:Min. 95%Molecular weight:643.81 g/molBoc-Phe-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molAc-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu-NH2
CAS:<p>The peptide Ac-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu (AFGP) is a small molecule that has been shown to be effective in the prophylaxis and treatment of infectious diseases. AFGP is used as an excipient in intravenous solutions, such as antibiotics, vaccines, and other injectable drugs. It also functions as a diluent for lyophilized products. In addition to its use in the pharmaceutical industry, AFGP is also used as an excipient for vaccine preparations and other injectable drugs. AFGP has been shown to reduce the symptoms of inflammatory diseases, such as asthma and rheumatoid arthritis. This peptide has also been shown to have antiinflammatory and antifibrotic properties.</p>Formula:C96H123N19O22Purity:Min. 95%Molecular weight:1,895.12 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molFmoc-Cit-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cit-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Lactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/mol(R)-4-N-Boc-2-hydroxymethyl-piperazine
CAS:<p>Please enquire for more information about (R)-4-N-Boc-2-hydroxymethyl-piperazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3Purity:Min. 95%Molecular weight:216.28 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/molH-Ser-Asp-Gly-Arg-Gly-OH
CAS:<p>H-Ser-Asp-Gly-Arg-Gly-OH is a peptide and model system for epidermal growth factor. It has been shown to stimulate epidermal growth and protein synthesis in the skin cells. The peptide has also been shown to inhibit fibrinogen production by monoclonal antibody, which is a biochemical marker of wound healing. H-Ser-Asp-Gly-Arg-Gly-OH analogs have been shown to inhibit the activation of epidermal growth factor receptor and have an inhibitory effect on cell growth.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/molFmoc-Tyr(Et)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5Purity:Min. 95%Molecular weight:431.48 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/molFmoc-Mating Factor a TFA salt
CAS:<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H124N20O19S(freebase)Purity:Min. 95%Molecular weight:1,906.21 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H100N22O14S3Purity:Min. 95%Molecular weight:1,449.77 g/mol1-Boc-1-methylhydrazine
CAS:<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/molACTH (1-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N21O20SPurity:Min. 95%Molecular weight:1,680.88 g/molZ-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Z-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone is a mitochondria-targeting compound that has been shown to have neuroprotective and anti-inflammatory properties. It binds to the ATP synthase in the mitochondrial membrane, inhibiting ATP production and causing cell death by apoptosis. ZAFMK also inhibits kinases such as protein kinase 3β (PK3β) and caspase 9, which are involved in inflammation and apoptosis. ZAFMK has been shown to be effective against various diseases such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, Huntington's disease, and stroke.</p>Formula:C29H40FN5O11SPurity:Min. 95%Molecular weight:685.72 g/molFmoc-D-His(1-Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-His(1-Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H35N3O4Purity:Min. 95%Molecular weight:633.73 g/molH-D-Val-Leu-Arg-pNA·2 AcOH
CAS:<p>H-D-Val-Leu-Arg-pNA·2 AcOH is a kallikrein inhibitor that can be used as a blood pressure lowering agent. It inhibits the enzymatic activity of kallikrein, which is responsible for the conversion of kininogen to bradykinin, and thus prevents the production of natriuretic peptides. H-D-Val-Leu-Arg-pNA·2 AcOH has been shown to decrease blood pressure in animals by inhibiting filtration through the glomerulus and by blocking renin release from juxtaglomerular cells.</p>Formula:C23H38N8O5·2C2H4O2Purity:Min. 95%Molecular weight:626.7 g/molIQB-782
CAS:<p>IQB-782 is a mucolytic agent with mucolytic expectorant activity for the study of obstructive lung disease.</p>Formula:C4H9N3O2SPurity:>99.99%Color and Shape:SolidMolecular weight:163.2Angiotensin I/II (1-6)
CAS:<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>Formula:C36H55N11O10Purity:Min. 95%Molecular weight:801.89 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H288N56O57Purity:Min. 95%Molecular weight:4,064.48 g/molBoc-L-glutamic acid γ-methyl ester
CAS:<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>Formula:C11H19NO6Purity:Min. 95%Molecular weight:261.27 g/mol([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Ala-bNA·HBr
