
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,464 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38247 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Z-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>Formula:C18H23N3O6Purity:Min. 95%Molecular weight:377.39 g/molGalanin (1-13)-Neuropeptide Y (25-36) amide
CAS:<p>Please enquire for more information about Galanin (1-13)-Neuropeptide Y (25-36) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H209N41O34Purity:Min. 95%Molecular weight:2,962.37 g/molAc-Gly-Pro-AFC
CAS:<p>Ac-Gly-Pro-AFC is a dipeptidyl peptidase inhibitor that inhibits the action of protein-degrading enzymes called peptidases. Ac-Gly-Pro-AFC has been shown to be effective in treating diabetes by inhibiting the activity of fibroblast activation protein, which is involved in the development of diabetes. Ac-Gly-Pro-AFC also has an inhibitory effect on the enzyme connect, which is involved in cellular proliferation and differentiation. Clinical trials have been conducted to evaluate the efficacy of this drug for treatment of diabetic nephropathy with promising results. Ac-Gly-Pro-AFC has also been shown to have a beneficial effect on collagen synthesis and inhibition of proinflammatory cytokine release from activated macrophages.</p>Formula:C19H18F3N3O5Purity:Min. 95%Molecular weight:425.36 g/mol(Pyr 16)-VIP (16-28) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H114N18O18SPurity:Min. 95%Molecular weight:1,503.81 g/mol1,3-Bis(methoxycarbonyl)-2-methyl-2-thiopseudourea
CAS:<p>1,3-Bis(methoxycarbonyl)-2-methyl-2-thiopseudourea (BMTC) is a novel anticancer agent that has been synthesized to be water soluble and also has significant cytotoxicity. BMTC is believed to exert its anticancer activity by binding to the colchicine binding site on tubulin which is involved in microtubule dynamics. The antitubulin effect of BMTC results in inhibition of cell division and growth. BMTC also inhibits cancer cell proliferation and migration. It has shown significant cytotoxicity against human prostate cancer cells and ovarian cancer cells, as well as inhibiting tumor xenografts in mice.</p>Formula:C6H10N2O4SPurity:Min. 95%Color and Shape:White PowderMolecular weight:206.22 g/molFor-Nle-Leu-Phe-OH
CAS:<p>Nle-Leu-Phe-OH is a potent colony-stimulating factor that binds to the receptor on the surface of cells and stimulates the production of white blood cells. Nle-Leu-Phe-OH has been shown to induce actin filament formation, which is necessary for cell movement. It also induces cytosolic calcium release and enhances protein synthesis. Nle-Leu-Phe-OH also binds to phosphatase and inhibits its activity, which may be due to a conformational change in the enzyme. This process is necessary for the synthesis of DNA and other proteins from amino acids. Nle-Leu-Phe-OH also causes an increase in the uptake of Ca2+ ions by cells.</p>Formula:C22H33N3O5Purity:Min. 95%Molecular weight:419.51 g/molPAR-2 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H55N9O8Purity:Min. 95%Molecular weight:657.8 g/molH-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H61N11O9SPurity:Min. 95%Molecular weight:848.03 g/molH-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH
CAS:<p>Please enquire for more information about H-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H91N17O15Purity:Min. 95%Molecular weight:1,254.44 g/molH-Asp-Arg-Gly-Asp-Ser-OH
CAS:<p>H-Asp-Arg-Gly-Asp-Ser-OH is an amide with a molecular weight of 456.5 and a purity of 99.2%. This compound has been shown to inhibit tumor cell growth in vitro and in vivo, as well as the metastasis of tumor cells. H-Asp-Arg-Gly-Asp-Ser-OH is also capable of inhibiting tumor cells that are resistant to conventional anti cancer drugs such as 5FU, cisplatin, and doxorubicin.</p>Formula:C19H32N8O11Purity:Min. 95%Molecular weight:548.5 g/molFmoc-L-Sec(phenyl)-OH
CAS:<p>Please enquire for more information about Fmoc-L-Sec(phenyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H21NO4SePurity:Min. 95%Molecular weight:466.39 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H129N25O25SPurity:Min. 95%Molecular weight:2,005.22 g/molChloroac-DL-Phe-OH
CAS:<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>Formula:C11H12ClNO3Purity:Min. 95%Molecular weight:241.67 g/molPACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C142H224N40O39SPurity:Min. 95%Molecular weight:3,147.61 g/molZ-Pro-Leu-OH
CAS:<p>The compound Z-Pro-Leu-OH is a peptidomimetic that has been shown to be an effective inhibitor of the enzyme l-amino acid oxidase, which catalyzes the oxidation of l-amino acids. This inhibition may be due to the protonation of the substrate and/or solvents in the enzyme active site. The molecule is hydrophobic, making it suitable for use in simulations and theoretical studies. Furthermore, this compound is identifiable by its retention time on high performance liquid chromatography (HPLC) and can be rationalized by its amide group.</p>Formula:C19H26N2O5Purity:Min. 95%Molecular weight:362.42 g/molHIV-1 rev Protein (34-50)
CAS:<p>Please enquire for more information about HIV-1 rev Protein (34-50) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H173N51O24Purity:Min. 95%Molecular weight:2,437.74 g/molBz-Tyr-4-Abz-OH·sodium salt
CAS:<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H19N2NaO5Purity:Min. 95%Molecular weight:426.4 g/mol5-FAM-Woodtide trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H133N21O26SPurity:Min. 95%Molecular weight:1,945.2 g/molCyclo(-Glu-Glu)
CAS:<p>Please enquire for more information about Cyclo(-Glu-Glu) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N2O6Purity:Min. 95%Molecular weight:258.23 g/molSerpinin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Serpinin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H202N32O46Purity:Min. 95%Molecular weight:2,865.11 g/mol(Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H79N15O10Purity:Min. 95%Molecular weight:1,098.3 g/molMast Cell Degranulating (MCD) Peptide HR-2
CAS:<p>Please enquire for more information about Mast Cell Degranulating (MCD) Peptide HR-2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H135N17O14Purity:Min. 95%Molecular weight:1,523 g/molAF-16 trifluoroacetate salt
CAS:<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>Formula:C71H119N25O25SPurity:Min. 95%Molecular weight:1,754.92 g/molAnti-Inflammatory Peptide 3
CAS:<p>Anti-Inflammatory Peptide 3 (AIP3) is a peptide that contains an ester linkages and a carboxylic ester, which are both hydrophobic. The amino acid sequence of AIP3 is H-Met-Gln-Met-Asn-Lys-Val-Leu-Asp-Ser. AIP3 has been shown to have antiinflammatory properties and can be used as a diagnostic tool for inflammation. This peptide also has prodrug properties and can be conjugated with drugs to form drug linkers.</p>Formula:C43H76N12O15S2Purity:Min. 95%Molecular weight:1,065.27 g/molZ-Val-Ala-OMe
CAS:<p>Z-Val-Ala-OMe is an anti-leishmanial agent that has been shown to be a more efficient method for the treatment of leishmaniasis than current treatments. It inhibits the growth of Leishmania by inhibiting serine proteases, which are involved in the formation of amorphous material on the surface of these parasites. Z-Val-Ala-OMe is active against both subtilis and licheniformis, with a residue half life of 3 hours at pH 5.5 and 20 degrees Celsius. This drug binds to the surface of Leishmania parasites and inhibits their ability to metabolize phosphite into ethyl esters.<br>The kinetic data obtained from Z-Val-Ala-OMe was measured using immobilized cells in a microtiter plate assay system. The data collected was used to generate a graph showing an initial burst phase followed by a linear phase for up to 72 hours post incubation with the drug</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molZ-Gly-Asp-OH
