
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12454 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C225H342N60O66SPurity:Min. 95%Molecular weight:4,975.55 g/molHexanedioic acid
CAS:<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>Formula:C6H10O4Color and Shape:White Off-White PowderMolecular weight:146.14 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H218N42O47SPurity:Min. 95%Molecular weight:3,381.65 g/molHIV (gp120) Antigenic Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H211N41O31SPurity:Min. 95%Molecular weight:2,720.25 g/molAmyloid beta-Protein (16-20) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>Formula:C35H52N6O6Purity:Min. 95%Molecular weight:652.82 g/molCathelicidin LL 37
CAS:<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>Formula:C205H340N60O53Purity:Min. 95%Molecular weight:4,493.27 g/mol3,4,9,10-Perylenetetracarboxylic diimide
CAS:<p>3,4,9,10-Perylenetetracarboxylic diimide is a model system for studying the mechanism of protonated pyridine. It is a bicyclic heterocycle that contains two phenyl rings and one imide group. The nitrogen atoms in the molecule form hydrogen bonds with other molecules and can be substituted with chlorine or bromine. 3,4,9,10-Perylenetetracarboxylic diimide has been shown to have chemical stability under conditions of hydrochloric acid and heat. This compound also has a high melting point and is not soluble in water. 3,4,9,10-Perylenetetracarboxylic diimide has been used to study the reaction mechanisms of chemical reactions involving light emission. This compound absorbs light at wavelengths longer than 400 nm (e.g., ultraviolet) and emits light at wavelengths shorter than 400 nm (e.g.,</p>Formula:C24H10N2O4Color and Shape:PowderMolecular weight:390.35 g/molMethyl 3-chlorophenylacetate
CAS:<p>Methyl 3-chlorophenylacetate is a chemical intermediate that has been used in the synthesis of pharmaceuticals and organic compounds. It has also been used as a reagent for research, especially in the study of organic chemistry. Methyl 3-chlorophenylacetate is a versatile building block and can be used as a reaction component to synthesize other chemicals. This compound is also an excellent scaffold for medicinal chemistry.</p>Formula:C9H9ClO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:184.62 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>Formula:C75H110N24O16S2Purity:Min. 95%Molecular weight:1,667.96 g/mol(Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C58H69ClN12O9S2Purity:Min. 95%Molecular weight:1,177.83 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H51N11O7•C2HF3O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:839.86 g/mol2-Bromo-3-methylbenzoic acid
CAS:<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>Formula:C8H7BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:215.04 g/mol3-Methylsalicylic acid
CAS:<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>Formula:C8H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:152.15 g/molBis-ACV trifluoroacetate salt
CAS:<p>Bis-ACV trifluoroacetate salt is a regulatory compound that belongs to the class of bis-acids. It is a cytosolic calcium ionophore that binds to the cytosolic calcium ion channel and regulates its activity. Bis-ACV trifluoroacetate salt also has nucleophilic attack on phosphate groups, which are essential for biosynthesis. The enzyme activity of this compound has been studied in various strains of bacteria such as E. coli and S. cerevisiae, and it was found to be involved in the synthesis of oligosaccharides and polysaccharides. This compound can be solubilized by the addition of sodium bicarbonate or urea, which facilitates its use in synthetic reactions. The synthase gene for this compound has been identified from various strains of bacteria such as E. coli and S. cerevisiae, but not from mammalian cells or plants.</p>Formula:C28H48N6O12S2Purity:Min. 95%Molecular weight:724.85 g/mol4,4',4''-Nitrilotribenzoic acid
CAS:<p>4,4',4''-Nitrilotribenzoic acid is a low molecular weight activated compound with a hexane molecule and luminescence properties. This compound has been used in the detection of human pathogens, for example, Salmonella enterica serovar Typhimurium. The uptake of 4,4',4''-nitrilotribenzoic acid by these bacteria has been shown to be due to its peroxidase-like activity. 4,4',4''-Nitrilotribenzoic acid has also been used for the activation of polybenzimidazole and for polymerization reactions in polybenzimidazole films. The time required for polymerization depends on the concentration of 4,4',4''-nitrilotribenzoic acid used.</p>Formula:C21H15NO6Purity:Min. 95%Molecular weight:377.35 g/molBromofluoroacetic Acid
CAS:<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>Formula:C2H2BrFO2Purity:Min. 95%Molecular weight:156.94 g/mol2-Amino-a-(methoxyimino)-4-thiazoleacetic acid
CAS:<p>2-Amino-a-(methoxyimino)-4-thiazoleacetic acid is a reaction product of cefotaxime and n-dimethyl formamide. It has been shown to be an effective agent for the treatment of wastewater with a high organic content. 2-Amino-a-(methoxyimino)-4-thiazoleacetic acid also reacts with chloride ions to form cleavage products that are soluble in water, making it an ideal choice for wastewater treatment. This compound is not toxic and can be used as a drug to treat patients with infections caused by bacteria resistant to other antibiotics. 2-Amino-a-(methoxyimino)-4-thiazoleacetic acid binds to mismatched base pairs in DNA, inhibiting DNA synthesis and causing cell death by apoptosis.</p>Formula:C6H7N3O3SPurity:Min. 95%Molecular weight:201.2 g/moltrans-4-[(2,5-Dihydro-2,5-dioxo-1H-pyrrol-1-yl)methyl]cyclohexanecarboxylic acid
CAS:<p>4-Maleimidomethylcyclohexanecaroboxylic acid (4MAMC) is a bifunctional molecule that is conjugated to a polymer, which has the ability to bind with cellular antigens and target tissue. It is used in clinical chemistry because it can be detected at low concentrations. 4MAMC has been shown to reduce cirrhosis caused by chronic liver injury. 4MAMC also increases the uptake of coagulation factors and decreases the expression of prothrombin, which leads to an increase in clotting time. The localization of 4MAMC is determined by the type of polymer conjugate it is bound with; for example, when it binds with human serum albumin, it localizes on the surface of cells.</p>Formula:C12H15NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:237.25 g/molMethyl benzofuran-6-carboxylate
