
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,464 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38247 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Gly-Gly-Pro-OH
CAS:<p>H-Gly-Gly-Pro-OH is a recombinant polypeptide with affinity for amino acids. It is a positionally defined sequence of amino acids that has been shown to bind to Alzheimer's disease (AD) amyloid peptides and inhibit the formation of beta amyloid fibrils. The N-terminal sequence of this polypeptide is immunogenic, which may be useful for generating antibodies against AD.</p>Formula:C9H15N3O4Purity:Min. 95%Molecular weight:229.23 g/molDiazepam Binding Inhibitor (DBI) Fragment (human)
CAS:<p>Please enquire for more information about Diazepam Binding Inhibitor (DBI) Fragment (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H148N26O32SPurity:Min. 95%Color and Shape:SolidMolecular weight:2,150.37 g/mol(Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken)
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H72N16O12Purity:Min. 95%Molecular weight:1,221.33 g/molSuc-Phe-Gly-Leu-betaNA
CAS:<p>Suc-Phe-Gly-Leu-betaNA is a synthetic peptide that has been shown to bind to glutathione, an antioxidant. It is used in a method for determining the concentration of antioxidants in a sample by injection into the gas phase. The chemical ionisation (CI) and electrospray ionisation (ESI) are used to produce ions from the peptide. The compounds are then separated using chromatography before being quantified by measuring their mass using a mass spectrometer. This process is repeated until all of the antioxidant has been eluted from the column.</p>Formula:C31H36N4O6Purity:Min. 95%Molecular weight:560.64 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H93N15O14S2Purity:Min. 95%Molecular weight:1,204.51 g/molpTH (13-34) (human)
CAS:<p>Please enquire for more information about pTH (13-34) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C125H199N39O33SPurity:Min. 95%Molecular weight:2,808.23 g/molH-Leu-Trp-Met-Arg-Phe-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-OH acetate salt is a molecule that transports amino acids across the cell membrane of bacteria, preventing bacterial growth. It is produced by proctolin and functional groups in dental plaque. This compound has been shown to inhibit the growth of bacteria in vitro by binding to hypochlorous acid, which is part of the antimicrobial activity of human neutrophils. H-Leu-Trp-Met-Arg-Phe-OH acetate salt has been used as a tracer for studying amino acid transport in E. coli cells and its uptake into extracellular vesicles. The product can also be used as an antiplaque agent due to its ability to inhibit the acid transport system and uptake of amino acids from the environment.</p>Formula:C37H53N9O6SPurity:Min. 95%Molecular weight:751.94 g/molFmoc-Lys(Nde)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H29N3O8Purity:Min. 95%Molecular weight:583.59 g/molAc-D-Lys-OH
CAS:<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>Formula:C8H16N2O3Purity:Min. 95%Molecular weight:188.22 g/molBradykinin (1-5) trifluoroacetate salt
CAS:<p>Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH is a peptide that has been shown to have anti-cancer properties. The effect of Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH on prostate cancer cells was studied in vitro by measuring the extent of cell growth. The results showed a dose dependent decrease in tumor growth rate, suggesting that this peptide may be useful as an adjuvant therapy for prostate cancer. Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe has also been shown to inhibit diabetic nephropathy and reduce proteinuria in diabetic patients. This peptide may also be used to diagnose prostate cancer because it binds to the thrombin receptor, which is present on cancer cells but not</p>Formula:C27H40N8O6Purity:Min. 95%Molecular weight:572.66 g/molL-Alanine methyl ester HCl
CAS:<p>L-Alanine methyl ester HCl is a compound that is used in wastewater treatment. It has been shown to inhibit the enzyme DPP-IV, which is associated with metabolic disorders. L-Alanine methyl ester HCl also has been shown to have antimicrobial activity against a number of bacteria, including methicillin resistant Staphylococcus aureus (MRSA). L-Alanine methyl ester HCl has been shown to have anti-inflammatory properties and can be used for the treatment of autoimmune diseases. This compound also has a significant effect on biological properties such as phase transition temperature and thermal expansion.</p>Formula:C4H10NO2ClPurity:Min. 95%Color and Shape:White PowderMolecular weight:139.58 g/mol(Ser4,Ile8)-Oxytocin
CAS:<p>Oxytocin is a neuropeptide hormone that regulates social behavior and the body's response to stress. It is produced by the hypothalamus, stored in the posterior pituitary gland, and released into the bloodstream. Oxytocin has been shown to regulate the release of prolactin from the anterior pituitary gland, as well as stimulate uterine contractions during labor. Oxytocin also plays a role in regulating blood pressure and vasopressin secretion. The activity of oxytocin is regulated by a number of factors including detection sensitivity, polyclonal antibodies, monoclonal antibodies, polymerase chain reaction (PCR), effective dose, salinity, neurosecretory sequences, and regulatory sequences such as linear regression analysis. Oxytocin has also been shown to have physiological activities including regulation of water balance through antidiuretic effects and modulation of appetite through action on receptors for ghrelin. Oxytocin is an endogenous molecule with a molecular weight of 3</p>Formula:C41H63N11O12S2Purity:Min. 95%Molecular weight:966.14 g/molH-Arg-Phe-OH acetate salt
CAS:<p>H-Arg-Phe-OH Acetate Salt is a peptide that has the amino acids H, Arg, Phe and OH. It is a stable complex with amines and is effective in reducing blood pressure. The binding constants are high, which means that it can be used as an antihypertensive agent. A study on the haemodynamic effects of H-Arg-Phe-OH Acetate Salt showed that it could inhibit the release of noradrenaline levels in the body. The reaction mechanism for H-Arg-Phe-OH Acetate Salt is functional groups plus fatty acids; kidney bean is one of its sources.</p>Formula:C15H23N5O3Purity:Min. 95%Molecular weight:321.38 g/molBoc-D-Asp-OFm
CAS:<p>Please enquire for more information about Boc-D-Asp-OFm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H25NO6Purity:Min. 95%Molecular weight:411.45 g/molH-Gly-Phe-Ser-OH
CAS:<p>H-Gly-Phe-Ser-OH is a substrate for thermolysin, an enzyme that catalyzes the hydrolysis of peptides to amino acids. It is modified by glycerol, which influences its affinity and nature. The residue can be either modified or unmodified with a specific chain length. The modifications of the residue are important in determining the specificity of the enzyme. H-Gly-Phe-Ser-OH has a high degree of hydrophobicity, which influences the catalytic reaction. This substrate can be used to determine enzyme specificity because it is not cleaved by enzymes such as trypsin and chymotrypsin.</p>Formula:C14H19N3O5Purity:Min. 95%Molecular weight:309.32 g/molAngiogenin (108-123)
CAS:<p>Please enquire for more information about Angiogenin (108-123) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H132N26O24Purity:Min. 95%Molecular weight:1,878.1 g/molLHRH (1-2) (free acid) acetate salt
CAS:<p>LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is an analog of the natural hormone LHRH. It is a member of the amide category and has been shown to have a constant level in human serum. LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is resistant to renal proximal tubule uptake and has an acidic pH optimum, which inhibits its uptake into cells. This drug also has an inhibitory effect on the reaction products of hydrogen chloride and proximal tubules.</p>Formula:C11H14N4O4Purity:Min. 95%Molecular weight:266.25 g/molFA-Phe-Val-NH2
CAS:<p>Please enquire for more information about FA-Phe-Val-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H25N3O4Purity:Min. 95%Molecular weight:383.44 g/molBicine
CAS:<p>Bicine, also known as N,N-Bis(2-hydroxyethyl)glycine, is a Bis(2-hydroxyethyl) amine buffer with an optimal pH range of 7.6-9.0 and a pKa of 8.26. This buffering agent forms metal complexes and is used in crystallization and enzymatic studies.</p>Formula:C6H13NO4Purity:Min. 95%Color and Shape:White SolidMolecular weight:163.17 g/molBoc-Ala-Ala-Asp-pNA