CAS:<p>H-Ala-bNA·HBr is a fluorogenic probe for pancreatic amide hydrolase that hydrolyzes the substrate H-Ala-bNA to release fluorescein. The probe has been used in enzymatic methods to identify and characterize the enzyme. The affinity of H-Ala-bNA·HBr for amide hydrolase is high and it can be used as a ligand to study the specificity of this enzyme. H-Ala-bNA·HBr can also be used as a fluorescent probe, with emission at 515 nm, and as a transfer reagent with an acceptor at 540 nm.</p>Formula:C13H14N2O·HBrPurity:Min. 95%Molecular weight:295.18 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Glu-OH
CAS:<p>H-Arg-Glu-OH is a small molecule that is used as a pharmacological agent for the treatment of diabetes. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of inflammatory mediators such as prostaglandin E2 and nitric oxide. H-Arg-Glu-OH also induces apoptosis in human monocytes and macrophages by binding to toll-like receptor 4 (TLR4) on the cell surface. This binding activates NFκB and JNK pathways, leading to the induction of apoptosis. H-Arg-Glu-OH binds with high affinity to monoclonal antibodies against glutamic acid and glycine, which are not present in humans. The compound may be toxic at a neutral pH because it is highly reactive due to intramolecular hydrogen bonding between carbonyl oxygens and amide hydrogens.</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/molMeOSuc-Val-Val-Ile-Ala-pNA
CAS:<p>Please enquire for more information about MeOSuc-Val-Val-Ile-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H46N6O9Purity:Min. 95%Molecular weight:634.72 g/mol(Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H189N33O36Purity:Min. 95%Molecular weight:2,682 g/molZ-Leu-Leu-Nle-aldehyde
CAS:<p>Z-Leu-Leu-Nle (ZLL) is a small molecule that selectively inhibits the activity of the aspartyl protease, BACE1, which is an enzyme that cleaves amyloid precursor protein (APP) to produce amyloid beta peptides. The inhibition of this enzyme has been shown to be effective in preventing or delaying the onset of Alzheimer's disease. ZLL also inhibits estrogen receptor alpha and has antiestrogenic effects in breast cancer cells. This compound induces apoptosis by binding to apoptotic proteins, such as tumor necrosis factor receptor 1, Fas ligand, and TRAIL receptors. It also inhibits cell growth and induces chemoresistance in breast cancer cells.</p>Formula:C26H41N3O5Purity:Min. 95%Molecular weight:475.62 g/mol(Lys(Z)2)-Tuftsin
CAS:<p>Please enquire for more information about (Lys(Z)2)-Tuftsin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N8O8Purity:Min. 95%Molecular weight:634.72 g/mol(Des-Arg9,Leu8)-Bradykinin
CAS:<p>Bradykinin is a peptide hormone that is produced in the body and has been found to be involved in many physiological processes. Bradykinin is formed from the cleavage of a larger protein, kininogen, by the enzyme kallikrein. Bradykinin binds to two types of receptors, B1 and B2. This antibody reacts with both types of receptor. The B2 receptor is found mainly on muscle cells and causes contraction, while the B1 receptor is found mainly on endothelial cells and causes vasodilation. The maximal response of bradykinin occurs when it binds to extracellular receptors. When knockout mice lack either type of bradykinin receptor they have an increased inflammatory response following injection with carrageenan or formaldehyde.</p>Formula:C41H63N11O10Purity:Min. 95%Molecular weight:870.01 g/molGalanin (1-19) (human)
CAS:<p>Please enquire for more information about Galanin (1-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H130N26O25Purity:Min. 95%Molecular weight:1,964.14 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/molH-Arg-Ala-OH acetate salt
CAS:<p>H-Arg-Ala-OH acetate salt (HAA) is a histidine analogue that has been found to have physiological function as an endogenous substrate for serine protease. HAA acts as a competitive inhibitor of the serine protease enzyme by binding to the active site serine in the active site. The molecule is a disulfide bond and can be synthesized by the microorganism Corynebacterium glutamicum. This salt was extracted from yellowtail and found to inhibit corynebacterium glutamicum. X-ray absorption studies showed that the molecule contains a single amino acid, which is an analog of histidine.</p>Formula:C9H19N5O3Purity:Min. 95%Molecular weight:245.28 g/molWRW4
CAS:<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H65N15O6Purity:Min. 95%Molecular weight:1,104.27 g/molH-Arg-Phe-Asp-Ser-OH
