
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
1,3-Dithiane-2-carboxylic acid
CAS:<p>1,3-Dithiane-2-carboxylic acid is an alkylating agent that reacts with electron-deficient substrates. It is a convenient way to access enantiopure carboxylates and unsaturated ketones in the presence of amines. This compound can also be used for the preparation of phthalimides and thioacetals. 1,3-Dithiane-2-carboxylic acid is prepared by ring opening of 1,3 dithianes. This reaction can be catalyzed by acids such as hydrochloric acid or pyridine.</p>Formula:C5H8O2S2Purity:Min. 95%Molecular weight:164.25 g/molCyclopropane-1,1-dicarboxylic acid, methylester
CAS:<p>Please enquire for more information about Cyclopropane-1,1-dicarboxylic acid, methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:144.13 g/mol2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid
CAS:<p>2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid (DMTA) is a versatile building block that can be used in the synthesis of a wide variety of compounds. DMTA is an important intermediate for the synthesis of complex molecules and is a useful scaffold for drug development. It has been shown to be an effective reagent for the synthesis of 2,4,6-trinitrobenzenesulfonic acid as well as other useful compounds. DMTA also has high quality and purity with CAS No. 462100-06-7 and is a speciality chemical.</p>Formula:C13H25NO7Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:307.34 g/mol(Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt
<p>Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H276N46O45Purity:Min. 95%Molecular weight:3,768.37 g/molFITC-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt
<p>Please enquire for more information about FITC-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C230H333N57O66S2Purity:Min. 95%Molecular weight:5,016.58 g/molDefensin HNP-3 (human) trifluoroacetate salt
CAS:<p>HNP-3</p>Formula:C151H222N44O40S6Purity:Min. 95%Molecular weight:3,486.05 g/mol7-Hydroxyheptanoic acid
CAS:<p>7-Hydroxyheptanoic acid is a fatty acid that has the hydroxyl group on the seventh carbon. It is biosynthesized from the hydroxylation of heptanal, which is catalyzed by a monooxygenase. The hydroxyl group in 7-hydroxyheptanoic acid can be oxidized to form a carboxylic acid (e.g., 7-ketoheptanoic acid). 7-hydroxyheptanoic acid can also be used as a coating material because it has functional groups and is biodegradable and metal ion free.</p>Formula:C7H14O3Purity:Min. 95%Molecular weight:146.18 g/molTumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt
<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C94H174N32O22S2Purity:Min. 95%Molecular weight:2,168.72 g/molpTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C108H173N27O35Purity:Min. 95%Molecular weight:2,409.69 g/molβ-Casomorphin (1-3) amide acetate salt
CAS:<p>Beta-casomorphin (1-3) amide acetate salt (BCMA) is a peptide that belongs to the class of opioid compounds. It is an amino acid and has been shown to be a potent agonist at opioid receptors. BCMA is used in vivo as a tritiated ligand for mapping the distribution of opioid receptors in rat brain. The affinity of BCMA for opioid receptors increases with dose, and its antinociceptive effects are dose-dependent. Beta-casomorphin (1-3) amide acetate salt has also been shown to have affinity for enkephalins, which are naturally occurring peptides that bind to opioid receptors.</p>Formula:C23H28N4O4Purity:Min. 95%Molecular weight:424.49 g/mol(Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C193H293N53O58SPurity:Min. 95%Molecular weight:4,315.78 g/molH-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35ClN4O3Purity:Min. 95%Molecular weight:390.95 g/mol(D-Ser4)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molGastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H209N35O38SPurity:Min. 95%Molecular weight:3,010.43 g/mol(D-Trp8)-γ2-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H99N21O16SPurity:Min. 95%Molecular weight:1,570.78 g/molEthylene glycol monoacetoacetate monomethacrylate
CAS:<p>Ethylene glycol monoacetoacetate monomethacrylate is a metal chelate that is used to treat muscle diseases. It has been shown to act as a gamma-aminobutyric acid agonist and inhibit the release of acetylcholine from nerve endings. This drug can also be used as a chemical stabilizer in the synthesis of polymers in organic chemistry. Ethylene glycol monoacetoacetate monomethacrylate is insoluble in water and soluble in organic solvents such as ethanol, acetone, or benzene. It has been found to have a phase transition temperature at -139°C, which is suitable for applications that require low temperatures. Ethylene glycol monoacetoacetate monomethacrylate reacts with sodium carbonate to form an ester and methacrylic acid (MAA). The reaction solution is typically heated with stirring until it reaches 40°C-50°C. The particle size of</p>Formula:C10H14O5Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:214.22 g/molThymosin α1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H215N33O55·xC2HF3O2Purity:Min. 95%Molecular weight:3,108.28 g/mol2-Amino-3-fluorobenzoic acid ethyl ester
CAS:<p>Please enquire for more information about 2-Amino-3-fluorobenzoic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H10FNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:183.18 g/molc3-Ethylbenzoic acid
CAS:<p>C3-Ethylbenzoic acid is an organic compound that can be synthesized from the reactants ethyl bromide, propylene oxide, and acetic anhydride. The synthesis of C3-Ethylbenzoic acid is a stepwise process in which the starting materials are converted to intermediates and then reacted to form the desired product. The reaction mechanism involves bond cleavage, which generates a carboxylic acid group on one end of the molecule and a phenyl group on the other end. C3-Ethylbenzoic acid interacts with clausamine and isoprene during transport through cell membranes. This interaction may lead to increased permeability of cell membranes by c3-ethylbenzoic acid.</p>Formula:C9H10O2Purity:Min. 95%Molecular weight:150.17 g/molSodium dimethyldithiocarbamate hydrate
CAS:<p>Sodium dimethyldithiocarbamate hydrate is a salt of dimethyldithiocarbamic acid. It is used as an additive in paints and coatings to prevent corrosion of metal. Sodium dimethyldithiocarbamate hydrate is also used in the production of polyurethane and polyester resins, where it acts as a curing agent. Dimethyldithiocarbamic acid has been shown to be a ligand for the influenza virus, inhibiting viral activity by binding to the hemagglutinin protein. The crystal system of this substance is hexagonal; its salts exist in both acidic and basic forms. The functional theory explains the stabilization of this compound through coordination with nitrogen atoms on one side and phenyl substituents on the other side. Hexamethylenetetramine reacts with sodium chloride to form sodium dimethyldithiocarbamate hydrate, which can then react with methanol or eth</p>Formula:C3H6NNaS2·xH2OPurity:Min. 95%Color and Shape:White PowderMolecular weight:143.2 g/molH-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H61N9O7S2·C2HF3O2Purity:Min. 95%Molecular weight:970.13 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/molH-Gly-Gly-Lys-Ala-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N6O6Purity:Min. 95%Molecular weight:402.45 g/mol(S)-(1-boc-pyrrolidin-3-yl)-acetic acid