CAS:<p>Please enquire for more information about Z-Gly-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H16N2O7Purity:Min. 95%Molecular weight:324.29 g/molAc-Ser-Gly-OH
CAS:<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molFmoc-Thr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Lys-Gly-Asp-Ile-Lys-Ser-Tyr-pNA
CAS:<p>Please enquire for more information about H-Arg-Lys-Gly-Asp-Ile-Lys-Ser-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H75N15O14Purity:Min. 95%Molecular weight:1,086.2 g/molH-Gly-Arg-Gly-Asp-Asn-Pro-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Asn-Pro-OH is a cyclic peptide that is derived from the amino acid sequence of human collagen. It has been shown to have significant cytotoxicity and act as a chemoattractant for cells. H-Gly-Arg-Gly-Asp-Asn-Pro-OH has also been found to stimulate the growth of fibroblasts and increase the production of collagen, which is an important structural protein in connective tissue. HGRAAAP has been shown to have antiinflammatory properties and can be used to treat autoimmune diseases and infectious diseases, such as papillary muscle dysfunction, which is caused by inflammation. HGRAAAP may also be used to inhibit water permeability into cells, which would be helpful for the treatment of certain cancers that are caused by unregulated cell growth.</p>Formula:C23H38N10O10Purity:Min. 95%Molecular weight:614.61 g/mol(S)-(-)-3-Chloro-1-phenyl-1-propanol
CAS:<p>(S)-(-)-3-Chloro-1-phenyl-1-propanol is an efficient method for the synthesis of chiral propiophenone. It is synthesized by reacting a mixture of borane and tetrahydrofuran with (S)-(-)-3-chloro-1-phenylpropanol. This reaction produces the desired compound in good yield and high diastereoselectivity. The synthesis of this compound has been shown to be useful for the production of antidepressant drugs, such as κ-opioid receptor ligands, which are used to treat depression, anxiety, and chronic pain.</p>Formula:C9H11ClOPurity:Min. 95%Molecular weight:170.64 g/molCopeptin (rat) trifluoroacetate salt
CAS:<p>Copeptin (rat) trifluoroacetate salt is a peptide that belongs to the group of protein inhibitors. It can inhibit the activity of the acetylcholine receptor, which leads to an increase in muscle tone and rigidity. Copeptin is also used as a research tool for studying protein interactions, antibody-antigen reactions, cell biology, ligand-receptor binding, pharmacology and life sciences. Copeptin has been shown to inhibit ion channels such as nicotinic receptors and potassium channels. The CAS number for copeptin (rat) trifluoroacetate salt is 86280-64-0.</p>Formula:C183H307N57O61Purity:Min. 95%Molecular weight:4,281.74 g/molIGF-I Analog
CAS:<p>Please enquire for more information about IGF-I Analog including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H88N14O15S2Purity:Min. 95%Molecular weight:1,249.5 g/molFluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H109N23O18SPurity:Min. 95%Molecular weight:1,628.86 g/molH-Lys-Gly-Trp-Lys-OtBu acetate salt
CAS:<p>The acetate salt of H-Lys-Gly-Trp-Lys is a peptide that has been modified with an acetyl group. The acetate salt is neutral and does not react with other compounds. This compound is a superoxide scavenger and can be used to prevent the formation of reactive oxygen species in biological systems.</p>Formula:C29H47N7O5Purity:Min. 95%Molecular weight:573.73 g/mol(β-Ala8)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H56N8O10SPurity:Min. 95%Molecular weight:780.93 g/molBoc-D-Glu-OEt·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO6·C12H23NPurity:Min. 95%Molecular weight:456.62 g/mol(S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline)
CAS:<p>(S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline) is an asymmetric ligand that is chiral and has been shown to be useful in the preparation of enantiopure alcohols. The compound has been used as a catalyst to prepare aldehydes and ketones. It also has been used in reactions involving dehydration or alkylation. (S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline) can be synthesized by reacting molybdenum with an alcohol and adding a base. This reaction produces the desired product with high selectivity, which is due to its chirality.</p>Formula:C21H22N2O2Purity:Min. 95%Color and Shape:Colourless Or White To Yellow Solid Or Liquid (May Vary)Molecular weight:334.41 g/mol(5-Bromo-2-methoxyphenyl)acetic acid
CAS:<p>5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.</p>Formula:C9H9BrO3Purity:Min. 95%Color and Shape:PowderMolecular weight:245.07 g/molAmyloid Dan Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H268N48O51S2Purity:Min. 95%Molecular weight:4,044.53 g/molC3a (72-77) (human)
CAS:<p>Please enquire for more information about C3a (72-77) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H51N11O7Purity:Min. 95%Molecular weight:665.79 g/molH-DL-Ala-DL-Ala-OH
CAS:<p>H-DL-Ala-DL-Ala-OH is a chemical that belongs to the group of amides. It has been shown to have an inhibitory effect on the growth of bacteria in vitro. The molecular weight and stability of H-DL-Ala-DL-Ala-OH are greater than those of vancomycin, which may be due to its higher nitrogen content. This chemical can be used as a model system for studying the reaction mechanism and structure of vancomycin, including the formation of intramolecular hydrogen bonds and carbonyl oxygens. H-DL-Ala-DL-Ala-OH also has antibiotic properties that are similar to penicillin.</p>Formula:C6H12N2O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:160.17 g/molH-Leu-Ser-Ala-Leu-OH
CAS:<p>H-Leu-Ser-Ala-Leu-OH is a chemical compound that has been shown to bind to 5-HT1B receptors. This receptor belongs to the 5HT1 family of serotonin receptors, which are G protein coupled receptors. The 5HT1B receptor has been shown to have a role in locomotor activity and dopamine release. HLSALLOH is also a specific antibody that reacts with the 5HT1B receptor in rats. The location of this receptor is on the dorsal raphe nucleus and other parts of the brainstem. HLSALLOH has a pH optimum of 6.0 and can be used as an immunogen for polyclonal antibodies against 5HT1B receptors.</p>Formula:C18H34N4O6Purity:Min. 95%Molecular weight:402.49 g/molLeptin (93-105) (human)
CAS:<p>Please enquire for more information about Leptin (93-105) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H110N20O23Purity:Min. 95%Molecular weight:1,527.68 g/molBz-Asn-pNA
CAS:<p>Bz-Asn-pNA is a peptide that is synthesized by the enzyme phosphoenolpyruvate carboxykinase. It has been shown to be an effective inhibitor of proteolytic enzymes, such as aminopeptidases. Bz-Asn-pNA has also been shown to be stable in high salt concentrations and its activity does not change at physiological pH levels. The kinetic constants for Bz-Asn-pNA have been determined using dodecylphosphocholine and endogenous substrate (3H)lysine. The optimum pH for Bz-Asn-pNA is between 7 and 8, which is optimal for protein synthesis.</p>Formula:C17H16N4O5Purity:Min. 95%Molecular weight:356.33 g/mol(D-Thr6,D-Trp8·9,L-alaninol15)-Galanin (1-15)
CAS:<p>Please enquire for more information about (D-Thr6,D-Trp8·9,L-alaninol15)-Galanin (1-15) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C84H117N21O18Purity:Min. 95%Molecular weight:1,708.96 g/molFmoc-Tyr(SO3H)-OH barium salt
CAS:<p>Please enquire for more information about Fmoc-Tyr(SO3H)-OH barium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H21NO8SPurity:Min. 95%Molecular weight:483.49 g/molBoc-Arg-SBzl·HCl
CAS:<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N4O3S·HClPurity:Min. 95%Molecular weight:416.97 g/molH-Phe-Glu-OH