CAS:<p>Methyl benzofuran-6-carboxylate is a synthetic retinoid that is a conformationally constrained analogue of retinoic acid, which is one of the most powerful biological molecules. Methyl benzofuran-6-carboxylate has been shown to be an effective anti-inflammatory agent and may be useful in the treatment of inflammatory skin diseases. It also inhibits the production of proinflammatory cytokines and chemokines, such as TNF-α, IL-1β, IL-8, CCL2, CXCL1, and CXCL2. Methyl benzofuran-6-carboxylate binds to specific receptors on cell surfaces to inhibit the production of inflammatory mediators. The drug also has been shown to have antiangiogenic activity. This property may be due to its ability to inhibit the production of vascular endothelial growth factor (VEGF) and other angiogenic factors.</p>Formula:C10H8O3Purity:Min. 95%Molecular weight:176.17 g/mol(Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H203N37O30SPurity:Min. 95%Molecular weight:2,796.3 g/molAmyloid beta-Protein (1-16) trifluoroacetate salt
CAS:<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Formula:C84H119N27O28Purity:Min. 95%Molecular weight:1,955.01 g/molTLQP-21 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N40O26Purity:Min. 95%Molecular weight:2,432.75 g/molNuclear Factor NF-KB Inhibitor SN50 trifluoroacetate salt
CAS:<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>Formula:C129H230N36O29SPurity:Min. 95%Molecular weight:2,781.5 g/molBiotinyl-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H305N57O53S3Purity:Min. 95%Molecular weight:4,344.02 g/molH-Gly-His-Arg-Pro-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N10O4Purity:Min. 95%Molecular weight:464.52 g/molBNP-32 (rat) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C146H239N47O44S3Purity:Min. 95%Molecular weight:3,452.95 g/molLHRH (4-10) acetate salt
CAS:<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H53N11O9Purity:Min. 95%Molecular weight:747.84 g/mol(Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H297N55O56SPurity:Min. 95%Molecular weight:4,327.84 g/molAbz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H58N12O16Purity:Min. 95%Molecular weight:986.98 g/mol(Ala13)-Apelin-13 (human, bovine, mouse, rat) acetate salt
CAS:<p>Apelin-13 is a peptide hormone that is secreted from the stomach and small intestine. It may have analgesic effects through its interaction with μ-opioid receptors, which are also activated by morphine. Apelin-13 has been shown to increase locomotor activity in rats, suggesting it can potentiate the antinociceptive effect of morphine.</p>Formula:C63H107N23O16S·xC2H4O2Purity:Min. 95%Molecular weight:1,474.74 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/mol(3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid
CAS:<p>Please enquire for more information about (3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19F2NO4Purity:Min. 95%Molecular weight:315.31 g/molpTH (2-38) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H314N58O53S2Purity:Min. 95%Molecular weight:4,371.06 g/molIL-1beta (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formula:C39H64N12O19Purity:Min. 95%Molecular weight:1,004.99 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/molMca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H105N19O19SPurity:Min. 95%Molecular weight:1,656.86 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formula:C65H118N18O15Purity:Min. 95%Molecular weight:1,391.74 g/mol5-Formyltetrahydropteroic acid
CAS:<p>5-Formyltetrahydropteroic acid is a labile, water soluble compound that can be used as a chromatographic standard. It has been used to determine the purity of water by measuring the concentration of this impurity in the sample. 5-Formyl tetrahydropterin has been shown to inhibit tumor growth and induce apoptosis in cancer cells. This compound also inhibits protein synthesis in cells by inhibiting ribosomal RNA processing and decreasing the rate of protein synthesis. 5-Formyltetrahydropteroic acid is also used to prevent bone marrow from producing red blood cells when given with leucovorin, which prevents the breakdown of bone marrow cells caused by radiation therapy or chemotherapy.</p>Formula:C15H16N6O4Purity:Min. 95%Molecular weight:344.33 g/molAc-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt
CAS:<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>Formula:C21H31ClN4O11Purity:Min. 95%Molecular weight:550.94 g/moluPAR (84-95) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H98N18O20SPurity:Min. 95%Molecular weight:1,447.62 g/mol2,5-Anhydro-3,4-dideoxy-erythro-hexaric acid - 98%
CAS:The synthesis of 2,5-anhydro-3,4-dideoxy-erythro-hexaric acid (2,5AHDHE) is described in detail. The reaction starts with the condensation of 3,4-dideoxy-erythro-hexose with aldehyde and furfural to give the hemiacetal. The ring opening of this hemiacetal leads to the formation of 2,5AHDHE and furfural. The protonation of 2,5AHDHE leads to proton release and bond cleavage. Furfural is reduced to 5-hydroxymethylfurfural (HMF). HMF is then oxidized to hydroxyl group by H2O2. The hydroxyl group reacts with a second molecule of 2,5AHDHE to form a new molecule of 2,5AHDHE and H2O2. This process can be repeated untilFormula:C6H8O5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:160.12 g/molZ-Ala-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N10O6Purity:Min. 95%Molecular weight:690.79 g/molBiphalin trifluoroacetate salt (
CAS:<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>Formula:C46H56N10O10Purity:Min. 95%Molecular weight:909 g/mol3-Chlorophenyl acetic acid
CAS:<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>Formula:C8H7ClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:170.59 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/molMet-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H47N9O8SPurity:Min. 95%Molecular weight:729.85 g/molSplenopentin acetate salt
CAS:<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>Formula:C31H51N9O9Purity:Min. 95%Molecular weight:693.79 g/mol2-Hydroxysuccinic acid methyl ester
CAS:<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>Formula:C5H8O5Purity:90% MinMolecular weight:148.11 g/mol(Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H203N39O28SPurity:Min. 95%Molecular weight:2,804.33 g/mol2-Bromoethanesulfonic acid sodium