CAS:<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molEthyl diphenylacetate
CAS:<p>Ethyl diphenylacetate is a trifluoromethyl group that has the potential for use as a fungicide. The hydrochloride salt of this compound exhibits high activity against various fungi, such as Rhizoctonia solani, Sclerotium rolfsii, and Botrytis cinerea. Ethyl diphenylacetate has also been shown to be an effective herbicide in plants, as it inhibits the enzyme acetolactate synthase and prevents the formation of branched-chain amino acids. It can also inhibit germination of seeds.</p>Formula:C16H16O2Purity:Min. 95%Molecular weight:240.3 g/mol(Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molMca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H105N19O19SPurity:Min. 95%Molecular weight:1,656.86 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Formula:C32H49N5O7•C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:675.81 g/molH-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS:<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>Formula:C30H44N8O4Purity:Min. 95%Molecular weight:580.72 g/moltert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15BrN2O2SPurity:Min. 95%Molecular weight:319.22 g/mol3-(4-Methoxybenzoyl)acrylic acid
CAS:<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H10O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.19 g/molH-Val-Lys-OH monoacetate salt
CAS:<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H23N3O3•C2H4O2Purity:Min. 95%Molecular weight:305.37 g/molBradykinin (2-7) acetate salt
CAS:<p>Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40N6O8Purity:Min. 95%Molecular weight:600.66 g/mol4-bromo-5-chloro-2-fluorobenzoic Acid
CAS:<p>Please enquire for more information about 4-bromo-5-chloro-2-fluorobenzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H3BrClFO2Purity:Min. 95%Molecular weight:253.45 g/molH-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/molModafinil carboxylate
CAS:<p>Modafinil is a drug that belongs to the class of wakefulness-promoting agents. It has been shown to have a long half-life and low toxicity in humans, which may be due to its effects on cytochrome P450 isoenzymes. Modafinil has been studied in clinical trials for its tolerability, with no significant side effects reported. The drug has also been shown to have anticonvulsant properties and can be used as an adjunctive treatment for patients with partial seizures. Modafinil binds to the GABA receptor in the brain and increases GABAergic neurotransmission. The compound's mechanism of action is not fully understood, but it is believed that it acts by inhibiting cyclic AMP degradation and increasing cAMP levels in the brain. This increase in cAMP levels may lead to increased protein kinase activity, decreased phosphorylation of glutamate receptors, increased release of dopamine, and decreased release of histamine from mast cells.</p>Formula:C15H14O3SPurity:Min. 95%Color and Shape:PowderMolecular weight:274.34 g/molCyclohexylacetic acid
CAS:<p>Cyclohexylacetic acid is a cyclic fatty acid that has been shown to inhibit the production of gamma-aminobutyric acid in hl-60 cells. This inhibition leads to an increase in epidermal growth factor and a decrease in malonic acid. Cyclohexylacetic acid also inhibits microbial metabolism by preventing the conversion of nitrogen atoms into ammonia, which can cause cardiac arrest or sublethal doses. The effects of cyclohexylacetic acid on coronary heart disease have not been determined because it is not commercially available for purchase.</p>Formula:C8H14O2Purity:Min. 95%Molecular weight:142.2 g/molH-D-Val-Leu-Lys-AMC acetate salt
CAS:<p>Please enquire for more information about H-D-Val-Leu-Lys-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H41N5O5Purity:Min. 95%Molecular weight:515.65 g/molTRAF6 Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H238N34O44Purity:Min. 95%Molecular weight:3,161.64 g/mol3-Bromo-6-methylpicolinic acid
CAS:<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H6BrNO2Purity:Min. 95%Molecular weight:252.49 g/molProp-1-en-2-ylboronic acid
CAS:<p>Prop-1-en-2-ylboronic acid is a chemical compound that belongs to the group of aromatic hydrocarbons. It is used in pharmaceutical preparations as a monomer and as a chiral building block for the synthesis of oxazolidinones, which are used in medicinal chemistry as protein inhibitors against cancers. Prop-1-en-2-ylboronic acid is also used as a reagent in preparative high performance liquid chromatography. This chemical has shown maximal response against colorectal carcinoma cells and has been shown to be an inhibitor of cholesterol ester transfer.</p>Formula:C3H7BO2Purity:90%MinMolecular weight:85.9 g/molNeuronostatin-13 (human, canine, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H110N20O16Purity:Min. 95%Molecular weight:1,415.68 g/mol3-Cyanopropanoic acid
CAS:<p>3-Cyanopropanoic acid is a reactive compound that forms a complex with palladium. It is produced by the reaction of acrylonitrile and chloride in the presence of a base such as sodium hydroxide. The reaction mechanism is shown below:</p>Formula:C4H5NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:99.09 g/molBradykinin (2-9) acetate salt
CAS:<p>Acetate salt</p>Formula:C44H61N11O10Purity:Min. 95%Molecular weight:904.02 g/mol(Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molBNP-32 (rat) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C146H239N47O44S3Purity:Min. 95%Molecular weight:3,452.95 g/molH-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23IN4O4Purity:Min. 95%Molecular weight:534.35 g/molAnxiety Peptide acetate salt
CAS:<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>Formula:C81H138N24O29Purity:Min. 95%Molecular weight:1,912.11 g/molMyelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H114N18O21Purity:Min. 95%Molecular weight:1,543.76 g/mol(D-Lys6)-LHRH (free acid) acetate salt
CAS:Controlled Product<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H83N17O14Purity:Min. 95%Molecular weight:1,254.4 g/molPresenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C92H130N28O37SPurity:Min. 95%Molecular weight:2,252.25 g/molBig Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt )
CAS:<p>Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H236N38O47S5Purity:Min. 95%Molecular weight:3,628.17 g/molAdrenomedullin 5 (primate) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin 5 (primate) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C253H394N82O71S2Purity:Min. 95%Molecular weight:5,784.48 g/molD-α-Hydroxyisovaleric acid
CAS:<p>D-alpha-Hydroxyisovaleric acid is a compound that is used to synthesize stereoisomers. It is also a component of supramolecular chemistry and has been used in the construction of supramolecular polymers. D-alpha-Hydroxyisovaleric acid can be found in some plants, such as valinomycin, isovaleric acid, and metarhizium. This stereoisomer can be synthetized from the hydroxy group and an amino acid or peptide. D-alpha-Hydroxyisovaleric acid has the ability to degrade nonribosomal peptides into smaller molecules through its hydrolytic properties. It also inhibits Verticillium dahliae, which causes wilt disease in plants, by inhibiting the synthesis of hydroxycarboxylates. D-alpha-Hydroxyisovaleric acid is biodegradable and can be used for industrial purposes as well as pharmaceuticals.</p>Formula:C5H10O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:118.13 g/molNeuropeptide Y (2-36) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H276N54O55SPurity:Min. 95%Molecular weight:4,108.51 g/mol4-Nitrobenzaldiacetate