CAS:<p>H-Phe-Glu-OH is a compound that has been shown to significantly increase the uptake of collagen in fibrosarcoma cells. H-Phe-Glu-OH binds to a receptor on the cell surface and activates it, which leads to an increase in collagen uptake. This drug also enhances the production of collagen molecules and can be used for diagnosing diseases such as cancer. H-Phe-Glu-OH does not affect normal cells, making it possible for this drug to be used as a diagnostic tool without harming healthy tissue.</p>Formula:C14H18N2O5Purity:Min. 95%Molecular weight:294.3 g/molH-Trp-Gly-Gly-Tyr-OH
CAS:<p>Please enquire for more information about H-Trp-Gly-Gly-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N5O6Purity:Min. 95%Molecular weight:481.5 g/molH-Thr(tBu)-NH2·HCl
CAS:<p>Please enquire for more information about H-Thr(tBu)-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H18N2O2·HClPurity:Min. 95%Molecular weight:210.7 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H294N54O56Purity:Min. 95%Molecular weight:4,278.74 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C61H83N15O10Purity:Min. 95%Molecular weight:1,186.41 g/molH-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
CAS:<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>Formula:C29H54N8O10Purity:Min. 95%Molecular weight:674.79 g/molAnti-Inflammatory Peptide 1
CAS:<p>Anti-Inflammatory Peptide 1 is a peptide that has been shown to have anti-inflammatory properties. It is synthesized from H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, with the hydroxyl group linked by an ester bond to the N terminal of the peptide. Antiinflammatory peptides can be used as potential biomarkers for inflammatory diseases or as a treatment for these diseases.</p>Formula:C45H82N12O14S2Purity:Min. 95%Molecular weight:1,079.34 g/molFmoc-Gly-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Gly-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H24N2O6Purity:Min. 95%Molecular weight:424.45 g/molSuc-Val-Pro-Phe-SBzl
CAS:<p>Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.</p>Formula:C30H37N3O6SPurity:Min. 95%Molecular weight:567.7 g/mol4-Methylsulphonylaniline
CAS:<p>4-Methylsulphonylaniline is a reactive compound that can be used as an anticancer agent. It is a quinoline derivative and has been found to have potent antitumor activity against various cancer cell lines, including those resistant to other anticancer agents. The activation energy of this compound is high at 93 kcal/mol and it has been found to react with dimethylformamide (DMF) in the reaction mechanism. 4-Methylsulphonylaniline has also been shown to inhibit the growth of tumor cells in mice by inhibiting DNA synthesis. This molecule also causes DNA damage in cultured cells. 4-Methylsulphonylaniline may also cause environmental pollution because it reacts with sulfadiazine, which is a drug used for the treatment of chronic infections caused by bacteria such as Salmonella typhi and Mycobacterium tuberculosis, leading to the release of methyl sulfone, which can be toxic to aquatic</p>Formula:C7H9NO2SPurity:Min. 95%Molecular weight:171.22 g/molH-Pro-Tyr-NH2·HCl
CAS:<p>Noopept is a peptide-like nootropic drug that belongs to the group of analogs of proline. It has been shown to have neuroprotective and cognitive enhancing effects in animal studies, as well as an antipsychotic effect. Noopept is a competitive antagonist of the glutamate receptor, and also has affinity for dopamine and serotonin receptors. Noopept is taken orally and penetrates into the brain quickly, where it interacts with different types of neurotransmitter systems. It also shows translational activity in vitro (in cell culture) and in vivo (in animals). This substance can be detected in human blood plasma following oral administration.</p>Formula:C14H19N3O3·HClPurity:Min. 95%Molecular weight:313.78 g/molCholecystokinin Octapeptide (1-3) (desulfated)
CAS:<p>Cholecystokinin Octapeptide (1-3) (desulfated) is a research chemical that has various applications in the field of chemistry and biology. This compound contains a hydrogen atom that plays a crucial role in solvation processes. It can be used in supercritical reactions due to its ability to interact with hydroxyl groups on metallic surfaces like silicon substrates. Additionally, Cholecystokinin Octapeptide (1-3) (desulfated) is utilized in thiol-ene reactions and chromatographic separations.</p>Formula:C18H25N3O7SPurity:Min. 95%Molecular weight:427.47 g/molPresenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C92H130N28O37SPurity:Min. 95%Molecular weight:2,252.25 g/molPre-S2 (1-26)
CAS:<p>Please enquire for more information about Pre-S2 (1-26) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H199N39O37SPurity:Min. 95%Molecular weight:2,944.29 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H125N27O29Purity:Min. 95%Molecular weight:2,001.08 g/mol1-Methylbiguanide sulfate
CAS:<p>Please enquire for more information about 1-Methylbiguanide sulfate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C4H8N8H2SO4Purity:Min. 95%Molecular weight:266.24 g/molFmoc-Asn(Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H77N17O11Purity:Min. 95%Molecular weight:1,200.35 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H179N35O28SPurity:Min. 95%Molecular weight:2,591.99 g/mol(Met(O)35)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O61SPurity:Min. 95%Molecular weight:4,530.04 g/molH-Met-Met-Met-OH
CAS:<p>H-Met-Met-Met-OH is a synthetic, antifungal drug that inhibits the synthesis of fatty acids. It has been shown to inhibit the growth of E coli K-12, which is responsible for the production of toxic substances in the intestine. H-Met-Met-Met-OH inhibits peptidase activity and fatty acid synthesis by competing with other substrates for uptake into the cell. H-Met-Met-Met-OH also inhibits sugar transport, leading to a decrease in glycolysis and energy production. The drug has been used in clinical trials against Candida albicans and Cryptococcus neoformans.</p>Formula:C15H29N3O4S3Purity:Min. 95%Molecular weight:411.61 g/molZ-D-Orn (Z)-OH
CAS:<p>Please enquire for more information about Z-D-Orn (Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H24N2O6Purity:Min. 95%Molecular weight:400.43 g/molAc-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2
CAS:<p>Please enquire for more information about Ac-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N7O6Purity:Min. 95%Molecular weight:842.04 g/molSarafotoxin C trifluoroacetate salt
CAS:<p>Sarafotoxin C is a peptide from the venom of the spider Phoneutria nigriventer that has been shown to have potent inhibitory properties on endothelin-1. Sarafotoxin C is able to block intracellular Ca2+ levels and signal pathways, leading to decreased levels of endothelin-1 as well as other inflammatory mediators. Sarafotoxin C has also been shown to have an anti-inflammatory effect in bowel disease, which may be due to its ability to inhibit the production of cytokines and prostaglandins. The biological properties of sarafotoxin C are related to its inhibition of polymerase chain reaction (PCR) amplification of DNA. This inhibition is due to the binding of sarafotoxin C with endothelin receptors on DNA, which prevents DNA polymerase from attaching. Endothelin-a receptor activity can also be inhibited by sarafotoxin C through enzymatic inactivation. Sarafot</p>Formula:C103H147N27O37S5Purity:Min. 95%Molecular weight:2,515.76 g/molAc-Arg-Phe-Met-Trp-Met-Lys-NH2 TFA salt