CAS:<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>Formula:C2H4BrNaO3SPurity:Min. 95%Molecular weight:211.01 g/mol(Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molpp60 c-src (521-533) (phosphorylated) trifluoroacetate salt
CAS:<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N16O28PPurity:Min. 95%Molecular weight:1,543.48 g/molHCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H99N15O14SPurity:Min. 95%Molecular weight:1,214.52 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/mol2-Hydroxy-4-(methylthio)butyric acid calcium salt
CAS:<p>2-Hydroxy-4-(methylthio)butyric acid calcium salt (2HMBAC) is a fatty acid that is found in malic acid. It is an important industrial chemical used for the preparation of other chemicals such as acetic anhydride, adipic acid, and butyric acid. 2HMBAC has been shown to have various biological functions including the inhibition of protein synthesis and the reduction of chloride ion transport. The dietary administration of 2HMBAC has been shown to relieve diarrhoea in rats.</p>Formula:C10H18CaO6S2Purity:Min. 95%Molecular weight:338.46 g/molFormyl-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H70N16O12Purity:Min. 95%Molecular weight:1,099.2 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.Formula:C34H41N3O6Purity:Min. 95%Molecular weight:587.71 g/molL-Glutamic acid alpha-amide
CAS:<p>L-Glutamic acid alpha-amide is an ester hydrochloride that is a tissue culture amide. It is a cyclic peptide analog and a hydroxyl group. L-glutamic acid alpha-amide has been shown to inhibit the inflammatory response in the bowel disease, Crohn's disease, by blocking the toll-like receptor 4 and 5. This drug also inhibits protein synthesis, which may be due to its ability to bind to fatty acids, thereby inhibiting the production of proteins vital for cell division.</p>Formula:C5H10N2O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:146.14 g/mol(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H244N48O40S2Purity:Min. 95%Molecular weight:3,496.04 g/molExtracellular Death Factor trifluoroacetate salt
CAS:<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>Formula:C27H36N10O10Purity:Min. 95%Molecular weight:660.64 g/mol(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate
CAS:Controlled Product<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>Formula:C21H33N5O5Purity:Min. 95%Molecular weight:435.52 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate
CAS:Controlled Product<p>Please enquire for more information about (2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H17NO2•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:285.26 g/mol3-Methylbutanoic acid
CAS:3-Methylbutanoic acid is an antimicrobial agent that belongs to the group of isovaleric acids. It is a product of β-oxidation and has been shown to inhibit the growth of bacteria by reacting with their surface. 3-Methylbutanoic acid inhibits bacterial growth by binding to the pyrazole ring in DNA and altering its conformation, preventing DNA replication. This reaction occurs at a rate comparable to that of other fluoroquinolones, such as ciprofloxacin, levofloxacin, and norfloxacin. 3-Methylbutanoic acid has been shown to have antibacterial activity against both Gram-positive and Gram-negative bacteria, particularly those that are resistant to erythromycin or lincomycin.Formula:C5H10O2Purity:Min. 95%Color and Shape:PowderMolecular weight:102.13 g/molAngiotensin II acetate salt
CAS:Controlled Product<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>Formula:C50H71N13O12·xC2H4O2Purity:Min. 95%Color and Shape:White SolidMolecular weight:1,046.18 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H116N20O19SPurity:Min. 95%Molecular weight:1,657.93 g/molWRW4
CAS:<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H65N15O6Purity:Min. 95%Molecular weight:1,104.27 g/molH-Lys-Gly-Asp-Ser-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Asp-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H27N5O8Purity:Min. 95%Molecular weight:405.4 g/mol(R)-(-)-3-Amino-3-phenylpropionic acid
CAS:<p>(R)-(-)-3-Amino-3-phenylpropionic acid is a hydrogenated, stereoselective β-amino acid that is involved in the biosynthesis of animal health. The enzyme acylase catalyzes this reaction by binding with chiral pyridoxal phosphate to form an acylation product. The stereospecificity of the reaction is determined by whether the enzyme has a preference for L or D amino acids. Acylases are found in organisms such as mammals and bacteria.</p>Formula:C9H11NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:165.19 g/molCyclopenten-1-ylboronic acid
CAS:<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>Formula:C5H9BO2Purity:Min. 95%Molecular weight:111.93 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/mol4-Pyridinylboronic acid
CAS:<p>4-Pyridinylboronic acid is a boron compound that contains two nitrogen atoms. It is an important reagent in organic synthesis and crystallography. 4-Pyridinylboronic acid has been shown to have biological properties, such as hydrogen bonding interactions. It is also used in the suzuki coupling reaction and the photochemical properties of the reaction solution are dependent on its coordination geometry. 4-pyridinylboronic acid has a high pH value, so it must be prepared in anhydrous sodium carbonate before use. The hydrogen bond between 4-pyridinylboronic acid and an azide is shown below: Nnowiki>/nowiki>Hnowiki>/nowiki>nowiki>/nowiki>Nnowiki>/nowiki>nowiki>/nowiki>H</p>Formula:C5H6BNO2Color and Shape:PowderMolecular weight:122.92 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS:Trifluoroacetate saltFormula:C121H168N26O33S4Purity:Min. 95%Molecular weight:2,643.05 g/molMca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molPACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H300N56O45SPurity:Min. 95%Molecular weight:4,024.75 g/molMca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H88N14O27Purity:Min. 95%Molecular weight:1,533.5 g/mol4-(Bromomethyl)phenylacetic acid