CAS:<p>4-Nitrobenzaldiacetate is a crystalline solid that can be obtained by two-dimensional experimental methods. It has been shown to have high reactivity in the presence of ozone and sulfuric acid. The reaction product is the corresponding sulfate salt. The filtration technique is used to separate the desired product from the reaction mixture. This product can also be crystallized with catalytic amounts of sulfuric acid and 4-nitrobenzoic acid. The catalytic oxidation of 4-nitrobenzoic acid to form 4-nitrobenzaldaicetic acid, as well as its subsequent conversion to 4-nitrobenzaldiacetate, are both feasible reactions for this compound.</p>Formula:C11H11NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:253.21 g/molM65 trifluoroacetate salt
<p>Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H326N64O61S5Purity:Min. 95%Molecular weight:4,823.51 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/mol(Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H105N17O12SPurity:Min. 95%Molecular weight:1,384.73 g/molNeuropeptide S (1-10) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H68N14O14SPurity:Min. 95%Molecular weight:1,025.14 g/molH-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
CAS:<p>L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.</p>Formula:C21H42N6O5Purity:Min. 95%Molecular weight:458.6 g/mol(R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid
CAS:<p>Please enquire for more information about (R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19F2NO4Purity:Min. 95%Molecular weight:315.31 g/mol5-Amino-2-methoxyisonicotinic acid
CAS:<p>5-Amino-2-methoxyisonicotinic acid is a carboxylic acid that is used in the synthesis of aminopyridines. The compound can be synthesized from formamidine acetate and diethyl dicarbonate. This process involves lithiation, followed by addition of an amine and finally conversion to the desired product with formamidine acetate. 5-Amino-2-methoxyisonicotinic acid can also be synthesized from formamide and diethyl ether. 5-Amino-2-methoxyisonicotinic acid is an analog of 2,4,6-trimethylaniline and has been shown to have similar properties to this compound, including strong basicity.</p>Formula:C7H8N2O3Purity:Min. 95%Molecular weight:168.15 g/mol(Ile3)-Pressinoic acid
CAS:<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/mol(D-Ala2)-Leu-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N9O8·xC2H4O2Purity:Min. 95%Molecular weight:725.84 g/molSauvagine trifluoroacetate salt
CAS:<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>Formula:C202H346N56O63SPurity:Min. 95%Molecular weight:4,599.31 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS:<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H37N5O4•3C2H4O2Purity:Min. 95%Molecular weight:567.67 g/mol(D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H290N56O56Purity:Min. 95%Molecular weight:4,338.75 g/molNociceptin trifluoroacetate salt
CAS:<p>Nociceptin trifluoroacetate salt is an opioid with low potency that is used in the treatment of pain. It has been shown to bind to the protein and inhibit protease, which has been proposed as a possible mechanism for its analgesic effects. Nociceptin trifluoroacetate salt may also have indirect effects on brain functions by regulating levels of nociceptin, a neuropeptide that interacts with nociceptive neurons in the brain. This drug has been shown to have nootropic effects in mice, including increased locomotor activity and improved memory retention. Nociceptin trifluoroacetate salt inhibits kappa-opioid receptors and is therefore used as a pharmacological tool for research into opioid receptor function.</p>Formula:C79H129N27O22Purity:Min. 95%Molecular weight:1,809.04 g/mol2-Pyridineboronic acid
CAS:<p>2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.</p>Formula:C5H6BNO2Purity:Min. 95%Molecular weight:122.92 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H228N38O51Purity:Min. 95%Molecular weight:3,259.53 g/mol4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt
CAS:<p>4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.</p>Formula:C23H34N6O6Purity:Min. 95%Molecular weight:490.55 g/mol2-Amino-5-chloro-3-methylbenzoic acid
CAS:<p>2-Amino-5-chloro-3-methylbenzoic acid (ACMB) is a substructure of the insecticidal compound chlorantraniliprole. It is a solid at room temperature and has a molecular weight of 142.15 g/mol. ACMB can be extracted from n-hexane, chlorantraniliprole, or xylene using gravimetric analysis. The bioactivity of ACMB can be determined by an anthranilic assay, while its solubility data are available in the literature. ACMB has been shown to have insecticidal activity against lepidoptera larvae and cyanuric activity against mosquito larvae.</p>Formula:C8H8ClNO2Purity:Min. 95%Molecular weight:185.61 g/mol1-Pyreneboronic Acid (contains varying amounts of Anhydride)
CAS:<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>Formula:C16H11BO2Purity:Min. 95%Molecular weight:246.07 g/molpTH (28-48) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H150N28O29Purity:Min. 95%Molecular weight:2,148.38 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H294N54O56Purity:Min. 95%Molecular weight:4,278.74 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C61H83N15O10Purity:Min. 95%Molecular weight:1,186.41 g/molAmyloid β-Protein (16-20) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>Formula:C35H52N6O6Purity:Min. 95%Molecular weight:652.82 g/molAnti-Kentsin trifluoroacetate salt
CAS:<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H45N11O6Purity:Min. 95%Molecular weight:559.66 g/molNeurokinin B trifluoroacetate salt
CAS:<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br><br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>Formula:C55H79N13O14S2Purity:Min. 95%Molecular weight:1,210.43 g/mol5-Nitro nicotinic acid
CAS:<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>Formula:C6H4N2O4Purity:Min. 95%Molecular weight:168.11 g/molTRAP-5 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H51N9O6Purity:Min. 95%Molecular weight:633.78 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C141H235N47O41·xC2H4O2Purity:Min. 95%Molecular weight:3,244.67 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS:<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Molecular weight:208.07 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/molOsteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H42N10O7Purity:Min. 95%Molecular weight:618.69 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C141H235N47O41Purity:Min. 95%Molecular weight:3,244.67 g/molEthyl imidazole-2-carboxylate