CAS:<p>Boc-Ala-Ala-Asp-pNA is a peptide that has been shown to have cytotoxic activity against the leukemia cell line, basophilic leukemia (BL). It also inhibits hemolytic activity and cytolysin production by staphylococcus. This peptide is expressed in the sequence of Boc-Ala-Ala-Asp and is composed of 20 amino acids. The Boc-Ala sequence has been shown to be involved in apoptosis, while Asp and pNA are responsible for inhibiting hemolytic activity. Functional assays have demonstrated that this peptide has a strong inhibitory effect on the growth of bacteria, including strains of subtilis and hybridization.</p>Formula:C21H29N5O9Purity:Min. 95%Molecular weight:495.48 g/molAcetyl-Amylin (8-37) (mouse, rat)
CAS:<p>Please enquire for more information about Acetyl-Amylin (8-37) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O44Purity:Min. 95%Molecular weight:3,242.6 g/molAc-Trp-Glu-His-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Trp-Glu-His-Asp-aldehyde is a tetrapeptide that has been shown to inhibit the activity of caspases. Caspases are proteases that play an important role in cell death by inducing apoptosis and necrosis. The structure of the Ac-Trp-Glu-His-Asp-aldehyde was determined by X-ray crystallography, revealing a hydrophobic molecule with a pseudo acid residue. This compound binds to peptides and blocks the binding site for caspase substrates, which prevents their activation. Acetylation of this compound also increases its hydrophobicity, making it more likely to bind to other molecules such as proteins or lipids.</p>Formula:C28H33N7O9Purity:Min. 95%Molecular weight:611.6 g/molFmoc-Sar-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Sar-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-L-α-aminobutyric acid
CAS:<p>Fmoc-L-alpha-aminobutyric acid is a synthetic amino acid that is used as a linker in solid-phase peptide synthesis. It is also used to synthesize analogs of the serine protease NS3, which are postulated to inhibit hepatitis C virus replication by preventing the release of viral RNA from infected cells. Fmoc-L-alpha-aminobutyric acid has been shown to have anti-viral activity against the influenza virus and HIV.</p>Formula:C19H19NO4Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:325.36 g/molFor-DL-Met-OH
CAS:<p>For-DL-Met-OH is a colony-stimulating factor that belongs to the group of pharmacokinetic properties. It has been shown to have an effect on white blood cell production in patients with radiation therapy, and is also effective against Pseudomonas aeruginosa, which is an important pathogen in chronic lung disease. For-DL-Met-OH has been found to be effective when administered intravenously and orally in this indication. The compound acts by binding to the target tissue cyclic peptide receptor and acylation reaction with the antibiotic. It has been found that For-DL-Met-OH can be synthesized using a neutral pH process and polypeptide synthesis.</p>Formula:C6H11NO3SPurity:Min. 95%Molecular weight:177.22 g/molFmoc-α-amino-D-Gly(Boc)-OH
CAS:<p>Please enquire for more information about Fmoc-α-amino-D-Gly(Boc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H24N2O6Purity:Min. 95%Molecular weight:412.44 g/molFmoc-Lys(Boc)-Pro-OH
CAS:<p>Fmoc-Lys(Boc)-Pro-OH is a residue that is used in the optimization of peptide synthesis. It is an acid labile protecting group that can be removed by treatment with trichloroacetic acid or hydrogen fluoride. Fmoc-Lys(Boc)-Pro-OH can be used for chemical ligation to other protected amino acids, such as Boc-Lys(Bzl)-OH, to form peptides. The residue has been shown to be useful in systematic optimization of peptide pairings and in the stepwise synthesis of peptides. The residue has also been shown to have a high yield and purity when synthesized by x-ray crystallography.<br>Fmoc-Lys(Boc)-Pro-OH is an amino acid with a molecular weight of 120 Da and consists of two alpha amino acids, L -lysine and L -proline, joined by a peptide bond.</p>Formula:C31H39N3O7Purity:Min. 95%Molecular weight:565.66 g/mol(Thr6)-Bradykinin
CAS:<p>Bradykinin is a peptide hormone that functions as a neurotransmitter, neuromodulator, and vasodilator. Bradykinin is released from the cell in response to tissue injury or inflammation. Bradykinin binds to the bradykinin receptors B2 and B1 on the surface of cells and stimulates them, which causes pain relief and vasodilation. Bradykinin is synthesized as an inactive pro-peptide (Tyr6) that undergoes proteolytic cleavage by proteases such as thrombin, trypsin, chymotrypsin, and elastase. The amino acid sequence of the active form of bradykinin is Thr6-Bradykinin H-Arg-Pro-Pro-Gly-Phe-Thr-Pro-Phe-Arg-OH.</p>Formula:C51H75N15O11Purity:Min. 95%Molecular weight:1,074.24 g/molGlutaryl-Phe-pNA
CAS:<p>Glutaryl-Phe-pNA is commonly used as a substrate to measure the activity of proteases, which are enzymes that cleave peptide bonds. The cleavage of the Glutaryl-Phe-pNA substrate by proteases releases a colored 4-nitroaniline product, which can be detected and quantified spectrophotometrically to measure protease activity.</p>Formula:C20H21N3O6Purity:Min. 95%Molecular weight:399.4 g/mol(D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H36N8O5Purity:Min. 95%Molecular weight:540.61 g/molH-Glu(D-Glu-OH)-OH
CAS:<p>Please enquire for more information about H-Glu(D-Glu-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H16N2O7Purity:Min. 95%Molecular weight:276.24 g/molGastrin I (rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C94H128N22O31S2Purity:Min. 95%Molecular weight:2,126.28 g/molBiotinyl-Obestatin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H190N34O35SPurity:Min. 95%Molecular weight:2,773.13 g/mol(H-Cys-Phe-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-Phe-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30N4O6S2Purity:Min. 95%Molecular weight:534.65 g/molNeuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>Formula:C190H287N55O57Purity:Min. 95%Molecular weight:4,253.65 g/molAc-Tyr-Phe-OMe
CAS:<p>Please enquire for more information about Ac-Tyr-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molBig Endothelin-3 (22-41) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Big Endothelin-3 (22-41) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H156N30O31Purity:Min. 95%Molecular weight:2,298.51 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H293N53O48S2Purity:Min. 95%Molecular weight:4,007.69 g/molH-Glu-Gly-Phe-OH
CAS:<p>H-Glu-Gly-Phe-OH is a labile tripeptide molecule that has been synthesized. The tripeptide is synthesized by coupling the amino acid H-Glu to Gly-Phe and then adding an amide bond to form the peptide. This study of the structure of H-Glu-Gly-Phe-OH was done using techniques such as electrospray ionization, chromatographic methods, and proton nuclear magnetic resonance spectroscopy. The compound was found to be neutral in charge and stable at room temperature, but unstable under acidic conditions. It is also soluble in any buffer with a pH range from 2.0 to 12.0 and can be purified by column chromatography or preparative HPLC.</p>Formula:C16H21N3O6Purity:Min. 95%Molecular weight:351.35 g/molH-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23IN4O4Purity:Min. 95%Molecular weight:534.35 g/molBiotinyl-ε-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone
CAS:<p>Please enquire for more information about Biotinyl-epsilon-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56ClN9O6SPurity:Min. 95%Molecular weight:790.42 g/molHippuryl-Phe-Arg-OH
CAS:<p>Hippuryl-Phe-Arg-OH is a potent and selective inhibitor of angiotensin-converting enzyme (ACE) with a long duration of action. It has been shown to be a potentiator of captopril and enalaprilat in the biochemical validation for ACE inhibition. Hippuryl-Phe-Arg-OH has significant inhibitory activity against phosphatases such as carboxypeptidase A, phospholipase A2, and aminopeptidase N.</p>Formula:C24H30N6O5Purity:Min. 95%Molecular weight:482.53 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O7SPurity:Min. 95%Molecular weight:592.67 g/molH-Lys-Pro-OH hydrochloride salt