CAS:<p>Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 is an opioid receptor agonist with a high affinity for the μ-, δ-, and κ-opioid receptors. Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 binds to these receptors, thereby inhibiting the release of neurotransmitters that transmit pain signals from the peripheral nerves to the brain. Acetyl fentanyl also inhibits the binding of opioid receptor antagonists such as naloxone, which is used in emergency rooms to block or reverse the effects of opioids. Acetyl fentanyl has been shown to be an effective analgesic in animal studies.</p>Formula:C44H66N12O7S2•xC2HF3O2Purity:Min. 95%Molecular weight:939.2 g/molH-Val-Ser-OH
CAS:<p>L-Threonine is an amino acid that belongs to the branched-chain family of amino acids. It is a nonessential amino acid, meaning that it can be synthesized by the human body. L-Threonine is one of the two amino acids (along with L-Serine) that has a hydroxyl group on the alpha carbon atom. It is also used in certain metabolic pathways such as sphingolipid metabolism and tryptophan metabolism. L-Threonine is used in experimental models for bowel disease and intestinal cancer, but its role in these conditions has not been determined. The molecule can be found in both animal and plant proteins, but most often it occurs in animal sources. The compound can also be found as a component of skin condition treatments or as an additive to shampoos, lotions, and cosmetics.</p>Formula:C8H16N2O4Purity:Min. 95%Molecular weight:204.22 g/molZ-Gly-Gly-Leu-OH
CAS:<p>Glycylglycine is a hydrophobic amino acid that is found in collagen and other proteins. It has been shown to inhibit the activity of proteinases such as chymotrypsin, trypsin, and elastase, which are enzymes that break down proteins. Glycylglycine is a fluorescent molecule that can be detected by fluorescence microscopy and has been used in the study of protein-protein interactions. Glycylglycine is an acidic amino acid with an amino acid composition that consists of about 20% glycine, 40% hydroxyphenylalanine, 30% serine and 10% threonine. The spatial specificity of this compound has been studied using sephacryl electrophoresis, which showed it was localized to the extracellular matrix and in cell culture supernatants. Aminocoumarins are glycylglycines with an attached aminocoumarin group. Hydrolysis of gly</p>Formula:C18H25N3O6Purity:Min. 95%Molecular weight:379.41 g/molZ-Homocit-OH
CAS:<p>Please enquire for more information about Z-Homocit-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N3O5Purity:Min. 95%Molecular weight:323.34 g/mol(Deamino-Cys1,D-Orn 8)-Vasopressin
CAS:<p>Please enquire for more information about (Deamino-Cys1,D-Orn 8)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H62N12O12S2Purity:Min. 95%Molecular weight:1,027.18 g/molFmoc-4-(Boc-amino)-L-phenylalanine
CAS:<p>Fmoc-4-(Boc-amino)-L-phenylalanine is a useful building block, which is used in the synthesis of complex compounds and research chemicals. It is also a reaction component in the synthesis of compounds. Fmoc-4-(Boc-amino)-L-phenylalanine has CAS No. 174132-31-1 and can be used as a versatile building block to produce high quality reagents.</p>Formula:C29H30N2O6Purity:Min. 98 Area-%Color and Shape:SolidMolecular weight:502.56 g/molRetrocyclin-1 trifluoroacetate salt
CAS:<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/molAc-Met-Asp-Lys-Val-Leu-Asn-Arg-Glu-OH
CAS:<p>Please enquire for more information about Ac-Met-Asp-Lys-Val-Leu-Asn-Arg-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H75N13O15SPurity:Min. 95%Molecular weight:1,046.2 g/molOsteocalcin (7-19) (human)
CAS:<p>Please enquire for more information about Osteocalcin (7-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H98N16O19Purity:Min. 95%Molecular weight:1,407.57 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C65H93N15O26Purity:Min. 95%Molecular weight:1,500.52 g/molZ-Pro-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Z-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H34N6O6·HClPurity:Min. 95%Molecular weight:599.08 g/mol5-Bromo-2-hydroxy-3-methyl pyrazine
CAS:<p>Please enquire for more information about 5-Bromo-2-hydroxy-3-methyl pyrazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molH-Leu-Gly-Gly-OH
CAS:<p>H-Leu-Gly-Gly-OH is a protease enzyme that belongs to the family of hydrolases. It has been shown to have proteolytic activity with casein and protein synthesis with pancreatic enzymes. The kinetic data for this enzyme were determined by measuring the rate of hydrolysis at different pH levels. The optimum pH for this enzyme is 6.0, with a maximum activity at pH 7.5 and an inhibition at pH 4.0. This enzyme can be found in either the free form or as an integral membrane protein in lysosomes, where it exhibits high affinity for hydrogen bonds and low affinity for ionic bonds. H-Leu-Gly-Gly-OH is used in analytical methods such as chromatography and spectrophotometry to identify proteins in biological samples.END></p>Formula:C10H19N3O4Purity:Min. 95%Molecular weight:245.28 g/mol[2,6-Dimethyl-4-(3-[2-(Z-amino)-ethylcarbamoyl]-propoxy)-benzenesulfonyl]-Dap (Boc)-OMe
CAS:<p>Please enquire for more information about [2,6-Dimethyl-4-(3-[2-(Z-amino)-ethylcarbamoyl]-propoxy)-benzenesulfonyl]-Dap (Boc)-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H44N4O10SPurity:Min. 95%Molecular weight:664.77 g/molAnti-Kentsin trifluoroacetate salt
CAS:<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H45N11O6Purity:Min. 95%Molecular weight:559.66 g/molCarboxymethyl-Phe-Leu-OH
CAS:<p>Carboxymethyl-Phe-Leu-OH (CMPLE) is a metalloprotease inhibitor that inhibits the activity of proteases, such as serine proteases and cysteine proteases. CMPLE is used to treat infectious diseases caused by bacteria, fungi, or parasites. CMPLE also has been shown to inhibit the formation of inflammatory responses in autoimmune and inflammatory diseases. This drug can be used in combination with benzalkonium chloride or monoclonal antibodies to treat hematopoietic cells. The optimum pH for this drug is 7.5, and it denatures at high temperatures. It also binds to epithelial surface glycoproteins in the gastrointestinal tract and may be useful for treating ulcers caused by Helicobacter pylori infection.</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molAmyloid β-Protein (1-46)
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-46) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C223H347N59O65SPurity:Min. 95%Molecular weight:4,926.57 g/molNeurokinin B trifluoroacetate salt
CAS:<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br><br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>Formula:C55H79N13O14S2Purity:Min. 95%Molecular weight:1,210.43 g/molN-Methyl-1-propanamine
CAS:<p>N-Methyl-1-propanamine is a compound made up of ethylene diamine and activated chlorine. It has been used as a model system to study the biological properties of amines. This compound has been shown to have anti-cancer effects in human serum and is active against inflammation diseases. N-Methyl-1-propanamine is soluble in water, but not in ethanol or acetone. It has a pH optimum at 10 and decomposes at temperatures higher than 120°C. The activation energies for the reactions of this compound with hydrogen bond acceptors, such as alcohols and ethers, are relatively low (around 20 kcal/mol).</p>Formula:C4H11NPurity:Min. 95%Molecular weight:73.14 g/molFA-Lys-Ala-OH
CAS:<p>FA-Lys-Ala-OH is a mutant enzyme that has an expressed constitutive mutation. It is a mutational variant of the wild type enzyme with an additive kinetic effect. The kinetic constants for this mutant were determined and correlated to determine the determinants of the mutations. This mutant has uncharged substitutions in its carboxypeptidase B active site, which changes its pH optimum from acidic to neutral values.</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molAc-Ile-Tyr-Gly-Glu-Phe-NH2
CAS:<p>Please enquire for more information about Ac-Ile-Tyr-Gly-Glu-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H44N6O9Purity:Min. 95%Molecular weight:668.74 g/molH-Tyr-Tyr-OH