CAS:<p>Ethyl imidazole-2-carboxylate is a β-glucosidase inhibitor that has shown selectivity for cancer cells. This drug inhibits the activity of β-glucosidase, an enzyme that catalyzes the hydrolysis of terminal non-reducing β-D-glucose residues from oligo-, di-, and polysaccharides, which are substrates for glycosylation. Dasatinib is a type of drug that inhibits Bcr-Abl tyrosine kinase and is used in the treatment of chronic myeloid leukemia and other cancers. The inhibition of this enzyme may lead to increased levels of thymidine (a nucleotide) and therefore, DNA synthesis. Dasatinib also blocks the function of ribonucleotide reductases, which are enzymes that reduce ribonucleotides to deoxyribonucleotides. This mechanism prevents DNA replication by inhibiting the production of new DNA</p>Purity:Min. 95%H-Gly-Gly-Arg-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/molUrotensin II-Related Peptide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>Formula:C49H64N10O10S2Purity:Min. 95%Molecular weight:1,017.23 g/molBenzopyrazine-6-boronic acidHCl
CAS:<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8BClN2O2Purity:Min. 95%Molecular weight:210.43 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molH-Pro-Lys-OH acetate salt
CAS:<p>H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.</p>Formula:C11H21N3O3Purity:Min. 95%Molecular weight:243.3 g/molFmoc-D-thiazolidine-4-carboxylic acid
CAS:<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17NO4SPurity:Min. 95%Molecular weight:355.41 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/mol(Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H295N53O59SPurity:Min. 95%Molecular weight:4,345.81 g/molSpexin trifluoroacetate salt
CAS:<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O19SPurity:Min. 95%Molecular weight:1,619.89 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/mol6,8-Dichlorochromone-2-carboxylic acid
CAS:<p>6,8-Dichlorochromone-2-carboxylic acid is a fine chemical that is used as a building block in the synthesis of complex compounds. It is also a versatile building block that can be used in many reactions, such as nucleophilic substitution, electrophilic addition, and condensation reactions. This compound has CAS number 16722-38-6 and is a reagent for research purposes.</p>Formula:C10H4Cl2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:259.04 g/molβ-MSH (human) trifluoroacetate salt
CAS:<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>Formula:C118H174N34O35SPurity:Min. 95%Molecular weight:2,660.92 g/molH-Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys-Ala-OH trifluoroacetate salt (Disulfide bond between Pen2 and Cys9)
CAS:<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>Formula:C35H57N13O14S2Purity:Min. 95%Molecular weight:948.04 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol4-Chloro-Nicotinic acid ethyl ester hydrochloride
CAS:<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>Formula:C8H8ClNO2·HClPurity:Min. 95%Molecular weight:222.07 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/molBIM-23627 trifluoroacetate salt
CAS:<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H69ClN12O8S2Purity:Min. 95%Molecular weight:1,161.83 g/mol4-Oxo-1-adamantanecarboxylic acid
CAS:<p>4-Oxo-1-adamantanecarboxylic acid is a versatile building block that can be used as a reactant and reagent in organic chemistry. It is used to synthesize various heterocyclic compounds, including the 4-oxo-1,4-dihydropyridine ring system. This compound has been shown to be useful as an intermediate or building block in the synthesis of a number of complex compounds. 4-Oxo-1-adamantanecarboxylic acid may also be used as a research chemical or speciality chemical.</p>Formula:C11H14O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:194.23 g/moltrans 4-Dimethylaminocrotonic acid HCl
CAS:<p>Intermediate in the synthesis of afatinib</p>Formula:C6H12ClNO2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:165.62 g/molLQEQ-19 (human) trifluoroacetate salt
<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C106H170N30O34Purity:Min. 95%Molecular weight:2,408.67 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H229N45O37Purity:Min. 95%Molecular weight:3,050.52 g/molNeuropeptide FF (5-8) acetate salt
CAS:<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H39N9O5Purity:Min. 95%Molecular weight:545.63 g/mol[p-Terphenyl]-4,4''-dicarboxylic acid
CAS:<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>Formula:C20H14O4Purity:Min. 95%Molecular weight:318.32 g/molAmylin (mouse, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C167H272N52O53S2Purity:Min. 95%Molecular weight:3,920.4 g/molAdrenomedullin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C242H381N77O75S5Purity:Min. 95%Molecular weight:5,729.42 g/molCys-CD36 (139-155) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-CD36 (139-155) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H133N25O26SPurity:Min. 95%Molecular weight:1,977.21 g/molCatestatin (human) trifluoroacetate
CAS:<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H164N32O27SPurity:Min. 95%Molecular weight:2,326.68 g/molpTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H317N63O53Purity:Min. 95%Molecular weight:4,416.02 g/mol2-Bromopropionic acid benzyl ester
CAS:<p>2-Bromopropionic acid benzyl ester is a synthetic compound with a molecular weight of 220.24 g/mol. It is soluble in organic solvents and has a hydroxyl group at its alpha position. 2-Bromopropionic acid benzyl ester is used in the synthesis of beta-cyclodextrin, which is an important biomaterial for drug delivery as well as other applications. 2-Bromopropionic acid benzyl ester also has antioxidant properties and can be used to treat leukemia cells by inhibiting the production of reactive oxygen species (ROS).</p>Formula:C10H11BrO2Purity:Min. 95%Molecular weight:243.1 g/mol4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester
CAS:<p>Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12BrNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:302.12 g/molα-MSH (11-13) (free acid) acetate salt
CAS:<p>α-MSH (11-13) (free acid) acetate salt is a synthetic, nonsteroidal compound that binds to and activates α-melanocyte-stimulating hormone receptors. It has been used as an antiinflammatory agent in the treatment of inflammatory bowel disease and bowel disease. α-MSH (11-13) (free acid) acetate salt is also being studied as a contraceptive and an elastase inhibitor. This drug has shown some promise in the treatment of autoimmune diseases, such as rheumatoid arthritis, Crohn's disease, ulcerative colitis, multiple sclerosis, and type 1 diabetes mellitus. It is thought that α-MSH (11-13) (free acid) acetate salt may inhibit the production of inflammatory cells by inhibiting leukocyte elastase activity.</p>Formula:C16H30N4O4Purity:Min. 95%Molecular weight:342.43 g/molAngiotensin A (1-7) trifluoroacetate
CAS:<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molTES
CAS:<p>TES, also known as N-Tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid, is a buffering agent that is used in protein assays and forms complexes with DNA and copper ions. The optimal pH range of this zwitterionic buffer is 6.8-8.2 and its pKa is 7.4.</p>Formula:C6H15NO6SPurity:Min. 95%Color and Shape:PowderMolecular weight:229.25 g/molH-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.</p>Formula:C14H25ClN6O5Purity:Min. 95%Molecular weight:392.84 g/mol2-(2-Naphthyloxy)propanoic acid