CAS:<p>H-Lys-Pro-OH hydrochloride salt is a monoclonal antibody that is used to treat psychotic disorders. It blocks the binding of gamma-aminobutyric acid (GABA) to its receptor, which reduces neuronal activity and has a calming effect on the central nervous system. H-Lys-Pro-OH hydrochloride salt also inhibits the phosphatase enzyme and prevents it from breaking down phosphotungstic acid, which is used in this process. The antibody also binds to the analog of gamma aminobutyric acid, preventing it from binding with its receptor. H-Lys-Pro-OH hydrochloride salt may be advantageous in treating kidney fibrosis because it prevents cell proliferation and growth in tissue cultures by inhibiting enzymes involved in collagen synthesis. H-Lys-Pro-OH hydrochloride salt may also be useful as an antitumor agent because it inhibits tumor growth by blocking uptake and replication of DNA.</p>Formula:C11H21N3O3Purity:Min. 95%Molecular weight:243.3 g/molZ-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H43FN4O11Purity:Min. 95%Molecular weight:654.68 g/molACTH (18-39) (human)
CAS:<p>ACTH is a polypeptide hormone that regulates the release of cortisol from the adrenal cortex. ACTH (18-39) is a fragment of ACTH which binds to the glucocorticoid receptor with high affinity. The carboxy terminal sequence of ACTH (18-39) is identical to that of human ACTH and can be used as an immunogen to produce monoclonal antibodies against ACTH. The monoclonal antibodies can then be used in prognostic studies for patients with congestive heart failure, diabetic neuropathy, or k562 cells. ACTH (18-39) has an optimum pH level of 7.0 and can bind to cellular receptors at physiological concentrations. It also has a molecular weight of 4,000 Daltons and is soluble in trifluoroacetic acid and hydrogen fluoride, but not in water or methanol.</p>Formula:C112H165N27O36Purity:Min. 95%Molecular weight:2,465.67 g/molH-Gly-Lys-His-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Lys-His-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H24N6O4Purity:Min. 95%Molecular weight:340.38 g/molZ-His-Phe-Phe-OEt
CAS:<p>Z-His-Phe-Phe-OEt is a synthetic, polyacrylamide gel-based experiment that determines the amino acid composition of imidazolium zymogens. This experiment utilizes an ion-exchange chromatography technique to separate and identify peptides. The solvents used in this experiment are acetone and ion-exchange chromatography. In order to carry out this experiment, one must first dissolve the polyacrylamide gel in a system of solvents with a pH of 7.5 or lower in order to create an electrofocusing environment. This solution is then applied to the polyacrylamide gel, which will form a solid film when dried. The imidazolium zymogen can then be cleaved by pepsin, yielding peptides that can be analysed using mass spectrometry.</p>Formula:C34H37N5O6Purity:Min. 95%Molecular weight:611.69 g/molHuman CMV pp65 (495-503) trifluoroacetate salt
CAS:<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H74N10O12SPurity:Min. 95%Molecular weight:943.16 g/molBoc-Ala-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%ACTH (1-39) (mouse, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C210H315N57O57SPurity:Min. 95%Molecular weight:4,582.16 g/molSauvagine trifluoroacetate salt
CAS:<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>Formula:C202H346N56O63SPurity:Min. 95%Molecular weight:4,599.31 g/molH-His-Phe-bNA·2 HCl
CAS:<p>Please enquire for more information about H-His-Phe-bNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H25N5O2·2HClPurity:Min. 95%Molecular weight:500.42 g/molCyclo(-D-Glu-Ala-D-allo-Ile-Leu-D-Trp)
CAS:<p>Please enquire for more information about Cyclo(-D-Glu-Ala-D-allo-Ile-Leu-D-Trp) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H44N6O7Purity:Min. 95%Molecular weight:612.72 g/mol(Phe2, Nle 4)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe2, Nle 4)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C137H212N40O30Purity:Min. 95%Molecular weight:2,899.4 g/molH-Arg-Met-OH acetate salt
CAS:<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/mol4-Bromo-6-methyl-2-pyridinamine
CAS:<p>4-Bromo-6-methyl-2-pyridinamine is a small molecule that binds to the bromodomain of the human protein BRD4. This binding inhibits the interaction between BRD4 and acetylated lysine residues on histones, thereby inhibiting transcriptional activation. 4-Bromo-6-methyl-2-pyridinamine has been shown to be a potent inhibitor of the activity of BRD4, which may be due to its chemical stability and ability to inhibit protein synthesis. The compound's potency in inhibition assays and its lack of biochemical toxicity make it an attractive lead compound for further study.</p>Formula:C6H7BrN2Purity:Min. 95%Molecular weight:187.04 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H270N48O51S2Purity:Min. 95%Molecular weight:4,046.55 g/molFmoc-D-Trp(Boc)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Trp(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-N-methyl-L-leucine
CAS:<p>Please enquire for more information about Fmoc-N-methyl-L-leucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H25NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:367.44 g/mol(4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid
CAS:<p>Please enquire for more information about (4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H11BO4Purity:Min. 95%Molecular weight:193.99 g/molH-Phe-Pro-Arg-OH
CAS:<p>H-Phe-Pro-Arg-OH is an active analogue of the natural amino acid, lysine. It has been shown to inhibit protein synthesis by binding to the lysine residues in proteins. This inhibition blocks the hydrophobic effect that is necessary for proper folding of newly synthesized proteins. Lysine's role in protein synthesis also extends to spermatozoa and blood clotting, which are inhibited by H-Phe-Pro-Arg-OH. The inhibition of lysine residues in human serum fibrinogen and thrombin may lead to a reduction in their ability to form clots. H-Phe-Pro-Arg-OH has also been shown to be an anticoagulant and thermodynamic data supports this conclusion. X ray crystal structures and titration calorimetry have confirmed that this compound binds to lysine residues with high affinity and specificity.</p>Formula:C20H30N6O4Purity:Min. 95%Molecular weight:418.49 g/mol(Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molFmoc-Dap(Adpoc)-OH
CAS:<p>Please enquire for more information about Fmoc-Dap(Adpoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H38N2O6Purity:Min. 95%Molecular weight:546.65 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H179N35O28SPurity:Min. 95%Molecular weight:2,591.99 g/mol(Fmoc-Glu70,Ala71·72,Lys74)-C3a (70-77)
CAS:<p>Please enquire for more information about (Fmoc-Glu70,Ala71·72,Lys74)-C3a (70-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H80N12O13Purity:Min. 95%Molecular weight:1,093.28 g/molCholecystokinin Octapeptide (1-3) (desulfated)
CAS:<p>Cholecystokinin Octapeptide (1-3) (desulfated) is a research chemical that has various applications in the field of chemistry and biology. This compound contains a hydrogen atom that plays a crucial role in solvation processes. It can be used in supercritical reactions due to its ability to interact with hydroxyl groups on metallic surfaces like silicon substrates. Additionally, Cholecystokinin Octapeptide (1-3) (desulfated) is utilized in thiol-ene reactions and chromatographic separations.</p>Formula:C18H25N3O7SPurity:Min. 95%Molecular weight:427.47 g/molH-Pro-Tyr-NH2·HCl
CAS:<p>Noopept is a peptide-like nootropic drug that belongs to the group of analogs of proline. It has been shown to have neuroprotective and cognitive enhancing effects in animal studies, as well as an antipsychotic effect. Noopept is a competitive antagonist of the glutamate receptor, and also has affinity for dopamine and serotonin receptors. Noopept is taken orally and penetrates into the brain quickly, where it interacts with different types of neurotransmitter systems. It also shows translational activity in vitro (in cell culture) and in vivo (in animals). This substance can be detected in human blood plasma following oral administration.</p>Formula:C14H19N3O3·HClPurity:Min. 95%Molecular weight:313.78 g/molBoc-L-valine
CAS:<p>Boc-L-Valine is a model system for the synthesis of peptides. This compound is synthesized in a liquid phase and then purified by column chromatography. It has an antimicrobial activity against Gram-positive bacteria such as Staphylococcus aureus and Escherichia coli, but not against Gram-negative bacteria such as Proteus vulgaris or Pseudomonas aeruginosa. Boc-L-Valine is also used to study the binding of inhibitors and ferrocenes.</p>Formula:C10H19NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:217.3 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS:<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Formula:C12H19NO5Purity:Min. 95%Molecular weight:257.28 g/molGly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C146H234N46O52Purity:Min. 95%Molecular weight:3,465.7 g/mol2-Chloromethyl-4-(3-methoxypropoxy)-3-methylpyridine hydrochloride