CAS:<p>Hydroxyl-Tyr-Tyr-OH is a fatty acid that belongs to the group of dietary lipids. It has been shown to have antioxidative properties and can be used in the treatment of pancreatic cancer. Hydroxyl-Tyr-Tyr-OH has also been shown to be an important regulatory molecule that controls certain cellular processes, including cell growth and differentiation. It may be involved in some disease processes, such as cancer and vasoactive intestinal peptide secretion, as well as being a reaction product of other molecules. Hydroxyl-Tyr-Tyr-OH can be found in urine samples after oral ingestion.</p>Formula:C18H20N2O5Purity:Min. 95%Molecular weight:344.36 g/mol(Asp28)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H281N49O61SPurity:Min. 95%Molecular weight:4,187.56 g/molTRAP-5 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H51N9O6Purity:Min. 95%Molecular weight:633.78 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N5O5·HClPurity:Min. 95%Molecular weight:534.05 g/molCoagulation Factor XIIIa (190-230)
CAS:Controlled Product<p>Please enquire for more information about Coagulation Factor XIIIa (190-230) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C220H322N54O73Purity:Min. 95%Molecular weight:4,891.23 g/mol(Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken)
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H72N16O12Purity:Min. 95%Molecular weight:1,221.33 g/molBoc-D-Ala-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-D-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Methylpentyl chloroformate
CAS:<p>Please enquire for more information about 3-Methylpentyl chloroformate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H13ClO2Purity:Min. 95%Molecular weight:164.63 g/molH-Leu-Leu-Leu-Phe-OMe·HCl
CAS:<p>Please enquire for more information about H-Leu-Leu-Leu-Phe-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H46N4O5·HClPurity:Min. 95%Molecular weight:555.15 g/molBz-Arg-OMe carbonate salt
CAS:<p>Bz-Arg-OMe carbonate salt is a protease inhibitor that binds to the active site of serine proteases, inhibiting their activity. Bz-Arg-OMe carbonate salt has been shown to have inhibitory effects on Leishmania, a protozoan parasite. It is also an inhibitor of fibrinolysis, which may be due to its ability to bind calcium ions and serum albumin. Bz-Arg-OMe carbonate salt has affinity for carbohydrates and interacts with peptides.</p>Formula:C14H20N4O3Purity:Min. 95%Molecular weight:292.33 g/molZ-Pro-D-Leu-D-Ala-NHOH
CAS:<p>Z-Pro-D-Leu-D-Ala-NHOH is a neutralizing peptide that inhibits the activity of elastase and collagenase. It also has potent inhibitory activities against experimental infection with various microorganisms, including Streptococcus pyogenes, Staphylococcus aureus, and Pseudomonas aeruginosa. This peptide is a molecule consisting of 11 amino acids, which is synthesized in vivo by the host as a response to bacterial infections. Z-Pro-D-Leu-D-Ala-NHOH can be used for pharmaceutical preparations or techniques that require an enzyme inhibitor. The biological function of this peptide is not fully understood but it has been shown to have antiestrogenic effects.</p>Formula:C22H32N4O6Purity:Min. 95%Molecular weight:448.51 g/molZ-Leu-Tyr-NH2
CAS:<p>Please enquire for more information about Z-Leu-Tyr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H29N3O5Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:427.49 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C141H235N47O41·xC2H4O2Purity:Min. 95%Molecular weight:3,244.67 g/molH-Glu-Glu-Asp-OH
CAS:<p>H-Glu-Glu-Asp-OH is a tripeptide that is a marker for endothelial cell proliferation. This peptide sequence has been shown to promote endothelial cell function, as well as to have atherogenic properties. The hydrolysate of H-Glu-Glu-Asp-OH has been shown to inhibit the growth of endothelial cells and functions in vitro.END><br>END></p>Formula:C14H21N3O10Purity:Min. 95%Molecular weight:391.33 g/molFmoc-Dap(Adpoc)-OH
CAS:<p>Please enquire for more information about Fmoc-Dap(Adpoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H38N2O6Purity:Min. 95%Molecular weight:546.65 g/molN-(4-Methoxyphenylazoformyl)-Arg-OH·HCl
CAS:<p>Please enquire for more information about N-(4-Methoxyphenylazoformyl)-Arg-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N6O4·HClPurity:Min. 95%Color and Shape:Orange Red SolidMolecular weight:372.81 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH is a peptide that has been shown to have chemotactic activity for monocytes and polymorphonuclear leucocytes, which are cells that participate in the inflammatory response. It also has biological properties that are reactive with hydroxyl groups and can be used to generate monoclonal antibodies. H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH has been shown to stimulate the migration of galleria mellonella larvae, suggesting it may have potential as an antiinflammatory agent.</p>Formula:C28H49N11O11Purity:Min. 95%Molecular weight:715.76 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molAc-Trp-NHMe
CAS:<p>Ac-Trp-NHMe is a hydrogen bond acceptor, which is a functional group that can form hydrogen bonds with other molecules. It is found in proteins and has been extensively studied by protein data bank. The amide group of Ac-Trp-NHMe forms a hydrogen bond with the carbonyl group of the amino acid tryptophan. The molecule has been used as a model system for studying the fluorescence properties of tryptophan, and to understand vibrational spectra. Ac-Trp-NHMe has also been shown to be an important chemical in plants, where it is involved in the formation of the dry weight of plants and water molecules.</p>Formula:C14H17N3O2Purity:Min. 95%Molecular weight:259.3 g/molZ-Ala-Pro-pNA
CAS:<p>Z-Ala-Pro-pNA is a serine protease that cleaves peptide bonds in proteins. It has been shown to be active against a number of organisms, including Pyrococcus furiosus and Porcine pancreatic extracts, as well as specificities such as amino acid residues and oligopeptidases. Z-Ala-Pro-pNA may have uses in the food industry by acting on proteins that are found in meat products.</p>Formula:C22H24N4O6Purity:Min. 95%Molecular weight:440.45 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS:<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Molecular weight:208.07 g/molFmoc-4-Cpa-4-Cpa-OH
<p>Fmoc-4-Cpa-4-Cpa-OH is a versatile building block that can be used to synthesize complex compounds with interesting biological activity. It is a reagent, speciality chemical, and useful scaffold for research chemicals. Fmoc-4-Cpa-4-Cpa-OH has been used in the synthesis of a number of biologically active compounds and as an intermediate for the synthesis of other chemical compounds.</p>Formula:C33H28Cl2N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:603.49 g/mol...(Ala13)-Apelin-13 (human, bovine, mouse, rat) trifluoroacetate salt
CAS:<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>Formula:C63H107N23O16S·xC2HF3O2Purity:Min. 95%Molecular weight:1,474.74 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molN,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine)
CAS:<p>Please enquire for more information about N,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2Purity:Min. 95%Color and Shape:PowderMolecular weight:168.28 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/molFmoc-Lys-OH·HCl
CAS:<p>Fmoc-Lys-OH·HCl is an acidic pyrylium that has been shown to be a potent inhibitor of tumor vasculature. It binds to the human serum albumin and inhibits the binding of ligands to the receptor tyrosine kinases, which are involved in brain tumor proliferation. Fmoc-Lys-OH·HCl has also been shown to inhibit the growth of cancer cells by binding to cell membrane receptors and inhibiting protein synthesis. This compound is also isomeric, meaning it can exist in different forms with different properties.</p>Formula:C21H24N2O4·HClPurity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:404.89 g/molBoc-4-Abz-OSu