CAS:<p>2-(2-Naphthyloxy)propanoic acid is a naphthalene derivative that is found in the plant species Carthamus tinctorius. It has been shown to have potent antagonist activity against the NMDA receptor, as well as antinociceptive and analgesic properties in vivo. 2-(2-Naphthyloxy)propanoic acid also shows potent anti-inflammatory and cardioprotective effects in vitro and in vivo. 2-(2-Naphthyloxy)propanoic acid can be used for the treatment of bone cancer, congestive heart failure, diabetic neuropathy, or other disorders of the peripheral nervous system.</p>Formula:C13H12O3Purity:Min. 95%Molecular weight:216.23 g/mol1-Adamantylphosphonic acid
CAS:<p>1-Adamantylphosphonic acid (1APA) is a trifluoroacetic acid derivative that is used as an organic solvent. It is also a catalyst in organic chemistry. 1APA can be used to catalyze the carbonylation of olefins with phosphines, which are ligands that bind to metal compounds and facilitate chemical reactions. Ferrocene, adamantyl, and metallocene are all examples of ligands. 1APA is also used as a reagent in the synthesis of phosphine ligands, which are used in catalytic reactions.</p>Formula:C10H17O3PPurity:Min. 95%Molecular weight:216.21 g/moltert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate
CAS:<p>tert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate is a chiral compound that contains two stereogenic centers. It is a racemate of enantiomers. The enantiomeric purity can be determined by the preparative method. This compound is soluble in water and is stable in neutral or acidic conditions. It has been shown to act as an α-amino acid and to inhibit glycine uptake by neurons.</p>Formula:C21H23NO4Purity:Min. 95%Color and Shape:SolidMolecular weight:353.41 g/molLHRH (1-5) (free acid) trifluoroacetate salt
CAS:<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>Formula:C34H38N8O9Purity:Min. 95%Color and Shape:PowderMolecular weight:702.71 g/mol5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride
CAS:<p>Please enquire for more information about 5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H12N2O4•HClPurity:Min. 95%Molecular weight:248.66 g/molThymopentin acetate salt
CAS:Controlled Product<p>Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.</p>Formula:C30H49N9O9Purity:Min. 95%Molecular weight:679.77 g/mol(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride
CAS:<p>(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride is a synthetic chiral compound that is used to study the role of glyoxylate in biochemical reactions. This drug is an enolate and alkylating agent that can react with nucleophiles such as amines and thiols. It has been shown to be effective against perchlorates by hydrolyzing them into chlorine and oxygen gas. This drug has also been shown to inhibit the growth of Rhodobacter sphaeroides by inhibiting glyoxylate metabolism.</p>Formula:C12H15NO4·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:273.71 g/mol4-[2-[[(1S)-1-(2-Aminophenyl)-3-methylbutyl]amino]-2-oxoethyl]-2-ethoxybenzoic acid
CAS:<p>Bosentan is a potent inhibitor of the uptake of organic anions. It is used in the treatment of pulmonary arterial hypertension and has been shown to be effective against pravastatin-resistant HIV protease inhibitors, such as saquinavir, quinidine, and rosuvastatin. Bosentan inhibits uptake by binding to the transporter protein at a site that does not overlap with the binding site for organic anion substrates. This leads to a change in kinetic parameters for substrates, such as pravastatin and saquinavir. The binding site on bosentan may also be elucidated through monolayer experiments with efflux transporters.</p>Formula:C22H28N2O4Purity:Min. 95%Molecular weight:384.47 g/molLysergic acid hydrazide
CAS:Controlled Product<p>Lysergic acid hydrazide is a synthetic drug with an active form of lysergic acid. It is used in the synthesis of ergocryptine and other drugs. The compound can be synthesized using methyl alcohol, trifluoromethyl group, hydroxy group, skeleton, and C1-4 alkyl as reactants. Lysergic acid hydrazide can also be synthesized from an inorganic acid such as nitrous or oxoalkyl. This compound has been used as a pharmaceutical preparation for the treatment of psychotic disorders. Lysergic acid hydrazide has shown to have reactive amide groups that may react with organic amines to form neurotoxic compounds.</p>Formula:C16H18N4OPurity:Min. 95%Molecular weight:282.34 g/molN-(2-Pyridyl)oxamic acid
CAS:<p>N-(2-Pyridyl)oxamic acid is a non-steroidal anti-inflammatory drug that belongs to the group of piroxicam. It was found to be a competitive inhibitor of the reaction between singlet oxygen and certain organic compounds. The reaction rate of N-(2-pyridyl)oxamic acid is dependent on the concentration of solvent, which affects the solvation of the reactants and products. The tautomerization equilibrium constant for N-(2-pyridyl)oxamic acid has been determined as 1.3 × 10 at 25°C in acetonitrile, with an apparent molecular weight of 251.6 g/mol. The singlet oxygen constant (Ks) for this compound is 2.8 × 10 at 25°C in acetonitrile, with a maximum absorbance wavelength at 295 nm and a half life time of 0.27 seconds at 298 K in pure water.</p>Formula:C7H6N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:166.13 g/molN,N-Bis(carboxymethyl)-L-glutamic acid
CAS:<p>N,N-bis(Carboxymethyl)-L-glutamic acid is a synthetic compound that functions as a disinfectant. It has been shown to be effective against bacteria and fungi in vitro, with an efficacy of over 90%. N,N-bis(Carboxymethyl)-L-glutamic acid is used as a treatment for tumors due to its ability to penetrate the tumor cells and inhibit fatty acid uptake. This compound also prevents the formation of new blood vessels by inhibiting the synthesis of DNA and RNA. N,N-bis(Carboxymethyl)-L-glutamic acid can be used in coatings for metals or metal surfaces that are exposed to water or air because it is biodegradable and noncorrosive.</p>Formula:C9H13NO8Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:263.2 g/molMethyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate
CAS:<p>Please enquire for more information about Methyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Glycodehydrocholic acid
CAS:Controlled Product<p>Glycodehydrocholic acid is a bile acid that is synthesized from cholesterol by the liver and intestine. It is used for the diagnosis of cancer and other medical conditions, such as obesity. Glycodehydrocholic acid inhibits the growth of adipose tissue cells, which may be due to its ability to increase the expression of genes related to lipid metabolism. This drug has also been shown to have an inhibitory effect on mitochondria and tumor cells in human serum. Glycodehydrocholic acid can be measured using chromatographic methods with a sample preparation before analysis. This drug can also be detected in urine samples by gas-liquid chromatography or mass spectrometry. The metabolic profiles of women differ from men, so it is important to take this into account when performing analytical chemistry procedures on this compound.</p>Formula:C26H37NO6Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:459.58 g/mol3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid
CAS:<p>3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is a versatile building block for the synthesis of complex compounds. It is used as a reagent to make other chemicals and has been used in the synthesis of research chemicals. 3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is also useful as an intermediate or scaffold compound in organic chemistry. This product has high purity and quality.</p>Formula:C14H16O3Purity:Min. 95%Molecular weight:232.28 g/molIsopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate
CAS:<p>Please enquire for more information about Isopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H16N4O3Purity:Min. 95%Molecular weight:252.27 g/mol5,7-Docosadiynoic acid
CAS:<p>5,7-Docosadiynoic acid is a fluorescent molecule that has been found to have low molecular weight, which makes it ideal for use in a variety of strategies. This compound can be used as a fluorescent probe for the detection of membrane interactions and also has many potential applications in polymerized optical devices. 5,7-Docosadiynoic acid is able to fluoresce when irradiated with light at wavelengths above 500 nm and has been shown to be excited by UV light. The chemical properties of 5,7-docosadiynoic acid make it an excellent candidate for use in sensors and optical devices.</p>Formula:C22H36O2Purity:Min. 95%Molecular weight:332.52 g/molAmylin (free acid) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H260N50O56S2Purity:Min. 95%Molecular weight:3,904.27 g/molD-(-)-3-Phosphoglyceric acid disodium
CAS:<p>D-(-)-3-Phosphoglyceric acid disodium is a homologue of D-glyceric acid and is used in the synthesis of phosphatidylcholine. It binds to the active site of phosphatases and prevents them from hydrolyzing phosphate groups, which are critical for the production of adenosine triphosphate (ATP). The chemical stability and the availability make this compound an excellent candidate for biochemical studies. D-(-)-3-Phosphoglyceric acid disodium has been shown to be essential in biological function, as it functions as a substrate for many metabolic pathways such as glycolysis, gluconeogenesis, pentose phosphate pathway, and fatty acid biosynthesis. The molecule is also involved in a number of biochemical reactions that are catalyzed by enzymes. Mutational studies have shown that organisms without this compound will not survive.</p>Formula:C3H5O7PNa2Purity:Min. 93%Color and Shape:White PowderMolecular weight:230.02 g/moltert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride
CAS:<p>Please enquire for more information about tert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18N2O2Purity:Min. 95%Molecular weight:246.31 g/mol4-Acetamidobenzenesulfonic acid
CAS:<p>4-Acetamidobenzenesulfonic acid (4ABS) is an organic compound that is used as a sulfa drug. It is found in the filtrate of the chemical reaction between inulin and sulfamic acid. 4ABS acts as an amine catalyst for acyl transfer reactions. 4ABS also reacts with chloroethanol to form a primary amino group on a colloidal particle surface. This reaction has been shown to be reversible, where hydrochloric acid can react with 4ABS to form the corresponding sulfamic acid.</p>Formula:C8H9NO3SPurity:Min. 95%Molecular weight:199.23 g/mol2-[(2,3-Dimethylphenyl)amino]nicotinic acid
CAS:<p>2-[(2,3-Dimethylphenyl)amino]nicotinic acid is an arylpropionic acid that has been designed for the treatment of cancer. It is a neutral compound that can be crystallized or sterilized and then injected or implanted into tissues. The compound can be used as a diagnostic tool to target specific tissues in the body by using iontophoresis or organic solvents. 2-[(2,3-Dimethylphenyl)amino]nicotinic acid interacts with chlorine ions to form a chloride derivative, which is then transported through the tissue. This process can be reversed by adding an acid solution to the tissue, which will cause the chloride ions to break down into hydrogen and chloride ions.</p>Formula:C14H14N2O2Purity:Min. 95%Molecular weight:242.27 g/molSodium phenylacetate
CAS:Controlled Product<p>Sodium phenylacetate is a chemical compound that is used as an antifungal agent in vitro. It has also been shown to have anti-proliferative and cytotoxic effects on neuroblastoma cells. The physiological function of sodium phenylacetate is not well understood, but it may act as a neurotransmitter by inhibiting the release of acetylcholine or by regulating cell signaling pathways. Sodium phenylacetate may also inhibit angiogenesis, which would limit the growth of cancerous tumors.</p>Formula:C8H7NaO2Purity:Min. 95%Color and Shape:PowderMolecular weight:158.13 g/mol7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid
CAS:<p>7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid (ABT) is a drug that binds to bacterial enzymes and inhibits their ability to synthesize proteins. ABT is a conjugate of fluoroquinolone and an amino acid. As the drug is degradable by hydrolysis, it has been shown to be less toxic in Sprague Dawley rats than other fluoroquinolones. This drug has been used in diagnostic tests as a ligand for affinity ligands, but has not been approved for human use. The drug also possesses functional groups that are important for binding to reconstituted enzymes.br>br>ABT's ester linkages are degradable by hydrolysis and can be</p>Formula:C20H16F3N3O3Purity:Min. 95%Molecular weight:403.35 g/molC-Type Natriuretic Peptide (32-53) acetate salt
CAS:<p>C-type Natriuretic peptide is a peptide hormone that causes vasodilation, diuresis, and natriuresis. It is secreted by the heart and kidneys in response to volume overload. C-type Natriuretic peptide has been shown to cause fibrosis of the kidney as well as other tissues in mice. The binding of C-type Natriuretic peptide to its receptor activates cyclase, which converts ATP into cAMP. This leads to increased levels of cGMP, which causes smooth muscle relaxation and vasodilation.</p>Formula:C93H157N27O28S3Purity:Min. 95%Molecular weight:2,197.6 g/mol11-Keto fusidic acid
CAS:<p>Fusidic acid is a hydrophilic antibiotic that is structurally related to penicillin. It has a cavity that interacts with γ-cyclodextrin, which can be used for its monitoring and stoichiometry. Fusidic acid has hydroxyl groups that are located on the 7th and 8th positions of the fusidate ring. This antibiotic has been shown to have stability constants in a range of 10-10 M. Fusidic acid also has two electrophoretically distinct forms, depending on the pH of the solution. The form at pH 10 is called fusidane, while the form at pH 5 is called fusidate.</p>Formula:C31H46O6Purity:Min. 95%Molecular weight:514.69 g/mol3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester
CAS:<p>Please enquire for more information about 3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H47NO9Purity:Min. 95%Molecular weight:505.64 g/molN,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide
CAS:<p>N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide is a molecule that has an optimum concentration of 0.5 M. It has a hydrogen bond donor and acceptor and is optically active. This molecule displays fluorescence properties and is inorganic with a chloride acceptor group. N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide has been shown to have high photostability and to be enhanced by light emission from a diode. This molecule also has carbonyl groups that are electron donors for the fluorescence process.</p>Formula:C49H50N6O4Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:786.96 g/molDansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.</p>Formula:C28H32N6O9S·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:742.68 g/molDecanoyl-Arg-Arg-Leu-Leu-chloromethylketone trifluoroacetate salt