CAS:<p>Please enquire for more information about 2-Chloromethyl-4-(3-methoxypropoxy)-3-methylpyridine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H17Cl2NO2Purity:Min. 95%Molecular weight:266.16 g/molAc-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H139N27O29S2Purity:Min. 95%Molecular weight:2,211.44 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N4O5Purity:Min. 95%Molecular weight:302.33 g/mol(Sar 1,Ile8)-Angiotensin II
CAS:<p>Angiotensin II is a peptide hormone. It is a potent vasoconstrictor that also stimulates the release of aldosterone from the adrenal gland, leading to an increase in blood pressure. Angiotensin II can be produced either by proteolytic cleavage of angiotensinogen (a zymogen) or by post-translational modification of angiotensin I (a decapeptide). Angiotensin II is a potent agonist of the thrombin receptor and binds to one of four subtypes of angiotensin receptors (AT1). The AT1 receptor antagonist is a drug that blocks the biological activity of angiotensin II and has been used clinically for treatment of hypertension.</p>Formula:C46H73N13O10Purity:Min. 95%Molecular weight:968.15 g/molMca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H103N23O24Purity:Min. 95%Molecular weight:1,638.7 g/molBoc-L-tyrosine methyl ester
CAS:<p>Boc-L-tyrosine methyl ester is a synthetic amino acid that can be used in the production of peptides and proteins. It has been shown to have a high uptake and hydroxyl group, which allows for the synthesis of dopamine. The kinetic study of Boc-L-tyrosine methyl ester in agarose gels has shown that it has a high affinity for dopamine. Boc-L-tyrosine methyl ester has also been used as an intermediate for the synthesis of peptides and proteins. It is not active against cancer cells but has been used to induce matrix metalloproteinase (MMP) activity in Mcf-7 cells.</p>Formula:C15H21NO5Purity:Min. 95%Color and Shape:White PowderMolecular weight:295.33 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/molH-Val-Ile-His-Thr-EDANS acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H48N8O8SPurity:Min. 95%Molecular weight:716.85 g/mol3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid
CAS:<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>Formula:C10H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:273.08 g/molFmoc-Thr(PO3H2)-OH
CAS:<p>Please enquire for more information about Fmoc-Thr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H20NO8PPurity:Min. 95%Molecular weight:421.34 g/molH-Ala-Ala-Tyr-OH
CAS:<p>Please enquire for more information about H-Ala-Ala-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N3O5Purity:Min. 95%Molecular weight:323.34 g/molFmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H38N2O7Purity:Min. 95%Color and Shape:White PowderMolecular weight:586.67 g/mol(H-Cys-Tyr-OH)2
CAS:<p>Please enquire for more information about (H-Cys-Tyr-OH)2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30N4O8S2Purity:Min. 95%Color and Shape:PowderMolecular weight:566.65 g/mol(Pro7)-Neurokinin B
CAS:<p>Please enquire for more information about (Pro7)-Neurokinin B including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H77N13O14S2Purity:Min. 95%Molecular weight:1,208.41 g/molZ-β-Ala-Val-OH
CAS:<p>Please enquire for more information about Z-beta-Ala-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molZ-Leu-Arg-4MbNA
CAS:<p>Please enquire for more information about Z-Leu-Arg-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H40N6O5Purity:Min. 95%Molecular weight:576.69 g/molZ-Val-Ala-Asp-AMC
CAS:<p>Z-Val-Ala-Asp-AMC is a photoactive peptide that is activated by light exposure. This drug has cytostatic and cardiotoxic effects, which may be due to its ability to induce autophagy. Z-Val-Ala-Asp-AMC induces cell death in cancer cells through the activation of caspase independent pathways. It also inhibits nitroprusside induced apoptosis in cultured skin cells, suggesting that it may have therapeutic potential for the treatment of cancer.</p>Formula:C30H34N4O9Purity:Min. 95%Molecular weight:594.61 g/molACTH (3-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (3-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H196N38O27SPurity:Min. 95%Molecular weight:2,683.19 g/mol(Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate
CAS:Controlled Product<p>Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt is a long acting analog of LHRH. It is a biocompatible polymeric drug that has been shown to have long term efficacy in treating various autoimmune diseases and infections. The drug's efficacy may be due to its ability to bind to the specific receptors on the surface of cells that are involved in the immune response. DesGly10,D-His(Bzl)6,ProNHEt9)-LHRH acetate salt Pyr His Trp Ser Tyr D His(Bzl)-Leu Arg Pro NHEt acetate salt is an analog of LHRH and has been shown to be effective in treating cancer and allergic symptoms as well.</p>Formula:C66H86N18O12•(C2H4O2)xPurity:Min. 95%Molecular weight:1,323.5 g/mol(Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H76N18O9S2Purity:Min. 95%Molecular weight:1,209.45 g/mol1-Methylethyl N-((S)-(((1R)-2-(6-amino-9H-purin-9-yl)-1-methylethoxy)methyl)phenoxyphosphinoyl)-L-alaninate
CAS:<p>Tenofovir is a nucleoside analog reverse transcriptase inhibitor that binds to the RNA-dependent polymerase. This compound is used in combination with other antiviral agents for the treatment of HIV-1 infection and for prophylaxis against HIV-1 infection. Tenofovir has been shown to be effective against infections caused by strains of HIV-1, such as the drug resistant virus. Tenofovir is absorbed rapidly after oral administration, with a bioavailability of over 80%. The prodrug fumarate is hydrolyzed to tenofovir in vivo and this conversion occurs more efficiently in acidic conditions. Alafenamide, a prodrug of tenofovir, has been approved by the FDA as an alternative to tenofovir disoproxil fumarate (TDF) for the treatment of HIV-1 infection. Alafenamide is an acyclic nucleoside phosphonate that inhibits viral replication by inhibiting reverse</p>Formula:C46H62N12O14P2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,069 g/molH-β-Chloro-Ala-NHOH hydrochloride salt
CAS:<p>Please enquire for more information about H-beta-Chloro-Ala-NHOH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C3H7ClN2O2Purity:Min. 95%Molecular weight:138.55 g/mol3-Methylcyclohex-2-en-1-one
CAS:<p>3-Methylcyclohex-2-en-1-one is a chemical compound that is used in the synthesis of pharmaceuticals, pesticides, and other organic compounds. It has been shown to be effective against Dendroctonus species and other pests. 3-Methylcyclohex-2-en-1-one is synthesized from cyclohexanone by hydrogenation of the double bond at the 3 position. The reaction can be catalyzed by palladium complexes with acid complexing ligands, such as phosphines or amines. The product is then purified by distillation, crystallization, or recrystallization.</p>Formula:C7H10OPurity:Min. 95%Molecular weight:110.15 g/molFmoc-Thr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Lys(Z)-ONp
CAS:<p>Z-Lys(Z)-ONp is an intermediate in the synthesis of lysergic acid diethylamide (LSD). It is a hypotensive agent that has analgesic properties. Z-Lys(Z)-ONp has been patented for use as a hypotensive agent, although it has not yet been approved for this use.</p>Formula:C28H29N3O8Purity:Min. 95%Molecular weight:535.55 g/molBoc-L-methionine - Solid
CAS:<p>Boc-L-methionine is a chemical compound that contains the amino acid methionine. It is used in solid-phase synthesis to produce cyclic peptides and proteins. Boc-L-methionine is activated by treatment with trifluoroacetic acid and then reacts with a protected amino acid to form the corresponding amide or ester, respectively. The activated carboxylic acid group of Boc-L-methionine reacts with an unprotected amino group of the amino acid to form an amide or ester linkage, respectively. The reaction products are cleaved from the resin support by hydrogen fluoride for purification.</p>Formula:C10H19NO4SPurity:Min. 95%Molecular weight:249.33 g/molH-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys-OH (Disulfide bond)
CAS:<p>Please enquire for more information about H-Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys-OH (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H61N13O15S2Purity:Min. 95%Molecular weight:1,040.13 g/mol6-Bromo-1-methylindazole