CAS:<p>Please enquire for more information about Boc-4-Abz-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N2O6Purity:Min. 95%Molecular weight:334.32 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molPyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/mol(3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin acetate salt
CAS:Controlled Product<p>Please enquire for more information about (3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H33I2N5O6Purity:Min. 95%Molecular weight:765.38 g/molIsovaleryl-Val-Val-Sta-OEt
CAS:<p>Isovaleryl-Val-Val-Sta-OEt is a peptide hormone and active inhibitor of the enzyme pepsin. This drug has been shown to have proteolytic activity in vitro, with a pepsin rate constant of 0.0015 min−1. It also inhibits the protease activity of trypsin, chymotrypsin, and elastase at a similar rate. Isovaleryl-Val-Val-Sta-OEt has been shown to be an active inhibitor of polymerase chain reaction (PCR) and reverse transcriptase activities. This drug is not absorbed through skin and can be used as a nonimmunogenic reagent for biochemical studies on water permeability and signal peptide sequences in biological samples.</p>Formula:C25H47N3O6Purity:Min. 95%Molecular weight:485.66 g/molH-Leu-Gly-Tyr-OH
CAS:<p>H-Leu-Gly-Tyr-OH is a tripeptide that plays a role in cell proliferation, endothelial cell function and endothelial cell proliferation. H-Leu-Gly-Tyr-OH has been shown to be an inhibitor of the production of prostaglandin, which is involved in atherogenesis. H-Leu-Gly-Tyr-OH also inhibits the functions of cells by linking with amide bonds and hydrolysates.</p>Formula:C17H25N3O5Purity:Min. 95%Molecular weight:351.4 g/molZ-His(Bzl)-OH
CAS:<p>Please enquire for more information about Z-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21N3O4Purity:Min. 95%Molecular weight:379.41 g/molH-Gly-Arg-Gly-Asp-OH
CAS:<p>H-Gly-Arg-Gly-Asp-OH is a cyclic peptide with the amino acid sequence of Gly-Arg-Gly-Asp. It has been shown to promote bone formation and inhibit bone resorption in vitro by stimulating the release of growth factors. This peptide can be used as a diagnostic agent for monitoring cell culture, which may be due to its ability to bind monoclonal antibodies. H-Gly-Arg-Gly-Asp-OH also has the ability to form conjugates with polymerase chain reaction (PCR) probes or other biomolecules. These conjugates can be used for detecting specific DNA sequences, such as those found in mammalian cells.</p>Formula:C14H25N7O7Purity:Min. 95%Molecular weight:403.39 g/molH-Cys(Bzl)-Gly-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O3S•(CF3CO2H)xPurity:Min. 95%Molecular weight:268.33 g/molHCV NS4A Protein (22-34) (H strain)
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-34) (H strain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H109N17O15SPurity:Min. 95%Molecular weight:1,328.67 g/molFmoc-Gly-Pro-Hyp-OH
CAS:<p>Fmoc-Gly-Pro-Hyp-OH is a synthetic single-stranded amide with a stepwise hydrogen bond. The synthesis of this compound starts with the creation of an ester by reacting an acid and alcohol in the presence of catalysts. The ester is then reacted with a primary amine to form an amide, which can be hydrolyzed to release the desired product. This synthetic process has been used for the production of collagen and cyclic peptides. Fmoc-Gly-Pro-Hyp-OH has been modified to include modifications such as alkene and modifications such as strategies, synthons, and isosteres.</p>Formula:C27H29N3O7Purity:Min. 95%Molecular weight:507.54 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molMethyltetrazine amine
CAS:<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>Formula:C10H11N5Purity:Min. 95%Color and Shape:PowderMolecular weight:201.23 g/molNeural-Cadherin (76-85) amide (chicken)
CAS:<p>Please enquire for more information about Neural-Cadherin (76-85) amide (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H75N17O13Purity:Min. 95%Molecular weight:1,050.17 g/molH-Ala-Arg-bNA·2 HCl
CAS:<p>Please enquire for more information about H-Ala-Arg-bNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N6O2·2HClPurity:Min. 95%Molecular weight:443.37 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>Formula:C139H231N43O39SPurity:Min. 95%Molecular weight:3,160.65 g/molAngiotensin I/II (3-8)
CAS:<p>Angiotensin I/II (3-8) H-Val-Tyr-Ile-His-Pro-Phe-OH is a peptide that has physiological effects and is used as a drug. It is an active analogue of the peptide hormone angiotensin II, which regulates blood pressure and fluid volume. Angiotensin I/II (3-8) H-Val-Tyr-Ile-His-Pro-Phe-OH binds to angiotensin receptors and stimulates the release of calcium ions from cytosolic stores in cells, leading to increased muscle contractions and vasoconstriction. This drug may also have effects on dopamine levels in the brain, locomotor activity, and biochemical properties such as enzyme activity or protein binding.br><br>Angiotensin I/II (3-8) H-Val-Tyr-Ile-His Pro Phe OH has been shown to reduce the level of dopamine</p>Formula:C40H54N8O8Purity:Min. 95%Molecular weight:774.91 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H85N19O13Purity:Min. 95%Molecular weight:1,208.37 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/molH-Tyr-AMC·TFA
CAS:<p>Please enquire for more information about H-Tyr-AMC·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H18N2O4·C2HF3O2Purity:Min. 95%Molecular weight:452.38 g/molH-Glu-Tyr-Glu-OH
CAS:<p>Please enquire for more information about H-Glu-Tyr-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H25N3O9Purity:Min. 95%Molecular weight:439.42 g/molBoc-Ala-Gly-OSu
CAS:<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N3O7Purity:Min. 95%Molecular weight:343.33 g/molH-Thr-Asp-OH TFA salt
CAS:<p>Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O6C2F3HO2Purity:Min. 95%Molecular weight:348.23 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molFmoc-Lys(N-Me-Abz-Boc)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(N-Me-Abz-Boc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H39N3O7Purity:Min. 95%Molecular weight:601.69 g/molMca-Arg-Pro-Lys-Pro-Gln-OH
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H56N10O11Purity:Min. 95%Molecular weight:840.92 g/molDecanoyl-Arg-Val-Arg-Lys-chloromethylketone
CAS:<p>Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is a potent activin antagonist that has been shown to inhibit follicle development in ovary cells. It also blocks the protease activity of leishmania, which is a parasite that causes cutaneous leishmaniasis. This drug binds to proteases and inhibits their activity by competing with substrates for the active site. Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is not expressed in the submandibular gland or the submaxillary gland, which are salivary glands.</p>Formula:C34H66ClN11O5Purity:Min. 95%Molecular weight:744.41 g/molFmoc-rink amide resin
CAS:<p>Fmoc-rink amide resin is a synthetic, radionuclide, and constant polymer. It is used in chemical ligation to produce peptides from amines and growth factors. Fmoc-rink amide resin also has antimicrobial properties due to its ability to inhibit the growth of bacteria and fungi by binding to their cell membranes. This polymer can be conjugated with growth factor or antimicrobial peptides for use as a therapeutic agent or used in the production of antibodies against a particular protein. Fmoc-rink amide resin has been shown to increase epidermal growth factor (EGF) uptake into cells by targeting EGF receptors on the cell surface.</p>Purity:Min. 95%H-Val-Ala-pNA acetate salt