CAS:<p>H-Arg-Phe-Asp-Ser-OH is a sequence of amino acids that is found in the protein collagen. It has been shown to be an inhibitor of human immunodeficiency virus type 1 (HIV1) and human insulin-like growth factor 2 (IGF2). In addition, H-Arg-Phe-Asp-Ser-OH is an important molecule for the production of monoclonal antibodies. H-Arg-Phe-Asp-Ser-OH is expressed in mammalian cells, including human cells, which are used as models to study the molecular interactions with HIV1 and IGF2. Monoclonal antibodies against H-Arg-Phe-Asp have been shown to inhibit the replication of HIV1.</p>Formula:C22H33N7O8Purity:Min. 95%Molecular weight:523.54 g/mol(2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester
CAS:<p>Please enquire for more information about (2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H23N5O7Purity:Min. 95%Molecular weight:493.47 g/molFormyl-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H70N16O12Purity:Min. 95%Molecular weight:1,099.2 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/mol1-O-Octadecyl-sn-glycero-3-phosphocholine
CAS:<p>Edelfosine is a phospholipid analog that has been shown to inhibit insulin-induced glucose uptake in adipocytes. It is a potent inhibitor of the insulin receptor tyrosine kinase and can also act as an allosteric inhibitor of protein kinase C (PKC). Edelfosine inhibits the growth of mammary carcinomas by inhibiting PKC, which leads to a decrease in cell proliferation. This drug also interacts with sulfonic acids, forming hydrogen bonds, which may be the reason for its high-performance liquid chromatography. The molecular weight of edelfosine is 582.3 g/mol.</p>Formula:C26H56NO6PPurity:Min. 95%Molecular weight:509.7 g/molH-Gln-Glu-OH
CAS:<p>H-Gln-Glu-OH is a pharmacological inhibitor that blocks the epidermal growth factor receptor (EGFR) and inhibits cell proliferation. It has been shown to inhibit endothelial cell proliferation in vitro. H-Gln-Glu-OH also inhibits the tyrosine kinase activity of EGFR, which is necessary for the activation of phospholipase C. This inhibition prevents atherogenic cell functions and has been shown to inhibit the growth of human epidermoid carcinoma in tissue culture.</p>Formula:C10H17N3O6Purity:Min. 95%Molecular weight:275.26 g/molH-D-Ala-bNA·HCl
CAS:<p>Please enquire for more information about H-D-Ala-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H14N2O·HClPurity:Min. 95%Molecular weight:250.72 g/mol(Glu8·9)-Helodermin
CAS:<p>Please enquire for more information about (Glu8·9)-Helodermin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H283N45O51Purity:Min. 95%Molecular weight:3,845.4 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/molCaloxin 2A1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.52 g/molAc-Gly-Lys-bNA
CAS:<p>Please enquire for more information about Ac-Gly-Lys-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N4O3Purity:Min. 95%Molecular weight:370.45 g/molBoc-Met-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Met-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3'-methoxy apiin;Chrysoeiol-7-(2-O-apiosylglucoside)
CAS:<p>Please enquire for more information about 3'-methoxy apiin;Chrysoeiol-7-(2-O-apiosylglucoside) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-N-Me-Homocys (Trt)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-Homocys (Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H35NO4SPurity:Min. 95%Molecular weight:613.77 g/mol(Cys(Bzl)84)-CD4 (81-92)
CAS:<p>The CD4 molecule is a major component of the human immune system. It interacts with other cells, such as T-cells, and plays an important role in the immune response. The CD4 molecule is a glycoprotein that consists of two subunits, (Cys(Bzl)84)-CD4 and (81-92) H-Thr-Tyr-Ile-Cys(Bzl)-Glu-Val-Glu-Asp-Gln-Lys-Glu-. The sequence of this molecule is important for its function, as it has been shown to be essential for binding to HIV particles. This protein may also play a role in regulating the growth of T cells. It was found that the amino acid sequence of CD4 is not conserved among different species. The amino acid sequence specificity in the CD4 molecule is due to the cysteine residues. These residues are able to form disulfide bridges with other cyste</p>Formula:C69H102N14O26SPurity:Min. 95%Molecular weight:1,575.69 g/molTyr-PDGF A-Chain (194-211)
CAS:<p>Please enquire for more information about Tyr-PDGF A-Chain (194-211) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H181N39O25Purity:Min. 95%Molecular weight:2,341.77 g/molBoc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Thionoser(Bzl)-1-(6-nitro)benzotriazolide
CAS:<p>Please enquire for more information about Boc-Thionoser(Bzl)-1-(6-nitro)benzotriazolide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H23N5O5SPurity:Min. 95%Molecular weight:457.5 g/mol(Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C169H279N53O51S2Purity:Min. 95%Molecular weight:3,933.48 g/molH-Leu-allyl ester·p-tosylate