CAS:<p>6-Bromo-1-methylindazole is an industrial chemical that can be synthesized by the reaction of formate, methanol, and indazole. The synthesis method involves the esterification of methyl formate with indazole to produce 6-bromo-1-methylindazole. It can also be synthesized by the annulation of methyl formate and cyclopentadiene followed by hydrolysis. This chemical has several isomers that are distinguished from each other based on their synthesis methods. 6-Bromo-1-methylindazole has been shown to have a hydrolysis reaction when it reacts with water, producing methyl bromide and hydrogen bromide.</p>Formula:C8H7BrN2Purity:Min. 95%Molecular weight:211.06 g/mol(His32,Leu34)-Neuropeptide Y (32-36)
CAS:<p>Please enquire for more information about (His32,Leu34)-Neuropeptide Y (32-36) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H54N14O6Purity:Min. 95%Molecular weight:742.87 g/molH-Ala-Gly-OH
CAS:<p>H-Ala-Gly-OH is a synthetic amino acid that is used to produce the peptide hormone luteinizing hormone (LH). It has been shown that H-Ala-Gly-OH is an antigen specific antibody response and has a hydrogen bond. The functional groups of H-Ala-Gly-OH include amine, carboxyl, and hydroxyl. Structural analysis of this compound was completed using a kinetic method. The conformational properties of H-Ala-Gly-OH were determined by nmr spectra and titration method. This synthetic amino acid may inhibit protein synthesis in vivo through treatment with carbohydrate.</p>Formula:C5H10N2O3Purity:Min. 95%Molecular weight:146.14 g/molZ-Val-Gly-Gly-OBzl
CAS:<p>Please enquire for more information about Z-Val-Gly-Gly-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29N3O6Purity:Min. 95%Molecular weight:455.5 g/molAlarin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C119H199N45O35Purity:Min. 95%Molecular weight:2,820.14 g/molZ-Ala-Ala-OMe
CAS:<p>Z-Ala-Ala-OMe is a serine protease inhibitor that binds to serine proteases, including chymotrypsin, trypsin, and elastase. The inhibition of these enzymes prevents the hydrolysis of proteins by these enzymes, which can lead to cell death. Z-Ala-Ala-OMe has been shown to inhibit the growth of bacteria in vitro and in animal models. This compound also showed an ability to inhibit the production of phosphite by immobilized subtilisin from Bacillus licheniformis (Bacillus subtilis) with a Km value of 0.5 mM</p>Formula:C15H20N2O5Purity:Min. 95%Molecular weight:308.33 g/molFmoc-4-phosphono-Phe(Bzl)-OH
CAS:<p>Fmoc-4-phosphono-Phe(Bzl)-OH is an efficient solid phase peptide synthesizer. It has been used in the synthesis of a variety of peptides, including those with short sequences and bulky side chains. Fmoc-4-phosphono-Phe(Bzl)-OH is an efficient synthesis reagent for the solid phase peptide synthesis of small or medium size peptides, which are difficult to synthesize with other methods.</p>Formula:C31H28NO7PPurity:Min. 95%Molecular weight:557.53 g/mol4-Phenyl-piperidine
CAS:<p>4-Phenyl-piperidine is a nitro compound that has been shown to be toxic for the kidneys and nervous system. 4-Phenyl-piperidine has been shown to inhibit dopamine uptake in the striatum and locomotor activity in rats. It also inhibits the hydrolysis of hydrochloric acid, which produces hydrogen ion (H+) ions, resulting in an acidic environment. The chemical structures of 4-phenyl-piperidine are similar to those of tricyclic antidepressants drugs, such as amitriptyline and imipramine, with a phenyl ring attached to an amine group. This drug is used as a pharmaceutical preparation for treating depression by inhibiting the reuptake of serotonin and norepinephrine, which are neurotransmitters that affect mood.</p>Formula:C11H15NPurity:Min. 95%Molecular weight:161.24 g/molBoc-Thr(Ile-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Ile-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H38N2O8Purity:Min. 95%Molecular weight:554.63 g/mol(D-Trp6)-LHRH (1-6) amide
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (1-6) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H49N11O9Purity:Min. 95%Molecular weight:887.94 g/mol[(RS)-2-Carboxy-3-phenylpropionyl]-Leu-OH
CAS:<p>Please enquire for more information about [(RS)-2-Carboxy-3-phenylpropionyl]-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21NO5Purity:Min. 95%Molecular weight:307.34 g/molH-His-Phe-OH
CAS:<p>H-His-Phe-OH is a polypeptide that is used in the diagnosis of chronic kidney disease. It is synthesized by the chemical reaction between histidine and phenylalanine. H-His-Phe-OH has been shown to have a molecular weight of 4,000 Da, with a diameter of 5 nm. The binding constants for this molecule are 3.5 x 10^6 M^(-1), and its stability in biological fluids has been shown to be greater than 100 hours at pH 7.4, 37°C.</p>Formula:C15H18N4O3Purity:Min. 95%Molecular weight:302.33 g/molH-Pro-Ser-Hyp-Gly-Asp-Trp-OH
CAS:<p>H-Pro-Ser-Hyp-Gly-Asp-Trp-OH is a cyclic hexapeptide with a high activity against platelets. It is an antagonist of the cyclic RGD sequence, which is present in fibrinogen, fibronectin, vitronectin and other proteins. This peptide binds to the n-terminal residue of these proteins and prevents them from binding to their receptors on the surface of platelets. H-Pro-Ser-Hyp-Gly-Asp-Trp-OH has been shown to be specific for human platelets and does not bind to erythrocytes or leukocytes.</p>Formula:C30H39N7O11Purity:Min. 95%Molecular weight:673.67 g/molZ-Pro-Leu-Gly-OH
CAS:<p>Z-Pro-Leu-Gly-OH is a peptide that belongs to the class of amides, oxalate salts, and grignard reagents. It can be synthesized from the reaction between an oxalate salt and a grignard reagent. The synthesis of Z-Pro-Leu-Gly-OH is usually done by reacting an oxalate salt with a grignard reagent in presence of a ketone or ketomethylene.</p>Formula:C21H29N3O6Purity:Min. 95%Molecular weight:419.47 g/molH-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Tyr69,Ala71·72,Lys74)-C3a (69-77)
CAS:<p>Please enquire for more information about (Tyr69,Ala71·72,Lys74)-C3a (69-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H77N13O11Purity:Min. 95%Molecular weight:976.17 g/mol2-[(1S)-1-Aminopropyl]-5-fluoro-3-phenyl-4(3H)-quinazolinone
CAS:Controlled Product<p>Intermediate in the synthesis of idelalisib (CAL 101)</p>Formula:C17H16FN3OPurity:Min. 95%Molecular weight:297.33 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Formula:C81H156N10O13SPurity:Min. 95%Molecular weight:1,510.23 g/molH-Tyr-Gly-Arg-Phe-Ser-OH·HCl
CAS:<p>Please enquire for more information about H-Tyr-Gly-Arg-Phe-Ser-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40N8O8·HClPurity:Min. 95%Molecular weight:665.14 g/molZ-Gly-Gly-Phe-bNA
CAS:<p>Please enquire for more information about Z-Gly-Gly-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H30N4O5Purity:Min. 95%Molecular weight:538.59 g/molH-Gly-Gly-pNA·HCl
CAS:<p>Please enquire for more information about H-Gly-Gly-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12N4O4·HClPurity:Min. 95%Molecular weight:288.69 g/molCyclo(-D-Ala-Val)
CAS:<p>Please enquire for more information about Cyclo(-D-Ala-Val) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O2Purity:Min. 95%Molecular weight:170.21 g/mol(D-Ala2)-Leu-Enkephalin amide
CAS:<p>Hyaluronic acid is a natural component of connective tissue and synovial fluid in animals. It is a linear, unbranched polysaccharide consisting of alternating D-glucuronic acid and N-acetyl-D-glucosamine. Hyaluronic acid has been shown to be useful in the treatment of long-term diseases such as heart disease or skin conditions like eczema. It is important for the efficient production of vaccines, which are used to prevent infectious diseases such as streptococcal infections. Hyaluronic acid can also be used as a microcontroller for minimally invasive procedures. This molecule can be used as an additive in the production of metallocene catalysts to increase the efficiency of these reactions, while reducing impurities during the process. The use of hyaluronic acid has been studied extensively, with many techniques employed to study its properties and functions. Genetic factors have also been found to play a role in</p>Formula:C29H40N6O6Purity:Min. 95%Molecular weight:568.66 g/mol3,5-Diiodo-4-methoxybenzhydrazide