CAS:<p>Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt is a prohormone that is biosynthesized from the amino acid decanoic acid. It has been shown to inhibit fatty acid synthesis and mineralization in tissue samples, as well as drug target enzymes such as human pathogens. Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt has also been shown to have insulin resistance properties and may be used for the treatment of metabolic disorders.</p>Formula:C35H67ClN10O5Purity:Min. 95%Molecular weight:743.42 g/mol5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid
CAS:<p>Please enquire for more information about 5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N5O3Purity:Min. 95%Color and Shape:White To Yellow To Dark Red SolidMolecular weight:301.3 g/molEthyl 4-formylpyrrole-2-carboxylate
CAS:<p>Ethyl 4-formylpyrrole-2-carboxylate is a chemical compound that is used as an intermediate in organic synthesis. The compound has been reported to have spectra at m/z (M+1) of 168, 156 and 140. It also has been reported to have yields of about 98% when synthesized from ethyl azidoacetate and ethyl bromoacetate. The mass spectra show the molecular ion peak at m/z of 168, 156 and 140 corresponding to the structure of ethyl 4-formylpyrrole-2-carboxylate. Furan, n-substituted furan, thiophene, acetamide and cyclization are other possible structures for this molecule.</p>Formula:C8H9NO3Purity:Min. 95%Molecular weight:167.16 g/mol2,4-Dihydroxybenzenesulfonic acid
CAS:<p>2,4-Dihydroxybenzenesulfonic acid is a chemical compound that is used as a polymerization catalyst. It is most commonly used in the production of polyoxyethylene and copolymers. The catalytic activity of 2,4-dihydroxybenzenesulfonic acid is due to its acid group and hydroxy groups. This chemical can also be prepared by the reaction of resorcinol and hydrogen peroxide. The fluidity of this compound can be increased by adding an appropriate fluidizing agent such as peroxide or ammonium persulfate.</p>Formula:C6H6O5SPurity:Min. 95%Molecular weight:190.17 g/molLinolenic acid - 85%
CAS:<p>Linolenic acid is a polyunsaturated fatty acid that is found in plants, animals, and human cells. Linolenic acid has been shown to suppress the growth of cancer cells by inhibiting the production of linoleic acid, which can stimulate the growth of cancer cells. Linolenic acid has also been shown to cause skin reactions such as erythema and pruritus when applied topically or taken orally. Linolenic acid may be used for the treatment of ovarian follicles. In addition, linolenic acid has been shown to have an allergic response in humans when it is injected into the vein. It is important to note that linolenic acid can inhibit T-cell proliferation and cytokine production in a dose-dependent manner. Furthermore, linolenic acid inhibits lipopolysaccharide-induced acute lung injury in mice by reducing inflammatory cell infiltration and neutrophil activation.</p>Formula:C18H30O2Purity:Min. 95%Molecular weight:278.43 g/molCromoglicic acid D5
CAS:<p>Please enquire for more information about Cromoglicic acid D5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6D5BrPurity:Min. 95%Color and Shape:PowderMolecular weight:473.40 g/molMethyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate
CAS:<p>Please enquire for more information about Methyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H9N3O4Purity:Min. 95%Molecular weight:271.23 g/molIsatin-5-sulfonic acid sodium salt dihydrate
CAS:<p>Isatin-5-sulfonic acid sodium salt dihydrate is a potent inhibitor of caspases. It has been shown to inhibit the activity of caspase-3 in vitro, thereby inhibiting apoptosis. Isatin-5-sulfonic acid sodium salt dihydrate has also been shown to increase survival rates in animal models of neurodegenerative diseases such as Parkinson's disease and Huntington's disease. Isatin-5-sulfonic acid sodium salt dihydrate may have neuroprotective effects by inhibiting the release of proinflammatory cytokines and nitric oxide, which are associated with neuronal death. This drug also inhibits monoamine oxidase A (MAO-A) and zymosterone B (ZVAD).</p>Formula:C8H4NNaO5S·2H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:285.21 g/molKermesic acid
CAS:<p>Kermesic acid is a hydroxybenzoic acid that is used as a food dye. It can be found in some red wines and it is also used to color the eggs of a particular breed of chicken. The most common use for kermesic acid is as an oxidizing agent in a chromatographic method, which separates molecules based on their size. The oxidation catalyst used can vary, but often trifluoroacetic acid (TFA) is used. TFA reacts with the kermesic acid to form an octaketide, which has the chemical formula C8H6O3. This octaketide then reacts with another molecule of TFA to form two esters.</p>Formula:C16H10O8Purity:Min. 95%Molecular weight:330.25 g/molDomoic acid
CAS:<p>Domoic acid is a neurotoxin that has been shown to induce neuronal death in vitro and in vivo. Domoic acid inhibits the activity of ligand-gated ion channels, which increases the cytosolic Ca2+ concentration. This toxin also induces mitochondrial membrane potential loss, causing apoptosis. Domoic acid binds to the NMDA receptor and blocks glutamate binding. It also inhibits ATP synthase by competing with ADP for binding sites on the enzyme's F1 portion. Domoic acid has low potency as a neurotoxin because it does not readily cross the blood-brain barrier or enter cells via passive diffusion.</p>Formula:C15H21NO6Purity:Min. 90 Area-%Color and Shape:Beige PowderMolecular weight:311.33 g/mol2-Chlorobutyric Acid
CAS:Formula:C4H7ClO2Purity:>90.0%(GC)Color and Shape:Colorless to Light orange to Yellow clear liquidMolecular weight:122.554-Bromo-2-methylbenzoic Acid
CAS:Formula:C8H7BrO2Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:215.052-(4-Hydroxyphenyl)propionic Acid
CAS:Formula:C9H10O3Purity:>98.0%(T)(HPLC)Color and Shape:White to Light yellow to Light red powder to crystalMolecular weight:166.18cis-4-(tert-Butoxycarbonylamino)cyclohexanecarboxylic Acid
CAS:Formula:C12H21NO4Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:243.30tert-Butyl Hydrogen Tetradecanedioate
CAS:Formula:C18H34O4Purity:>95.0%(GC)(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:314.47(Ethylenedithio)diacetic Acid
CAS:Formula:C6H10O4S2Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:210.263,3-Dimethyl-2-oxobutyric Acid
CAS:Formula:C6H10O3Purity:>98.0%(T)Color and Shape:White or Colorless to Almost white or Almost colorless powder to lump to clear liquidMolecular weight:130.143,4-Dihydroxyhydrocinnamic Acid
CAS:Formula:C9H10O4Purity:>98.0%(GC)(T)Color and Shape:White to Brown powder to crystalMolecular weight:182.183-(4-Carboxyphenyl)propionic Acid
CAS:Formula:C10H10O4Purity:>98.0%(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:194.1916-Hydroxyhexadecanoic Acid
CAS:Formula:C16H32O3Purity:>98.0%(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:272.433-Iodo-4-methoxybenzoic Acid