CAS:<p>4-(Bromomethyl)phenylacetic acid is a potent cancer drug that blocks the activity of hydrogen-bonding interactions. It inhibits the growth of prostate cancer cells, DU145 cells, and other cell lines. The drug has been shown to inhibit the activation of toll-like receptor 4 (TLR4) in primary blood cells from healthy donors. TLR4 is a protein found on the surface of immune cells that senses molecules from bacteria, fungi, parasites, and viruses. This protein plays an important role in triggering anti-inflammatory and pro-inflammatory responses to infection. The drug also inhibits platelet aggregation and lipoprotein lipase activity in vitro.</p>Formula:C9H9BrO2Purity:Min. 95%Color and Shape:SolidMolecular weight:229.07 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molPancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Pancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H287N55O53SPurity:Min. 95%Molecular weight:4,209.71 g/molNociceptin (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H100N22O15Purity:Min. 95%Molecular weight:1,381.59 g/mol([ring-D5]Phe3)-Octreotide acetate salt
CAS:Controlled Product<p>Please enquire for more information about ([ring-D5]Phe3)-Octreotide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H61D5N10O10S2Purity:Min. 95%Molecular weight:1,024.27 g/mol16-Hydroxyhexadecanoic acid
CAS:<p>16-Hydroxyhexadecanoic acid is a fatty acid that contains 16 carbons and 2 hydroxyl groups. It can be found in rat liver microsomes, where it binds to the cytochrome P450 enzyme, inhibiting its activity. The structural analysis of this compound has been shown to have intermolecular hydrogen bonding between the nitrogen atoms and the oxygen atoms in the hydroxyl group. 16-Hydroxyhexadecanoic acid also exhibits phase transition temperatures, which are increased by adding water molecules. This compound also has an inhibitory effect on recombinant cytochrome P450 enzymes from p. pastoris and can be used as a substrate for methyl myristate metabolism. In addition, 16-hydroxyhexadecanoic acid binds to dinucleotide phosphate (NADPH) and fluoresces when excited at 340 nm using a fluorescence detector.</p>Formula:C16H32O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:272.42 g/molAlpha-Casein (90-96) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H64N10O12Purity:Min. 95%Molecular weight:913.03 g/mol(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H77N17O11Purity:Min. 95%Molecular weight:1,200.35 g/molDnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H94N22O21Purity:Min. 95%Molecular weight:1,423.49 g/molRetrocyclin-1 trifluoroacetate salt
CAS:<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molH-Val-Ala-pNA acetate salt
CAS:<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molC-Peptide (human) trifluoroacetate salt
CAS:<p>C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molCART (61-102) (human, rat) trifluoroacetate salt
CAS:Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C189H310N58O56S7Purity:Min. 95%Molecular weight:4,515.3 g/molOxalic acid dihydrate
CAS:<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br>br> Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>Formula:C2H2O4•(H2O)2Purity:Min. 95%Molecular weight:126.07 g/mol4-Difluoromethoxyphenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-Difluoromethoxyphenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H17BF2O3Purity:Min. 95%Molecular weight:270.08 g/mol3-Amino-4-methyl-thiophen-2-carboxylic acid methyl ester
CAS:<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>Purity:Min. 95%Molecular weight:171.22 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/molC-Type Natriuretic Peptide (1-53) (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C251H417N81O71S3Purity:Min. 95%Molecular weight:5,801.7 g/molGalanin-Like Peptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C292H451N83O84SPurity:Min. 95%Molecular weight:6,500.28 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/mol3-[(2-Aminoethyl)dithio]propionic acid
CAS:<p>Dithiobis(3-mercaptopropionate) is an analog of 3-[(2-Aminoethyl)dithio]propionic acid (DTA). It has been used as a cross-linking agent for the synthesis of polymers with acidic pH. Dithiobis(3-mercaptopropionate) is also used for the synthesis of conjugates and bifunctional molecules. Dithiobis(3-mercaptopropionate) can be synthesized by reacting bis(sulfanylmethyl)amine with sodium azide in an acidic solution. The cross-linking reaction will produce a disulfide bond, which is a covalent linkage between two cysteine residues in two different polypeptides or proteins. This crosslink is irreversible, so it cannot be broken down by chemical processes, but can be broken down by enzymatic digestion.</p>Formula:C5H11NO2S2Purity:(%) Min. 95%Color and Shape:PowderMolecular weight:181.28 g/molH-Arg-Met-OH acetate salt
CAS:<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/mol5-Ethylpyridine-2-carboxylic acid
CAS:<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:Off-White PowderMolecular weight:151.16 g/molMethyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate
CAS:<p>Please enquire for more information about Methyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%5,7-Docosadiynoic acid
CAS:<p>5,7-Docosadiynoic acid is a fluorescent molecule that has been found to have low molecular weight, which makes it ideal for use in a variety of strategies. This compound can be used as a fluorescent probe for the detection of membrane interactions and also has many potential applications in polymerized optical devices. 5,7-Docosadiynoic acid is able to fluoresce when irradiated with light at wavelengths above 500 nm and has been shown to be excited by UV light. The chemical properties of 5,7-docosadiynoic acid make it an excellent candidate for use in sensors and optical devices.</p>Formula:C22H36O2Purity:Min. 95%Molecular weight:332.52 g/molGlycodehydrocholic acid
CAS:Controlled Product<p>Glycodehydrocholic acid is a bile acid that is synthesized from cholesterol by the liver and intestine. It is used for the diagnosis of cancer and other medical conditions, such as obesity. Glycodehydrocholic acid inhibits the growth of adipose tissue cells, which may be due to its ability to increase the expression of genes related to lipid metabolism. This drug has also been shown to have an inhibitory effect on mitochondria and tumor cells in human serum. Glycodehydrocholic acid can be measured using chromatographic methods with a sample preparation before analysis. This drug can also be detected in urine samples by gas-liquid chromatography or mass spectrometry. The metabolic profiles of women differ from men, so it is important to take this into account when performing analytical chemistry procedures on this compound.</p>Formula:C26H37NO6Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:459.58 g/molAmylin (free acid) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H260N50O56S2Purity:Min. 95%Molecular weight:3,904.27 g/moltert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate
CAS:<p>tert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate is a chiral compound that contains two stereogenic centers. It is a racemate of enantiomers. The enantiomeric purity can be determined by the preparative method. This compound is soluble in water and is stable in neutral or acidic conditions. It has been shown to act as an α-amino acid and to inhibit glycine uptake by neurons.</p>Formula:C21H23NO4Purity:Min. 95%Color and Shape:SolidMolecular weight:353.41 g/molAngiotensin A (1-7) trifluoroacetate
CAS:<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molLHRH (1-5) (free acid) trifluoroacetate salt
CAS:<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>Formula:C34H38N8O9Purity:Min. 95%Color and Shape:PowderMolecular weight:702.71 g/mol3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid
CAS:<p>3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is a versatile building block for the synthesis of complex compounds. It is used as a reagent to make other chemicals and has been used in the synthesis of research chemicals. 3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is also useful as an intermediate or scaffold compound in organic chemistry. This product has high purity and quality.</p>Formula:C14H16O3Purity:Min. 95%Molecular weight:232.28 g/mol2-Bromopropionic acid benzyl ester
CAS:<p>2-Bromopropionic acid benzyl ester is a synthetic compound with a molecular weight of 220.24 g/mol. It is soluble in organic solvents and has a hydroxyl group at its alpha position. 2-Bromopropionic acid benzyl ester is used in the synthesis of beta-cyclodextrin, which is an important biomaterial for drug delivery as well as other applications. 2-Bromopropionic acid benzyl ester also has antioxidant properties and can be used to treat leukemia cells by inhibiting the production of reactive oxygen species (ROS).</p>Formula:C10H11BrO2Purity:Min. 95%Molecular weight:243.1 g/molN,N-Bis(carboxymethyl)-L-glutamic acid
CAS:<p>N,N-bis(Carboxymethyl)-L-glutamic acid is a synthetic compound that functions as a disinfectant. It has been shown to be effective against bacteria and fungi in vitro, with an efficacy of over 90%. N,N-bis(Carboxymethyl)-L-glutamic acid is used as a treatment for tumors due to its ability to penetrate the tumor cells and inhibit fatty acid uptake. This compound also prevents the formation of new blood vessels by inhibiting the synthesis of DNA and RNA. N,N-bis(Carboxymethyl)-L-glutamic acid can be used in coatings for metals or metal surfaces that are exposed to water or air because it is biodegradable and noncorrosive.</p>Formula:C9H13NO8Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:263.2 g/molIsopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate
CAS:<p>Please enquire for more information about Isopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H16N4O3Purity:Min. 95%Molecular weight:252.27 g/mol1-Adamantylphosphonic acid
CAS:<p>1-Adamantylphosphonic acid (1APA) is a trifluoroacetic acid derivative that is used as an organic solvent. It is also a catalyst in organic chemistry. 1APA can be used to catalyze the carbonylation of olefins with phosphines, which are ligands that bind to metal compounds and facilitate chemical reactions. Ferrocene, adamantyl, and metallocene are all examples of ligands. 1APA is also used as a reagent in the synthesis of phosphine ligands, which are used in catalytic reactions.</p>Formula:C10H17O3PPurity:Min. 95%Molecular weight:216.21 g/molLysergic acid hydrazide
CAS:Controlled Product<p>Lysergic acid hydrazide is a synthetic drug with an active form of lysergic acid. It is used in the synthesis of ergocryptine and other drugs. The compound can be synthesized using methyl alcohol, trifluoromethyl group, hydroxy group, skeleton, and C1-4 alkyl as reactants. Lysergic acid hydrazide can also be synthesized from an inorganic acid such as nitrous or oxoalkyl. This compound has been used as a pharmaceutical preparation for the treatment of psychotic disorders. Lysergic acid hydrazide has shown to have reactive amide groups that may react with organic amines to form neurotoxic compounds.</p>Formula:C16H18N4OPurity:Min. 95%Molecular weight:282.34 g/molH-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.</p>Formula:C14H25ClN6O5Purity:Min. 95%Molecular weight:392.84 g/molAlpha-MSH (11-13) (free acid) acetate salt
CAS:<p>α-MSH (11-13) (free acid) acetate salt is a synthetic, nonsteroidal compound that binds to and activates α-melanocyte-stimulating hormone receptors. It has been used as an antiinflammatory agent in the treatment of inflammatory bowel disease and bowel disease. α-MSH (11-13) (free acid) acetate salt is also being studied as a contraceptive and an elastase inhibitor. This drug has shown some promise in the treatment of autoimmune diseases, such as rheumatoid arthritis, Crohn's disease, ulcerative colitis, multiple sclerosis, and type 1 diabetes mellitus. It is thought that α-MSH (11-13) (free acid) acetate salt may inhibit the production of inflammatory cells by inhibiting leukocyte elastase activity.</p>Formula:C16H30N4O4Purity:Min. 95%Molecular weight:342.43 g/molN-Methyliminodiacetic Acid
CAS:<p>N-Methyliminodiacetic acid is a monosodium salt that is produced by the reaction of methylamine and malonic acid. It has been shown to have an inhibitory effect on enzymes and metabolic rates in the human body. The structure of N-methyliminodiacetic acid contains a hydroxyl group, which can form hydrogen bonding interactions with nitrogen atoms in proteins, forming a chelate ligand. This type of binding is thought to be responsible for its ability to inhibit enzyme activities and metabolic rate.</p>Formula:C5H9NO4Purity:Min. 95%Molecular weight:147.13 g/mol5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride
CAS:<p>Please enquire for more information about 5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H12N2O4•HClPurity:Min. 95%Molecular weight:248.66 g/mol4-[2-[[(1S)-1-(2-Aminophenyl)-3-methylbutyl]amino]-2-oxoethyl]-2-ethoxybenzoic acid