CAS:<p>3,5-Diiodo-4-methoxybenzhydrazide is a high quality chemical that is useful in the preparation of complex compounds. This compound has been shown to be an excellent reagent and useful intermediate for the synthesis of various fine chemicals. It has been used as a precursor for the production of the antiviral drug Tamiflu, among other pharmaceuticals. 3,5-Diiodo-4-methoxybenzhydrazide is also a versatile building block that can be used in research or as a reaction component in organic synthesis.</p>Formula:C8H8I2N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:417.97 g/molEthyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate
CAS:<p>Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate is an anticancer agent that belongs to the class of formamidines. It is synthesized by refluxing ethyl 4-hydroxyphenylacetic acid with hexamethylenetetramine and acetic acid in ethanol. After purification, it is converted to its active form by reacting with hydrochloric acid. Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate prevents the growth of cancer cells in culture by preventing DNA synthesis, which prevents RNA and protein synthesis. This agent has also been found to suppress paclitaxel production in cultured human breast cancer cells.</p>Formula:C13H13NO3SPurity:Min. 95%Molecular weight:263.31 g/molSuc-Val-Pro-Phe-4MbNA
CAS:<p>Please enquire for more information about Suc-Val-Pro-Phe-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H40N4O7Purity:Min. 95%Molecular weight:616.7 g/mol(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt acetate salt is a synthetic hormone that belongs to the group of gonadotropin releasing hormones (GnRH). It is used in veterinary medicine to stimulate ovulation and follicular growth in animals. (Des-Gly10, tBu-D-Gly6, Pro -NHEt9)-LHRH acetate salt Pyr -His -Trp -Ser -Tyr -tBu -D -Gly -Leu -Arg -Pro NHEt acetate salt is a prodrug that is hydrolyzed in vivo to buserelin, its active form. This drug has been shown to be effective against estradiol benzoate and sodium salts</p>Formula:C59H84N16O12·xC2H4O2Purity:Min. 95%Molecular weight:1,209.4 g/molFmoc-D-Ser(BSi)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H31NO5SiPurity:Min. 95%Molecular weight:441.59 g/molH-β-Ala-Gly-OH
CAS:<p>H-beta-Ala-Gly-OH is a monoclinic crystalline compound. It is soluble in water and slightly soluble in ethanol, acetone, and benzene. The solubility of this compound depends on the pH of the solution as well as the presence of glycine. H-beta-Ala-Gly-OH has an upfield shift when protonated, making it useful for analytical purposes. This compound can be used to prepare glycine methyl ester by reacting with methanol or hydrochloric acid.</p>Formula:C5H10N2O3Purity:Min. 95%Molecular weight:146.14 g/molent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt
CAS:<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H119N15O13Purity:Min. 95%Molecular weight:1,486.88 g/molH-Gly-DL-Thr-OH
CAS:<p>H-Gly-DL-Thr-OH is an organic compound that is a component of natural phenolic compounds. This compound is generated by the pyrolysis of biomass, and it has been shown to have selective properties for GC-MS analysis. H-Gly-DL-Thr-OH can be used as a sustainable chemical component in the production of biofuels and other chemicals. The optimal conditions for this synthesis are potassium hydroxide, temperature, pressure, and irradiation time. The separation parameters for H-Gly-DL-Thr-OH are based on its GC retention time and mass spectra.</p>Formula:C6H12N2O4Purity:Min. 95%Molecular weight:176.17 g/molSorbin (147-153) amide (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Sorbin (147-153) amide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H58N10O9Purity:Min. 95%Molecular weight:738.88 g/molN,N,N',N'-Tetrakis(4-aminophenyl)-1,4-phenylenediamine
CAS:<p>TPD is a versatile building block and intermediate that is used as a research chemical and speciality chemical. TPD is an important and useful scaffold in organic chemistry, which can be used to produce various compounds. It is also a reagent for the synthesis of low-molecular-weight compounds with a wide range of applications, such as pharmaceuticals, agrochemicals, dyes, fragrances, etc. TPD is soluble in water and can be easily purified by recrystallization or column chromatography. TPD has been shown to have high quality and purity because it does not contain any impurities.</p>Formula:C30H28N6Purity:Min. 95%Color and Shape:Brown PowderMolecular weight:472.59 g/mol2,3,5,6-Tetra-methyl-pyrazine
CAS:<p>2,3,5,6-Tetra-methyl-pyrazine is a chemical compound that is structurally similar to ATP. It has been shown to inhibit the mitochondrial membrane potential and induce apoptosis in rat heart cells. 2,3,5,6-Tetra-methyl-pyrazine has also been shown to inhibit ATP synthase activity and increase lactate levels in the presence of glucose. This compound inhibits cyclase activity and increases microdialysis probe signal pathways. 2,3,5,6-Tetra-methyl-pyrazine may be useful for the treatment of myocardial infarcts.</p>Formula:C8H12N2Purity:Min. 95%Molecular weight:136.19 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt is a peptide that binds to the α5β1 integrin receptor. It has been shown to inhibit the growth of carcinoma cell lines and induce apoptosis in tumor cells by binding to receptors on the surface of cancer cells. H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt has also been shown to be effective against damaged tissue, such as adhesions, and promote wound healing by stimulating collagen production. This agent also has genotoxic effects and can cause DNA damage. H-Gly-Arg-Ala-Asp-Ser-Pro -OH trifluoroacetate salt may also have an antiapoptotic effect through its ability to bind with basic proteins, proapoptotic proteins, and epidermal growth factor receptor.</p>Formula:C23H39N9O10Purity:Min. 95%Molecular weight:601.61 g/molFmoc-Cys(NPys)-OH
CAS:<p>Fmoc-Cys(NPys)-OH is a disulfide with a cyclic structure that can be used in the synthesis of peptides. It reacts efficiently with thiols to form stable, covalent bonds and can be used as an efficient ligation reagent for cyclic peptides. Fmoc-Cys(NPys)-OH is also useful for the synthesis of biomolecules because it has a systematic nature and does not react with other reactive groups on the molecule. It has been shown to have high reactivity towards oxytocin, which is important for its function in triggering labor contractions.</p>Formula:C23H19N3O6S2Purity:Min. 95%Color and Shape:White SolidMolecular weight:497.55 g/molmono-Methyl terephthalate
CAS:<p>Mono-methyl terephthalate (MMT) is a monomer used in the manufacturing of polyester and other types of plastic. It is produced from terephthalic acid, which is derived from crude oil or natural gas. The oxidation catalyst used in this process is usually manganese dioxide. MMT has been shown to inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. This active form is metabolized through a number of metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. MMT also specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains (e.g., ESX-1 secretion system protein) and inhibits cell growth in culture.</p>Formula:C9H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:180.16 g/molFibronectin Receptor Peptide (124-131)
CAS:<p>Please enquire for more information about Fibronectin Receptor Peptide (124-131) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H72N8O15SPurity:Min. 95%Molecular weight:1,045.21 g/molH-Arg-Gly-OH·HCl
CAS:<p>Please enquire for more information about H-Arg-Gly-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H17N5O3·HClPurity:Min. 95%Molecular weight:267.71 g/molLys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin
CAS:<p>Please enquire for more information about Lys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N19O14S2Purity:Min. 95%Molecular weight:1,394.67 g/molN,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine)
CAS:<p>Please enquire for more information about N,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2Purity:Min. 95%Color and Shape:PowderMolecular weight:168.28 g/mol(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone
CAS:<p>(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone is an organic compound that has been shown to induce apoptosis in prostate cancer cells. The mechanism of this induction is not yet fully understood, but it may be due to the inhibition of the synthesis of proteins required for cell division. It also had a significant effect on locomotor activity in mice. This compound has been shown to have acute toxicities, and its phase transition temperature is below room temperature. It can be used as a fumigant and an inorganic acid, and it has been proposed as a potential fluorescence probe for natural compounds.</p>Purity:Min. 95%N-α-Trityl-Nε-Fmoc-L-lysine