CAS:Formula:C8H7IO3Purity:>97.0%(GC)(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:278.05Hydantoin-5-acetic acid, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C5H6N2O4Purity:98%Color and Shape:Crystalline powder, WhiteMolecular weight:158.11Cycloheptylacetic acid, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C9H16O2Purity:99%Color and Shape:Clear colorless, LiquidMolecular weight:156.23Dehydroacetic acid, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C8H8O4Purity:98%Color and Shape:Powder, White to cream or pale yellowMolecular weight:168.15o-Cresolphthalein complexone, indicator grade
CAS:<p>Indicator for complexometric titration of Mg, Ca, Sr and Ba. It is used as an alkaline earth metal ion indicator. Suggested to be colorless at pH 11, but turns pink in the presence of alkaline earth metals. Also utilized in an auto analyzer to determine serum calcium. This Thermo Scientific Chemical</p>Formula:C32H32N2O12Color and Shape:White to cream, PowderMolecular weight:636.61Cyclopentanecarboxylic acid, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H10O2Purity:99%Color and Shape:Liquid, Clear colorless to pale yellowMolecular weight:114.14Ammonium acetate, 97%
CAS:<p>Ammonium acetate is widely utilized as a catalyst in the Knoevenagel condensation. It is the primary source of ammonia in the Borch reaction in organic synthesis. It is used with distilled water to make a protein precipitating reagent. It acts as a buffer for electrospray ionization (ESI) mass spect</p>Formula:C2H7NO2Purity:97%Color and Shape:Crystals or powder or crystalline powder, WhiteMolecular weight:77.08Ref: 02-A16343
Discontinued product3-Nitrophthalimide, 98%
CAS:<p>3-Nitrophthalimide is a useful dye for biological research purposes. It is a nitro heterocyclic compounds found to exhibit potential antifungal activities. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label informatio</p>Formula:C8H4N2O4Purity:98%Color and Shape:Pale yellow to yellow, Crystals or powder or crystalline powderMolecular weight:192.131-Cyclohexene-1-carboxylic acid, 97%
CAS:<p>1-Cyclohexene-1-carboxylic acid is an intermediate in benzoic acid anaerobic decomposition by methanogenic consortium. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The o</p>Formula:C7H10O2Purity:97%Color and Shape:Powder or crystalline powder or fused solid or clear liquid as melt, Colorless or white to pale cream or pale yellowMolecular weight:126.16N-(4-Bromobutyl)phthalimide, 96%
CAS:<p>N-(4-Bromobutyl)phthalimide is used in organic synthesis and the production of pharmaceutical. It can react with 1-phenyl-piperazine to get N-[4-(4-phenyl-piperazin-1-yl)-butyl]-phthalimide. It is a useful synthesis reagent used to synthesize B-cyclodextrin derivatives. This Thermo Scientific Chemic</p>Formula:C12H12BrNO2Purity:96%Color and Shape:White to cream, PowderMolecular weight:282.14Tricarballylic acid, 98%
CAS:<p>It is used as an alternative to DMDHEU (formaldehyde releasing cross- linking agent). This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item</p>Formula:C6H8O6Purity:98%Color and Shape:White to cream to pale brown, Crystals or powder or crystalline powderMolecular weight:176.121-Methylindazole-3-carboxylic acid, 97%
CAS:<p>1-Methylindazole-3-carboxylic acid is used as important raw material and intermediate used in organic Synthesis, pharmaceuticals, agrochemicals and dyestuff. It is also used as a pharmaceutical adjuvant, Granisetron Impurity D. This Thermo Scientific Chemicals brand product was originally part of th</p>Formula:C9H8N2O2Purity:97%Color and Shape:Powder, White to creamMolecular weight:176.18Ethyl trimethylacetate, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C7H14O2Purity:99%Color and Shape:Clear colorless, LiquidMolecular weight:130.191-Naphthylacetic acid, 95%, may cont. up to 5% 2-isomer
CAS:<p>1-Naphthylacetic acid is used as a plant growth regulator and for plant tissue culture. It is used for the vegetative propagation of plants from stem and leaf cutting, abscission promoter and substrate for auxin inducers of specific plant enzymes. Further, it stimulates root formation in cuttings of</p>Formula:C12H10O2Purity:95%Color and Shape:White to cream to yellow or pale brown, Crystalline powder or powderMolecular weight:186.21Sodium DL-lactate, 60% w/w aq. soln.
CAS:<p>Useful chiral synthon; building block for depsipeptides</p>Formula:C3H5NaO3Purity:60%Molecular weight:112.06Methyl 1-methylpyrrole-2-carboxylate, 99%
CAS:<p>Methyl 1-methylpyrrole-2-carboxylate is used as chemical and organic Intermediates. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item c</p>Formula:C7H9NO2Purity:99%Color and Shape:Clear colorless to yellow to orange, LiquidMolecular weight:139.15Adipic dihydrazide, 97%
CAS:<p>Adipic dihydrazide is used as a formaldehyde scavenger and reacts with formaldehyde, thereby preventing the volatilizing of formaldehyde in the air. It is also employed as a paint additive and coating additive. It is also used as an intermediate. Further, it is used for cross-linking water-based emu</p>Formula:C6H14N4O2Purity:97%Color and Shape:White to pale cream or pale yellow, Powder or crystalline powderMolecular weight:174.20Strontium oxalate, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C2O4SrPurity:95%Color and Shape:White, Powder or lumpMolecular weight:175.64Methyl cyclopentanecarboxylate, 97%
CAS:<p>Methyl cyclopentanecarboxylate This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the</p>Formula:C7H12O2Purity:97%Color and Shape:Clear colorless to pale yellow, LiquidMolecular weight:128.17Methyl chlorodifluoroacetate, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C3H3ClF2O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:144.50N-(2-Hydroxyethyl)succinimide, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H9NO3Purity:95%Color and Shape:White to cream to pale yellow, Crystals or powder or crystalline powder or lumps or fused solidMolecular weight:143.14Dimethyl fumarate, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H8O4Purity:99%Color and Shape:Crystals or crystalline powder or flakes, White to cream to pale brownMolecular weight:144.135-Hexenyl acetate, 97%
CAS:<p>(4E,7Z)-4,7-Tridecadienyl acetate,a component of the sex pheromone was synthesized from 5-hexenyl acetate. CM of 5-decene with 5-hexenyl acetate is used to produce the insect pheromone. Used in olefin cross metathesis. This Thermo Scientific Chemicals brand product was originally part of the Alfa Ae</p>Formula:C8H14O2Purity:97%Color and Shape:LiquidMolecular weight:142.24-(Methoxycarbonyl)cyclohexane-1-carboxylic acid, 97%
CAS:<p>4-(Methoxycarbonyl)cyclohexane-1-carboxylic acid is used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / i</p>Formula:C9H14O4Purity:97%Molecular weight:186.21n-Butylidenephthalide, (E)+(Z), 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C12H12O2Purity:95%Color and Shape:Clear, yellow, LiquidMolecular weight:188.23N-(4-Pentynyl)phthalimide, 97%
CAS:<p>N-(4-Pentynyl)phthalimide is used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU referen</p>Formula:C13H11NO2Purity:97%Color and Shape:White to yellow to pale brown, PowderMolecular weight:213.243-(3-Fluorophenyl)propionic acid, 97%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C9H9FO2Purity:97%Color and Shape:White to cream or pale yellow, Crystals or powder or crystalline powderMolecular weight:168.17