CAS:<p>H-Leu-allyl ester·p-tosylate is an amide with immobilized amino groups. It is an optically active compound that can be cumulated and used for biomolecular chemistry. H-Leu-allyl ester·p-tosylate has been shown to inhibit the growth of fungi by inhibiting the synthesis of tenuazonic acid, a mycotoxin that is found in contaminated grains.</p>Formula:C9H17NO2C7H8O3SPurity:Min. 95%Molecular weight:343.44 g/molH-Asp-Trp-OH
CAS:<p>H-Asp-Trp-OH is a peptide that has been shown to have antioxidative activity and neuroprotective effects. It has also been shown to be a reactive compound that can interact with other molecules, such as thiobarbituric acid. H-Asp-Trp-OH has been shown to increase the number of neurons in the brain and may be helpful in reducing neuronal damage by apoptotic cell death. This peptide also has potential use in treating neurodegenerative diseases, such as Alzheimer's disease.</p>Formula:C15H17N3O5Purity:Min. 95%Molecular weight:319.31 g/molH-D-Pro-Pro-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Pro-Pro-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/molH-Met-Arg-Phe-Ala-OH
CAS:<p>H-Met-Arg-Phe-Ala-OH is a synthetic peptide that has been shown to be an effective inhibitor of protein synthesis in mammalian cells. It binds to the active site of protein translation machinery, thereby inhibiting the production of proteins vital for cell division. H-Met-Arg-Phe-Ala-OH is stable in aqueous solution and resistant to proteolytic degradation. It also has a high detection sensitivity and can be detected by FTIR spectroscopy, which makes it suitable for use in a variety of applications. H-Met-Arg-Phe-Ala-OH can be used as a tool for studying protein synthesis inhibition or as an antiobiotic agent against cancer cells.</p>Formula:C23H37N7O5SPurity:Min. 95%Molecular weight:523.65 g/molHCV-1 e2 Protein (554-569)
CAS:<p>Please enquire for more information about HCV-1 e2 Protein (554-569) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H111N19O21S3Purity:Min. 95%Molecular weight:1,698.99 g/mol(3,5-Dibromo-Tyr1)-Leu-Enkephalin
CAS:<p>Please enquire for more information about (3,5-Dibromo-Tyr1)-Leu-Enkephalin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H35Br2N5O7Purity:Min. 95%Molecular weight:713.42 g/mol(Cys39)-Tissue Factor (33-53)
CAS:<p>Please enquire for more information about (Cys39)-Tissue Factor (33-53) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H166N26O33S2Purity:Min. 95%Molecular weight:2,456.79 g/molZ-Trp-Ala-OH
CAS:<p>Z-Trp-Ala-OH is an imidazolide that is used as a potassium supplement. It has the potential to be used in the treatment of epilepsy, but more research is needed to determine its safety and efficacy.</p>Formula:C22H23N3O5Purity:Min. 95%Molecular weight:409.44 g/molH-His-Pro-NH2·2 HBr
CAS:<p>Please enquire for more information about H-His-Pro-NH2·2 HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H17N5O2·2HBrPurity:Min. 95%Molecular weight:413.11 g/molH-Ala-D-Gln-OH
CAS:<p>Please enquire for more information about H-Ala-D-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molNps-Val-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H14N2O4S·C12H23NPurity:Min. 95%Molecular weight:451.62 g/molAzilsartan medoxomil
CAS:<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>Formula:C30H24N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:568.53 g/molZ-Leu-Tyr-OH
CAS:<p>The enzyme z-leu-tyr-OH is a peptidyl acid phosphatase that hydrolyzes the phosphate group from peptides. It is activated at acidic ph, and has been shown to hydrolyze the residue of metal ions such as Zn2+, Cu2+ and Hg2+. The enzyme is expressed by tissues such as the pancreas, and has been shown to be involved in the biochemical processes of hyaluronate degradation.</p>Formula:C23H28N2O6Purity:Min. 95%Molecular weight:428.48 g/molBursin (avian)
CAS:<p>Bursin is a vaccine that is used to prevent the infection of avian influenza in chickens. It has been shown to stimulate antibody production and increase the immune response in chickens. Bursin consists of an amino terminal, carboxy terminal, and a peptide sequence that binds to receptors on the surface of cells. Peptides such as bursin are used for sample preparation or expression plasmids in tissue culture experiments. Bursin also has calcium-binding properties and can be used as a histochemical stain for skin cells. The hydroxyl group on the side chain is important for its function.</p>Formula:C14H25N7O3Purity:Min. 95%Molecular weight:339.39 g/mol