CAS:<p>N-alpha-Trityl-Nepsilon-Fmoc-L-lysine is a pentapeptide that is used in peptides. It has been shown to have cytotoxicity and permeability, as well as being biologically active. N-alpha-Trityl-Nepsilon-Fmoc-L-lysine has also been used in solid phase synthesis of peptides. This pentapeptide can be synthesized using the Miyaura cross coupling reaction with an ether or Suzuki cross coupling reaction. N-alpha-Trityl-Nepsilon-Fmoc-L-lysine is a bicyclic molecule that can be synthesized on a solid phase.</p>Formula:C40H38N2O4Purity:Min. 95%Molecular weight:610.74 g/molDolastatin 15 (5S)-1-[(2S)-O-(N,N-Dimethyl-Val-Val-N-Me-Val-Pro-Pro)-2-hydroxyisovaleryl]-2-oxo-4-methoxy-5-benzyl-3-pyrroline
CAS:<p>Dolastatin 15 (5S)-1-[(2S)-O-(N,N-Dimethyl-Val-Val-N-Me-Val-Pro-Pro)-2-hydroxyisovaleryl]-2-oxo-4-methoxy-5-benzylpyrrolidinium is a natural compound that has been isolated from the Indian Ocean sea hare Dolabella auricularia. It has shown significant cytotoxicity against cancer cells as well as significant immunosuppressive activities in animals. Dolastatin 15 is an analog of dolastatin 10 and has been shown to be active against hepatitis B and C virus. It also has antiinflammatory properties and may be effective in combating autoimmune diseases. The synthesis of this compound is an asymmetric synthesis with a hydroxyl group on one side of the molecule and an amide on the other side.</p>Formula:C45H68N6O9Purity:Min. 95%Molecular weight:837.06 g/molDiethyl (5-phenylisoxazol-3-yl) phosphate
CAS:<p>Diethyl (5-phenylisoxazol-3-yl) phosphate is a chlorpyrifos analog that is detectable in the blood and urine. The compound has been detected in red blood cells, plasma, serum, and urine samples at levels of 10 to 50 μg/L. Diethyl (5-phenylisoxazol-3-yl) phosphate can be used as an analytical method for detecting chlorpyrifos residue on food products or in environmental samples. Diethyl (5-phenylisoxazol-3-yl) phosphate is transfected into human hepatoma cells and activated by carbamate or propanil. It inhibits cellular protein synthesis by binding to the 30S ribosomal subunit, preventing the formation of the initiation complex between aminoacyl tRNA and mRNA. This binding also prevents peptide bond formation between amino acids, leading to cell death.</p>Formula:C13H16NO5PPurity:Min. 95%Molecular weight:297.24 g/molType A Allatostatin II
CAS:<p>Allatostatin II is a fatty acid that has been shown to have receptor activity. It is an analog of the glycopeptide antibiotic gramicidin S and has been shown to inhibit the growth of bacteria and fungi. Allatostatin II also has diagnostic properties, which are used in biochemical tests for inflammatory diseases. The molecule is conjugated with various agents to form diagnostic agents or antibiotics, such as stenotrophomonas maltophilia and erythromycin. Allatostatin II is found in the human plasma, but its function is unknown.</p>Formula:C49H74N14O13Purity:Min. 95%Molecular weight:1,067.2 g/molFmoc-O-tert-butyl-L-trans-4-hydroxyproline
CAS:<p>Fmoc-O-tert-butyl-L-trans-4-hydroxyproline is a synthetic, cleavable peptide that can be used as a biomaterial. It is synthesized by coupling Fmoc-O-(tert-butoxycarbonyl)-L-trans(4R)-hydroxyproline with the amino acid N,N'-diisopropylcarbodiimide and 4-(dimethylamino)pyridine in a microwave reactor. The peptide has been shown to inhibit the enzyme matrix metalloproteinase 9 (MMP9), which plays an important role in tumor cell invasion and metastasis. This compound also has the ability to form conjugates with other molecules, such as lipopeptides, which may improve its therapeutic potential.</p>Formula:C24H27NO5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:409.47 g/molµ-Conotoxin GIIIA
CAS:Controlled Product<p>Conotoxins are peptides that can bind to specific receptors on the surface of cells. Their function is to regulate ion channels and thus affect cellular physiology. Conotoxin GIIIA is a disulfide-bonded peptide with a molecular weight of 5808 Da. It has been shown to inhibit Na+ channel activity in human serum, and may have diagnostic and therapeutic applications for diseases such as epilepsy. The amino acid sequence of conotoxin GIIIA is Arg-Asp-Cys-Cys-Thr-Hyp-Hyp-Lys-Lys-Cys-Lys-Asp-Arg-Gln-Cys (NH2)</p>Formula:C100H170N38O32S6Purity:Min. 95%Molecular weight:2,609.05 g/mol...(Ala13)-Apelin-13 (human, bovine, mouse, rat) trifluoroacetate salt
CAS:<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>Formula:C63H107N23O16S·xC2HF3O2Purity:Min. 95%Molecular weight:1,474.74 g/molH-Met-Phe-Gly-OH
CAS:<p>H-Met-Phe-Gly-OH is a hydrophobic amino acid. It has been shown to be present in human proteins, and it has been used as a marker for determining the sequence of amino acids in peptides. H-Met-Phe-Gly-OH is an acidic tripeptide that can be analysed using reversed phase high performance liquid chromatography (RPHPLC). This tripeptide is found in the peptide transporter, which transports amino acids across cellular membranes. The structural studies of H-Met-Phe-Gly-OH have revealed that this tripeptide has an alpha helix conformation, with two hydrogen bonds from the backbone amides to the backbone carbonyl groups.</p>Formula:C16H23N3O4SPurity:Min. 95%Molecular weight:353.44 g/molFA-Phe-Lys-OH·HCl
CAS:<p>Please enquire for more information about FA-Phe-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H27N3O5•HClPurity:Min. 95%Molecular weight:449.93 g/molZ-Gly-Val-OH
CAS:<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formula:C15H20N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:308.33 g/molZ-Leu-Leu-Arg-AMC
CAS:<p>Z-Leu-Leu-Arg-AMC is a proteolytic substrate that is used to study the activation of Th17 cells. It activates these cells by binding to the antigen peptide and protease activity, which are involved in the immune response. Z-Leu-Leu-Arg-AMC has been shown to induce autoimmune diseases in mice, as well as other conditions such as chronic inflammation and obesity. This compound also has a potential drug target for neutralizing acidity, which could be useful in treating cancer and other diseases. Z-Leu-Leu-Arg-AMC is stable at acidic pHs and can be used for biochemical studies of proteases at acidic pHs.</p>Formula:C36H49N7O7Purity:Min. 95%Color and Shape:PowderMolecular weight:691.82 g/mol(H-Cys-allyl ester)2·2 p-tosylate (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-allyl ester)2·2 p-tosylate (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N2O4S2·2C7H8O3SPurity:Min. 95%Molecular weight:664.84 g/mol(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)
CAS:<p>Please enquire for more information about (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C148H221N41O47SPurity:Min. 95%Molecular weight:3,358.65 g/molHIV Protease Substrate VII
CAS:<p>Please enquire for more information about HIV Protease Substrate VII including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H81N15O14Purity:Min. 95%Molecular weight:1,140.29 g/molN-Boc-2-aminoacetaldehyde
CAS:<p>N-Boc-2-aminoacetaldehyde is an aliphatic aldehyde that has been used in the synthesis of a number of bioactive molecules. It is synthesized by reacting an N-Boc amino acid with chloroform and hydrochloric acid. The reaction time is typically 2 hours at room temperature, although it can be decreased to 20 minutes if the temperature is increased to 60°C. The product can be purified using extraction or recrystallization methods. N-Boc-2-aminoacetaldehyde reacts with chloride ions to form phosphoranes, which are useful in clinical development as antimicrobial peptides. This compound also reacts with fluorine to form hydrogenated derivatives that have been shown to have neurokinin activity in animal models.</p>Formula:C7H13NO3Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:159.18 g/molHIV-1 gag Protein p17 (76-84) acetate salt
CAS:<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>Formula:C44H72N10O15Purity:Min. 95%Molecular weight:981.1 g/mol(D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H290N56O56Purity:Min. 95%Molecular weight:4,338.75 g/molFarnesyl-Met-OMe
CAS:<p>Please enquire for more information about Farnesyl-Met-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H37NO2SPurity:Min. 95%Molecular weight:367.59 g/molN-(4-Methoxybenzylidene)-4-butylaniline