CAS:<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/mol1-O-Octadecyl-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-Octadecyl-2-O-acetyl-sn-glycero-3-phosphocholine (OGPC) is a phospholipid that has been shown to be an effective drug in the treatment of chronic arthritis. It is a potent antagonist of the inflammatory response, and has been shown to inhibit the production of inflammatory cytokines such as tumour necrosis factor alpha (TNFα). OGPC has been used in cell culture studies, which have shown that it inhibits IL2 receptor binding and TNFα release by human monocytes. Clinical studies have also shown that OGPC can be used to treat arthritis.</p>Formula:C28H58NO7PPurity:Min. 95%Molecular weight:551.74 g/molFmoc-N-methyl-L-valine
CAS:<p>Fmoc-N-methyl-L-valine is a synthetic immunosuppressant that acts by inhibiting the production of cytokines and other inflammatory mediators. It binds to the enzyme cyclooxygenase, which is involved in the synthesis of prostaglandins and thromboxanes. Fmoc-N-methyl-L-valine has been shown to be effective against gram-positive bacteria. This compound also inhibits xanthine oxidase and may act as an analog for azathioprine, which is used in the treatment of autoimmune diseases such as rheumatoid arthritis. The reaction mechanism for this compound is not well understood but appears to involve a nucleophilic attack on a benzoquinoneiminium cation formed from the attack on an electron deficient benzene ring with a triphosgene electrophile.</p>Formula:C21H23NO4Purity:Min. 95%Molecular weight:353.41 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molAngiotensin I/II (1-6)
CAS:<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>Formula:C36H55N11O10Purity:Min. 95%Molecular weight:801.89 g/molBoc-D-Phe-Pro-Arg-OH
CAS:<p>Boc-D-Phe-Pro-Arg-OH is a receptor binding molecule that belongs to the family of serine proteases. It has been shown to be reactive with multi-walled carbon nanotubes and fatty acids, making it useful for analytical chemistry, processing and amplification. The Boc-D-Phe-Pro-Arg-OH molecule binds to carbohydrate molecules in a way that mimics the action of an enzyme. This binding activates markers and triggers a reaction that produces hydrogen bonds between the target and the substrate. Boc-D-Phe-Pro-Arg-OH has been shown to have high affinity for serine protease receptors.</p>Formula:C25H38N6O6Purity:Min. 95%Molecular weight:518.61 g/molN-Boc-D-b-homoproline
CAS:<p>Please enquire for more information about N-Boc-D-b-homoproline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/mol1-O-Hexadecyl-sn-glycerol
CAS:<p>1-O-Hexadecyl-sn-glycerol is a glycol ether that is used as a surfactant and emulsifier in cosmetic products. It has been shown to have minimal toxicity, and to not be carcinogenic or teratogenic. 1-O-Hexadecyl-sn-glycerol has been shown to increase the stability of proteins in rat liver microsomes, and it also prevents the hydrolysis of carbohydrates. The surface glycoprotein adsorbed by 1-O-Hexadecyl-sn-glycerol may play an important role in the binding of monoclonal antibodies. This compound affects cellular calcium levels, with high concentrations resulting in increased cytosolic calcium concentrations. Zirconium oxide can replace calcium ions in 1-O-Hexadecyl-sn-glycerol for this purpose, although this substitution reduces enzyme activity.</p>Formula:C19H40O3Purity:Min. 95%Molecular weight:316.52 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu-OH
CAS:<p>H-Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu-OH is a peptide that is an activator of casein kinase II. Casein kinase II is a serine/threonine protein kinase that plays an important role in the regulation of cell proliferation and differentiation, apoptosis, and immune response. It has been shown to be involved in restenosis after angioplasty, as well as in tumorigenesis and radiation therapy. H-Arg-Arg-Glu-Glu-Glu-Thr-Glu - Glu - Glu - OH has also been shown to inhibit the replication of influenza virus by interfering with viral transcription and viral maturation. This peptide has been used for the treatment of alopecia, which may be due to its ability to inhibit hair follicle growth.</p>Formula:C46H75N15O23Purity:Min. 95%Molecular weight:1,206.18 g/molOxyntomodulin (bovine, dog, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C192H295N59O60SPurity:Min. 95%Molecular weight:4,421.82 g/molH-Lys-Gly-Lys-OH acetate salt
CAS:<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>Formula:C14H29N5O4Purity:Min. 95%Molecular weight:331.41 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/mol(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H303N59O53Purity:Min. 95%Molecular weight:4,309.85 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/molFmoc-His(1-Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-His(1-Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Gly-His-Ala-OH
CAS:<p>H-Gly-Gly-His-Ala-OH is a peptide of four amino acids. It has been shown experimentally that the side chain of His is always oriented in the same direction, regardless of the conformation. The proton shift constants and vicinal coupling constants for Gly, Gly and Ala are constant, while His has a variable proton shift constant. The experimental parameters for the molecule have been rationalized by using conformational shifts to explain their variability. For example, the proton shift constants have been found to be dependent on the rotation about an axis perpendicular to the peptide backbone. H-Ala-Gly-Gly-His-OH is a pentapeptide with five amino acids that differs from HGGHAOH by having Ala instead of His at position 1. The vicinal coupling constants are different and so are other experimental parameters.</p>Formula:C13H20N6O5Purity:Min. 95%Molecular weight:340.34 g/molAc-Asp(Glu-OH)-OH
CAS:<p>Ac-Asp(Glu-OH)-OH is a low potency, but potentiating compound that binds to the cell cytoplasm. It inhibits the uptake of glutamate into the synaptic cleft by binding to acidic granules. This compound may be neuroprotective and inhibit prostate carcinoma growth. Ac-Asp(Glu-OH)-OH has also been shown to inhibit postsynaptic potentials and decrease glutamate release in cerebellar granule cells.</p>Formula:C11H16N2O8Purity:Min. 95%Molecular weight:304.25 g/molH-Gly-Gly-Glu-Ala-OH
CAS:<p>H-Gly-Gly-Glu-Ala-OH is a carboxylate. It has been shown to be an ionizable molecule with a proton that can exist in either the hydrated or dehydrated form. The proton of the carboxylate group can move between the two forms and the ionization state depends on pH and temperature. H-Gly-Gly-Glu-Ala-OH is a linear peptide, which means it has an amide group and a residue at each end of the chain. Each of these residues has specific conformations, which are impacted by intramolecular hydrogen bonds. These conformations play a role in determining its pharmacological properties, as well as its function in structural biology and magnetic resonance techniques. H-Gly-Gly-Glu-Ala-OH also has population distribution studies that have been used for diffraction analyses, as well as for titration experiments.</p>Formula:C12H20N4O7Purity:Min. 95%Molecular weight:332.31 g/molO-Hippuryl-DL-b-phenyllactic acid sodium salt
CAS:<p>Please enquire for more information about O-Hippuryl-DL-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/mol(Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla)
CAS:<p>Please enquire for more information about (Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H63N11O16SPurity:Min. 95%Molecular weight:986.06 g/molNeuromedin B trifluoroacetate salt