CAS:<p>N-(4-Methoxybenzylidene)-4-butylaniline is an organic compound that belongs to the group of liquid crystals. It has been used in the study of phase transitions and thermal properties. The melting point of N-(4-methoxybenzylidene)-4-butylaniline is between -80 and -90 °C, depending on the solvent. This compound has a low proton affinity, but it can be oxidized to form a radical cation.</p>Formula:C18H21NOPurity:Min. 95%Molecular weight:267.37 g/molBoc-glu(OtBu)-OH
CAS:<p>Boc-glu(OtBu)-OH is a synthetic substrate that is used in chemical diversity studies. It has been shown to be an important model system for the study of disaccharide uptake and metabolism. This substrate binds to lectins, which are proteins found on the surface of cells. Boc-glu(OtBu)-OH binds to oligosaccharides and human cervical carcinoma cells, as well as amide groups. Analytical methods have been developed to measure its uptake and metabolism.</p>Formula:C14H25NO6Purity:Min. 98 Area-%Color and Shape:White Off-White PowderMolecular weight:303.35 g/molLeptin tifluoroacetic acid (150-167)
CAS:<p>Leptin tifluoroacetic acid (150-167) is a diagnostic agent that can be used to measure leptin in vivo. Leptin tifluoroacetic acid (150-167) is an agonist for the leptin receptor, which has been shown to have effects on locomotor activity, body weight and body mass index in animals. Leptin tifluoroacetic acid (150-167) has also been shown to have anti-inflammatory properties and may be of use in the treatment of bowel diseases such as inflammatory bowel disease or bowel disease. Leptin tifluoroacetic acid (150-167) binds with high affinity to human fat cells, allowing it to be used as a marker for fat cell differentiation and energy metabolism. The main function of leptin is regulation of food intake and energy expenditure by acting on receptors in the brain, liver, muscle and other tissues.</p>Formula:C87H138N22O28S2•(CF3CO2H)xPurity:Min. 95%Molecular weight:2,004.29 g/molFmoc-N-Me-D-Arg(Mtr)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H38N4O7SPurity:Min. 95%Molecular weight:622.73 g/molMca-Leu-Glu-Val-Asp-Gly-Trp-Lys(Dnp)-NH2
CAS:<p>Please enquire for more information about Mca-Leu-Glu-Val-Asp-Gly-Trp-Lys(Dnp)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H70N12O19Purity:Min. 95%Molecular weight:1,227.24 g/molH-Lys-Leu-OH·HBr
CAS:<p>Please enquire for more information about H-Lys-Leu-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H25N3O3·HBrPurity:Min. 95%Molecular weight:340.26 g/molMca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H105N19O19SPurity:Min. 95%Molecular weight:1,656.86 g/molAbz-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-3-nitro-Tyr-Thr-NH2
CAS:<p>Please enquire for more information about Abz-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-3-nitro-Tyr-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H84N14O22S2Purity:Min. 95%Molecular weight:1,393.5 g/molMethyl 3-amino-2-phenylpropanoate HCl
CAS:<p>Methyl 3-amino-2-phenylpropanoate HCl is a chemical intermediate that is synthesized in the biosynthesis of scopolamine and tenellin. It has been found to be an isotopically labeled analog of tropane alkaloids, which are a class of natural products that includes atropine, hyoscyamine, and scopolamine. Methyl 3-amino-2-phenylpropanoate HCl is one of many compounds that can provide structural insights into the biosynthesis and metabolism of these compounds.</p>Formula:C10H13NO2·HClPurity:Area-% Min. 95 Area-%Color and Shape:PowderMolecular weight:215.68 g/molFmoc-Leu-Ser(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Leu-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O6Purity:Min. 95%Molecular weight:480.55 g/molMethoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H34N8O7Purity:Min. 95%Molecular weight:522.56 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molMyosin Light Chain Kinase (480-501)
CAS:<p>H-AKKLSKDRMKKYMARRKWQKTG-NH2 peptide, corresponding to 480-501 amnino acids of Myosin Light Chain Kinase. Myosin Light Chain Kinase is a serine/threonine specific protein kinase that phosphorylates the myosin light chain.</p>Formula:C120H209N41O28S2Purity:Min. 95%Molecular weight:2,738.34 g/molH-Arg-Trp-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O2·2HClPurity:Min. 95%Molecular weight:432.35 g/molAmyloid β-Protein (1-38) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H277N51O56SPurity:Min. 95%Molecular weight:4,131.54 g/mol4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid
CAS:<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>Formula:C13H18N2O2Purity:Min. 95%Molecular weight:234.29 g/molH-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%pTH (44-68) (human)
CAS:<p>Please enquire for more information about pTH (44-68) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H199N41O41Purity:Min. 95%Molecular weight:2,836.08 g/molBiotinyl-Tyr-Val-Ala-Asp-chloromethylketone
CAS:<p>Please enquire for more information about Biotinyl-Tyr-Val-Ala-Asp-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H45ClN6O9SPurity:Min. 95%Molecular weight:725.25 g/molDL-Alanine ethyl ester hydrochloride
CAS:<p>DL-Alanine ethyl ester hydrochloride is a byproduct of the reaction between ethylene and amines. It can be produced through the addition of l-phenylalanine to acetonitrile. This compound is an organic ester that has been shown to have a variety of reactions with metal ions, such as aluminium, l-glutamic acid, and primary amines. The product can be used in thermodynamic data for reaction systems involving DL-alanine ethyl ester hydrochloride.</p>Formula:C5H11NO2·HClPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:153.61 g/molSuc-Ala-Ala-Val-AMC
CAS:<p>Please enquire for more information about Suc-Ala-Ala-Val-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H32N4O8Purity:Min. 95%Molecular weight:516.54 g/molFmoc-Lys(Boc)-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H41N3O8Purity:Min. 95%Molecular weight:595.68 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molFmoc-D-Arg(Pbf)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys-Leu-OH acetate salt
CAS:<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>Formula:C12H25N3O3·C2H4O2Purity:Min. 95%Molecular weight:319.4 g/molH-Phe-Phe-Phe-Phe-OH
CAS:<p>Please enquire for more information about H-Phe-Phe-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H38N4O5Purity:Min. 95%Molecular weight:606.71 g/molFmoc-Cys(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Gly-Gly-Leu-pNA
CAS:<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molFmoc-b-(2-thienyl)-L-alanine
CAS:<p>Please enquire for more information about Fmoc-b-(2-thienyl)-L-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H19NO4SPurity:Min. 95%Molecular weight:393.46 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molBoc-Pen (NPys)-OH
CAS:<p>Please enquire for more information about Boc-Pen (NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N3O6S2Purity:Min. 95%Molecular weight:403.48 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/mol3-(Boc-amino)pyridine
CAS:<p>3-(Boc-amino)pyridine is a glycine derivative with a trigonal, chelate ring. It can be hydrolyzed by acid to form 3-aminopyridine. 3-(Boc-amino)pyridine has been shown to react with trimethyltin chloride to form an intramolecular complex in the presence of alkyllithiums. This reaction proceeds through lithiation and methylation of the carboxyl group of 3-(Boc-amino)pyridine. The interaction between 3-(Boc-amino)pyridine and trimethyltin chloride forms an antiaromatic six membered ring that resembles a benzene molecule.</p>Formula:C10H14N2O2Purity:Min. 95%Molecular weight:194.23 g/molH-Gly-Gly-bNA·HBr
CAS:<p>Please enquire for more information about H-Gly-Gly-bNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O2·HBrPurity:Min. 95%Molecular weight:338.2 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/mol(Des-Tyr1)-Met-Enkephalin
CAS:<p>Des-Tyr1-Met-Enkephalin H-Gly-Gly-Phe-Met-OH is a peptide that is derived from the endorphin family. It has been shown to have both amnestic and enkephalin effects, which may be due to its antagonistic effect on naloxone. This endogenous peptide has been studied in a dose response curve, with an increase in amnesia and decrease in memory retention as the dose increases. Des-Tyr1-Met-Enkephalin H-Gly-Gly-Phe-Met-OH also binds to receptors at the same sites as other substances such as epinephrine, β endorphin, and behavioral effects are observed.</p>Formula:C18H26N4O5SPurity:Min. 95%Molecular weight:410.49 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/mol