CAS:<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/molH-Glu-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/molFmoc-D-Lys(Trt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Lys(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H38N2O4Purity:Min. 95%Molecular weight:610.74 g/molH-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid
CAS:<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>Formula:C13H18N2O2Purity:Min. 95%Molecular weight:234.29 g/molFmoc-[D4]Ala-OH
CAS:Controlled Product<p>Please enquire for more information about Fmoc-[D4]Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H13D4NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:315.35 g/molHymenistatin I Cyclo(-Pro-Pro-Tyr-Val-Pro-Leu-Ile-Ile)
CAS:<p>Hymenistatin I is a cyclic peptide that is synthesized from the natural amino acid L-proline. It has been shown to inhibit tumor growth and is used in the treatment of bladder cancer. The synthesis of Hymenistatin I begins with the protection of proline as an N-tert-butyloxycarbonyl derivative, followed by a sequence of coupling reactions. This synthetic process involves the use of a linker, such as tetrazole or succinimidyl ester, for example. The final product can then be purified by HPLC analysis. Hymenistatin I inhibits calcineurin inhibitor, which are immunosuppressive agents that are used to treat lymphocytic leukemia and other autoimmune diseases.</p>Formula:C47H72N8O9Purity:Min. 95%Molecular weight:893.12 g/molAQEE-30 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H245N47O56Purity:Min. 95%Molecular weight:3,674.9 g/molNeuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H288N56O57Purity:Min. 95%Molecular weight:4,064.48 g/molEpinecidin-1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C114H176N30O21SPurity:Min. 95%Molecular weight:2,334.87 g/mol2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide
CAS:<p>2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide is a signal molecule that has antimicrobial activity. It inhibits the proliferation of cells and is used as an antifungal agent. 2,5,6-Trimethyloxathiinium ion has been shown to induce apoptosis in human leukemia cells and inhibit the growth of erythrocytes infected with Plasmodium falciparum. This compound also inhibits wild type strains of bacteria and fungi and can be used as a natural fungicide. 2,5,6-Trimethyloxathiinium ion has been found to be effective in treating autoimmune diseases such as diabetes mellitus type II, which may be due to its ability to regulate glucose metabolism and suppress inflammatory responses.</p>Formula:C12H13NO2SPurity:Min. 95%Molecular weight:235.3 g/molFMOC-D-CYS(TRT)-WANG RESIN - 200-400 mesh
<p>Please enquire for more information about FMOC-D-CYS(TRT)-WANG RESIN - 200-400 mesh including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Substance P (4-11)
CAS:<p>Substance P (4-11) H-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a fluorescent peptide that binds to calcium and chloride ions. It has been shown to have an affinity for both peptide and calmodulin binding. This peptide has also been shown to be highly heat stable and can be used in a wide range of temperatures. The substance P (4-11) sequence is found in porcine, rat, bovine, and human proteins. The amino acid sequence is composed of 4 amino acids: proline, glutamine, phenylalanine, and leucine. This peptide's optimum pH is 7.5 with a temperature range of 35°C to 45°C. It has been shown that the activity of this peptide decreases as the concentration increases. It has also been shown to be susceptible to aminopeptidases at high concentrations or when</p>Formula:C46H67N11O10SPurity:Min. 95%Molecular weight:966.16 g/molFmoc-Pro-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pro-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%LHRH hydrochloride salt
CAS:<p>LHRH is a hormone that has been used to treat endometriosis, prostate cancer, and ovarian cysts. It is an agonist of the gonadotropin-releasing hormone receptor (GnRH receptor). LHRH binds to the GnRH receptor in the pituitary gland and stimulates the release of follicle-stimulating hormone and luteinizing hormone. This leads to increased production of estrogen and testosterone. LHRH has been shown to be effective in treating infectious diseases such as tuberculosis and HIV/AIDS. LHRH can also be used as a diagnostic aid for determining whether or not a tumor is cancerous by measuring its protein content.</p>Formula:C55H75N17O13·xHClPurity:Min. 95%Molecular weight:1,182.29 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molAnthranilyl-HIV Protease Substrate V trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H76N14O13Purity:Min. 95%Molecular weight:1,081.23 g/molZ-Tyr-Lys-Arg-pNA·2 TFA
CAS:<p>Z-Tyr-Lys-Arg-pNA·2 TFA is a potent inhibitor of proteases. It has been shown to be an efficient inhibitor of the major yeast protease, proteinase A, and other enzymes that are used for the industrial production of peptides. Z-Tyr-Lys-Arg-pNA·2 TFA is a synthetic peptide with a molecular mass of 5,836 Da and an optimum pH of 7.5. This peptide is synthesized by the chemical reaction between butoxycarbonyl (Boc) Lys(Z)-Tyr(N)-Arg(R)-pNA and 2 equivalents of trifluoroacetic acid (TFA). The synthesis takes place in a homogenous solution in dichloromethane at room temperature in the presence of triethylamine as base. Filtration through a 0.22 μm filter removes any insoluble impurities from the solution.</p>Formula:C35H45N9O8·2C2HF3O2Purity:Min. 95%Molecular weight:947.83 g/molFmoc-Leu-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Leu-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-L-glutamic acid γ-methyl ester
CAS:<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>Formula:C11H19NO6Purity:Min. 95%Molecular weight:261.27 g/molH-Arg-Trp-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O2·2HClPurity:Min. 95%Molecular weight:432.35 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molExtracellular Death Factor trifluoroacetate salt
CAS:<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>Formula:C27H36N10O10Purity:Min. 95%Molecular weight:660.64 g/molH-Ser-Gln-Asn-Tyr-Pro-Ile-Val-OH
CAS:<p>Please enquire for more information about H-Ser-Gln-Asn-Tyr-Pro-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H57N9O12Purity:Min. 95%Molecular weight:819.9 g/mol(Deamino-Cys1,b-(3-pyridyl)-D-Ala2,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>DDAVP is an analogue of vasopressin, which belongs to the class of inositol phosphates. It is a potent agonist for the V1 receptor and has a higher affinity for this receptor than vasopressin. DDAVP also has antagonist properties at the V2 receptor. The biological activity of DDAVP is mediated by its ability to increase phospholipase A2 activity and cause the release of arachidonic acid from membrane phospholipids. This activation causes an increase in prostaglandin synthesis, leading to increased vascular permeability and hypotension. DDAVP may also have antidiuretic effects due to its antagonism of oxytocin receptors.</p>Formula:C45H63N15O11S2Purity:Min. 95%Molecular weight:1,054.21 g/molAc-Pen-Arg-Gly-Asp-Cys-OH (Disulfide bond)
CAS:<p>Disulfide bond is an analytical method for the determination of the concentration-time curve. It is a cyclic peptide that competes with fibrinogen for binding to platelets. Disulfide bond has been shown to be an antagonist of receptor antagonist, and has potential applications in the treatment of autoimmune diseases. Disulfide bond can also be used as a model system for toxicological studies and experimental models in humans.</p>Formula:C22H36N8O9S2Purity:Min. 95%Molecular weight:620.7 g/molZ-D-Arg(Z)2-OH
CAS:<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H32N4O8Purity:Min. 95%Molecular weight:576.6 g/mol