CAS:<p>Bosentan is a potent inhibitor of the uptake of organic anions. It is used in the treatment of pulmonary arterial hypertension and has been shown to be effective against pravastatin-resistant HIV protease inhibitors, such as saquinavir, quinidine, and rosuvastatin. Bosentan inhibits uptake by binding to the transporter protein at a site that does not overlap with the binding site for organic anion substrates. This leads to a change in kinetic parameters for substrates, such as pravastatin and saquinavir. The binding site on bosentan may also be elucidated through monolayer experiments with efflux transporters.</p>Formula:C22H28N2O4Purity:Min. 95%Molecular weight:384.47 g/molTES
CAS:<p>TES, also known as N-Tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid, is a buffering agent that is used in protein assays and forms complexes with DNA and copper ions. The optimal pH range of this zwitterionic buffer is 6.8-8.2 and its pKa is 7.4.</p>Formula:C6H15NO6SPurity:Min. 95%Color and Shape:PowderMolecular weight:229.25 g/mol4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester
CAS:<p>Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12BrNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:302.12 g/mol(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride
CAS:<p>(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride is a synthetic chiral compound that is used to study the role of glyoxylate in biochemical reactions. This drug is an enolate and alkylating agent that can react with nucleophiles such as amines and thiols. It has been shown to be effective against perchlorates by hydrolyzing them into chlorine and oxygen gas. This drug has also been shown to inhibit the growth of Rhodobacter sphaeroides by inhibiting glyoxylate metabolism.</p>Formula:C12H15NO4·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:273.71 g/mol2-(2-Naphthyloxy)propanoic acid
CAS:<p>2-(2-Naphthyloxy)propanoic acid is a naphthalene derivative that is found in the plant species Carthamus tinctorius. It has been shown to have potent antagonist activity against the NMDA receptor, as well as antinociceptive and analgesic properties in vivo. 2-(2-Naphthyloxy)propanoic acid also shows potent anti-inflammatory and cardioprotective effects in vitro and in vivo. 2-(2-Naphthyloxy)propanoic acid can be used for the treatment of bone cancer, congestive heart failure, diabetic neuropathy, or other disorders of the peripheral nervous system.</p>Formula:C13H12O3Purity:Min. 95%Molecular weight:216.23 g/molThymopentin acetate salt
CAS:Controlled Product<p>Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.</p>Formula:C30H49N9O9Purity:Min. 95%Molecular weight:679.77 g/molN-(2-Pyridyl)oxamic acid
CAS:<p>N-(2-Pyridyl)oxamic acid is a non-steroidal anti-inflammatory drug that belongs to the group of piroxicam. It was found to be a competitive inhibitor of the reaction between singlet oxygen and certain organic compounds. The reaction rate of N-(2-pyridyl)oxamic acid is dependent on the concentration of solvent, which affects the solvation of the reactants and products. The tautomerization equilibrium constant for N-(2-pyridyl)oxamic acid has been determined as 1.3 × 10 at 25°C in acetonitrile, with an apparent molecular weight of 251.6 g/mol. The singlet oxygen constant (Ks) for this compound is 2.8 × 10 at 25°C in acetonitrile, with a maximum absorbance wavelength at 295 nm and a half life time of 0.27 seconds at 298 K in pure water.</p>Formula:C7H6N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:166.13 g/molCromoglicic acid D5
CAS:<p>Please enquire for more information about Cromoglicic acid D5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6D5BrPurity:Min. 95%Color and Shape:PowderMolecular weight:473.40 g/molDecanoyl-Arg-Arg-Leu-Leu-chloromethylketone trifluoroacetate salt
CAS:<p>Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt is a prohormone that is biosynthesized from the amino acid decanoic acid. It has been shown to inhibit fatty acid synthesis and mineralization in tissue samples, as well as drug target enzymes such as human pathogens. Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt has also been shown to have insulin resistance properties and may be used for the treatment of metabolic disorders.</p>Formula:C35H67ClN10O5Purity:Min. 95%Molecular weight:743.42 g/molLinolenic acid - 85%
CAS:<p>Linolenic acid is a polyunsaturated fatty acid that is found in plants, animals, and human cells. Linolenic acid has been shown to suppress the growth of cancer cells by inhibiting the production of linoleic acid, which can stimulate the growth of cancer cells. Linolenic acid has also been shown to cause skin reactions such as erythema and pruritus when applied topically or taken orally. Linolenic acid may be used for the treatment of ovarian follicles. In addition, linolenic acid has been shown to have an allergic response in humans when it is injected into the vein. It is important to note that linolenic acid can inhibit T-cell proliferation and cytokine production in a dose-dependent manner. Furthermore, linolenic acid inhibits lipopolysaccharide-induced acute lung injury in mice by reducing inflammatory cell infiltration and neutrophil activation.</p>Formula:C18H30O2Purity:Min. 95%Molecular weight:278.43 g/molSodium phenylacetate
CAS:Controlled Product<p>Sodium phenylacetate is a chemical compound that is used as an antifungal agent in vitro. It has also been shown to have anti-proliferative and cytotoxic effects on neuroblastoma cells. The physiological function of sodium phenylacetate is not well understood, but it may act as a neurotransmitter by inhibiting the release of acetylcholine or by regulating cell signaling pathways. Sodium phenylacetate may also inhibit angiogenesis, which would limit the growth of cancerous tumors.</p>Formula:C8H7NaO2Purity:Min. 95%Color and Shape:PowderMolecular weight:158.13 g/mol(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt acetate salt is a synthetic hormone that belongs to the group of gonadotropin releasing hormones (GnRH). It is used in veterinary medicine to stimulate ovulation and follicular growth in animals. (Des-Gly10, tBu-D-Gly6, Pro -NHEt9)-LHRH acetate salt Pyr -His -Trp -Ser -Tyr -tBu -D -Gly -Leu -Arg -Pro NHEt acetate salt is a prodrug that is hydrolyzed in vivo to buserelin, its active form. This drug has been shown to be effective against estradiol benzoate and sodium salts</p>Formula:C59H84N16O12·xC2H4O2Purity:Min. 95%Molecular weight:1,209.4 g/mol3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester
CAS:<p>Please enquire for more information about 3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H47NO9Purity:Min. 95%Molecular weight:505.64 g/mol11-Keto fusidic acid
CAS:<p>Fusidic acid is a hydrophilic antibiotic that is structurally related to penicillin. It has a cavity that interacts with γ-cyclodextrin, which can be used for its monitoring and stoichiometry. Fusidic acid has hydroxyl groups that are located on the 7th and 8th positions of the fusidate ring. This antibiotic has been shown to have stability constants in a range of 10-10 M. Fusidic acid also has two electrophoretically distinct forms, depending on the pH of the solution. The form at pH 10 is called fusidane, while the form at pH 5 is called fusidate.</p>Formula:C31H46O6Purity:Min. 95%Molecular weight:514.69 g/molEthyl 4-formylpyrrole-2-carboxylate
CAS:<p>Ethyl 4-formylpyrrole-2-carboxylate is a chemical compound that is used as an intermediate in organic synthesis. The compound has been reported to have spectra at m/z (M+1) of 168, 156 and 140. It also has been reported to have yields of about 98% when synthesized from ethyl azidoacetate and ethyl bromoacetate. The mass spectra show the molecular ion peak at m/z of 168, 156 and 140 corresponding to the structure of ethyl 4-formylpyrrole-2-carboxylate. Furan, n-substituted furan, thiophene, acetamide and cyclization are other possible structures for this molecule.</p>Formula:C8H9NO3Purity:Min. 95%Molecular weight:167.16 g/mol4-Acetamidobenzenesulfonic acid
CAS:<p>4-Acetamidobenzenesulfonic acid (4ABS) is an organic compound that is used as a sulfa drug. It is found in the filtrate of the chemical reaction between inulin and sulfamic acid. 4ABS acts as an amine catalyst for acyl transfer reactions. 4ABS also reacts with chloroethanol to form a primary amino group on a colloidal particle surface. This reaction has been shown to be reversible, where hydrochloric acid can react with 4ABS to form the corresponding sulfamic acid.</p>Formula:C8H9NO3SPurity:Min. 95%Molecular weight:199.23 g/molD-(-)-3-Phosphoglyceric acid disodium
CAS:<p>D-(-)-3-Phosphoglyceric acid disodium is a homologue of D-glyceric acid and is used in the synthesis of phosphatidylcholine. It binds to the active site of phosphatases and prevents them from hydrolyzing phosphate groups, which are critical for the production of adenosine triphosphate (ATP). The chemical stability and the availability make this compound an excellent candidate for biochemical studies. D-(-)-3-Phosphoglyceric acid disodium has been shown to be essential in biological function, as it functions as a substrate for many metabolic pathways such as glycolysis, gluconeogenesis, pentose phosphate pathway, and fatty acid biosynthesis. The molecule is also involved in a number of biochemical reactions that are catalyzed by enzymes. Mutational studies have shown that organisms without this compound will not survive.</p>Formula:C3H5O7PNa2Purity:Min. 93%Color and Shape:White PowderMolecular weight:230.02 g/mol7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid
CAS:<p>7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid (ABT) is a drug that binds to bacterial enzymes and inhibits their ability to synthesize proteins. ABT is a conjugate of fluoroquinolone and an amino acid. As the drug is degradable by hydrolysis, it has been shown to be less toxic in Sprague Dawley rats than other fluoroquinolones. This drug has been used in diagnostic tests as a ligand for affinity ligands, but has not been approved for human use. The drug also possesses functional groups that are important for binding to reconstituted enzymes.br>br>ABT's ester linkages are degradable by hydrolysis and can be</p>Formula:C20H16F3N3O3Purity:Min. 95%Molecular weight:403.35 g/moltert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride
CAS:<p>Please enquire for more information about tert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18N2O2Purity:Min. 95%Molecular weight:246.31 g/molDansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.</p>Formula:C28H32N6O9S·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:742.68 g/mol2,4-Dihydroxybenzenesulfonic acid
CAS:<p>2,4-Dihydroxybenzenesulfonic acid is a chemical compound that is used as a polymerization catalyst. It is most commonly used in the production of polyoxyethylene and copolymers. The catalytic activity of 2,4-dihydroxybenzenesulfonic acid is due to its acid group and hydroxy groups. This chemical can also be prepared by the reaction of resorcinol and hydrogen peroxide. The fluidity of this compound can be increased by adding an appropriate fluidizing agent such as peroxide or ammonium persulfate.</p>Formula:C6H6O5SPurity:Min. 95%Molecular weight:190.17 g/mol2-[(2,3-Dimethylphenyl)amino]nicotinic acid
CAS:<p>2-[(2,3-Dimethylphenyl)amino]nicotinic acid is an arylpropionic acid that has been designed for the treatment of cancer. It is a neutral compound that can be crystallized or sterilized and then injected or implanted into tissues. The compound can be used as a diagnostic tool to target specific tissues in the body by using iontophoresis or organic solvents. 2-[(2,3-Dimethylphenyl)amino]nicotinic acid interacts with chlorine ions to form a chloride derivative, which is then transported through the tissue. This process can be reversed by adding an acid solution to the tissue, which will cause the chloride ions to break down into hydrogen and chloride ions.</p>Formula:C14H14N2O2Purity:Min. 95%Molecular weight:242.27 g/molC-Type Natriuretic Peptide (32-53) acetate salt
CAS:<p>C-type Natriuretic peptide is a peptide hormone that causes vasodilation, diuresis, and natriuresis. It is secreted by the heart and kidneys in response to volume overload. C-type Natriuretic peptide has been shown to cause fibrosis of the kidney as well as other tissues in mice. The binding of C-type Natriuretic peptide to its receptor activates cyclase, which converts ATP into cAMP. This leads to increased levels of cGMP, which causes smooth muscle relaxation and vasodilation.</p>Formula:C93H157N27O28S3Purity:Min. 95%Molecular weight:2,197.6 g/mol5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid
CAS:<p>Please enquire for more information about 5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N5O3Purity:Min. 95%Color and Shape:White To Yellow To Dark Red SolidMolecular weight:301.3 g/molN,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide
CAS:<p>N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide is a molecule that has an optimum concentration of 0.5 M. It has a hydrogen bond donor and acceptor and is optically active. This molecule displays fluorescence properties and is inorganic with a chloride acceptor group. N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide has been shown to have high photostability and to be enhanced by light emission from a diode. This molecule also has carbonyl groups that are electron donors for the fluorescence process.</p>Formula:C49H50N6O4Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:786.96 g/molMethyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate
CAS:<p>Please enquire for more information about Methyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H9N3O4Purity:Min. 95%Molecular weight:271.23 g/molKermesic acid
CAS:<p>Kermesic acid is a hydroxybenzoic acid that is used as a food dye. It can be found in some red wines and it is also used to color the eggs of a particular breed of chicken. The most common use for kermesic acid is as an oxidizing agent in a chromatographic method, which separates molecules based on their size. The oxidation catalyst used can vary, but often trifluoroacetic acid (TFA) is used. TFA reacts with the kermesic acid to form an octaketide, which has the chemical formula C8H6O3. This octaketide then reacts with another molecule of TFA to form two esters.</p>Formula:C16H10O8Purity:Min. 95%Molecular weight:330.25 g/molIsatin-5-sulfonic acid sodium salt dihydrate
CAS:Isatin-5-sulfonic acid sodium salt dihydrate is a potent inhibitor of caspases. It has been shown to inhibit the activity of caspase-3 in vitro, thereby inhibiting apoptosis. Isatin-5-sulfonic acid sodium salt dihydrate has also been shown to increase survival rates in animal models of neurodegenerative diseases such as Parkinson's disease and Huntington's disease. Isatin-5-sulfonic acid sodium salt dihydrate may have neuroprotective effects by inhibiting the release of proinflammatory cytokines and nitric oxide, which are associated with neuronal death. This drug also inhibits monoamine oxidase A (MAO-A) and zymosterone B (ZVAD).Formula:C8H4NNaO5S·2H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:285.21 g/molDomoic acid
CAS:<p>Domoic acid is a neurotoxin that has been shown to induce neuronal death in vitro and in vivo. Domoic acid inhibits the activity of ligand-gated ion channels, which increases the cytosolic Ca2+ concentration. This toxin also induces mitochondrial membrane potential loss, causing apoptosis. Domoic acid binds to the NMDA receptor and blocks glutamate binding. It also inhibits ATP synthase by competing with ADP for binding sites on the enzyme's F1 portion. Domoic acid has low potency as a neurotoxin because it does not readily cross the blood-brain barrier or enter cells via passive diffusion.</p>Formula:C15H21NO6Purity:Min. 90 Area-%Color and Shape:Beige PowderMolecular weight:311.33 g/mol2-Chlorobutyric Acid
CAS:Formula:C4H7ClO2Purity:>90.0%(GC)Color and Shape:Colorless to Light orange to Yellow clear liquidMolecular weight:122.5516-Hydroxyhexadecanoic Acid
CAS:Formula:C16H32O3Purity:>98.0%(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:272.433,3-Dimethyl-2-oxobutyric Acid
CAS:Formula:C6H10O3Purity:>98.0%(T)Color and Shape:White or Colorless to Almost white or Almost colorless powder to lump to clear liquidMolecular weight:130.143,4-Dihydroxyhydrocinnamic Acid
CAS:Formula:C9H10O4Purity:>98.0%(GC)(T)Color and Shape:White to Brown powder to crystalMolecular weight:182.18tert-Butyl Hydrogen Tetradecanedioate
CAS:Formula:C18H34O4Purity:>95.0%(GC)(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:314.473-Iodo-4-methoxybenzoic Acid
CAS:Formula:C8H7IO3Purity:>97.0%(GC)(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:278.053-(4-Carboxyphenyl)propionic Acid
CAS:Formula:C10H10O4Purity:>98.0%(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:194.19(Ethylenedithio)diacetic Acid
CAS:Formula:C6H10O4S2Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:210.264-Bromo-2-methylbenzoic Acid
CAS:Formula:C8H7BrO2Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:215.052-(4-Hydroxyphenyl)propionic Acid
CAS:Formula:C9H10O3Purity:>98.0%(T)(HPLC)Color and Shape:White to Light yellow to Light red powder to crystalMolecular weight:166.18cis-4-(tert-Butoxycarbonylamino)cyclohexanecarboxylic Acid
CAS:Formula:C12H21NO4Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:243.30N-(2-Hydroxyethyl)succinimide, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H9NO3Purity:95%Color and Shape:White to cream to pale yellow, Crystals or powder or crystalline powder or lumps or fused solidMolecular weight:143.14tert-Butyl cyanoacetate, 98%
CAS:<p>tert-Butyl cyanoacetate is used in the synthesis of vinylogous urea. It is also used as a new additive for the sugar nucleoside base coupling step en route to DAPD with improved -selectivity. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some</p>Formula:NCCH2CO2C(CH3)3Purity:98%Color and Shape:Liquid or viscous liquid, Clear colorless to white to yellowMolecular weight:141.17N-Vinylphthalimide, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C10H7NO2Purity:99%Color and Shape:White to cream to pale yellow, Crystals or powder or crystalline powderMolecular weight:173.17Methyl chlorodifluoroacetate, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C3H3ClF2O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:144.50N-(4-Pentynyl)phthalimide, 97%
CAS:<p>N-(4-Pentynyl)phthalimide is used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU referen</p>Formula:C13H11NO2Purity:97%Color and Shape:White to yellow to pale brown, PowderMolecular weight:213.24Ethyl tert-butylacetate, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C8H16O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:144.21Isopropyl palmitate, tech. 85%
CAS:<p>Isopropyl palmitate is used to formulate and evaluate the suitability of pluronic lecithin organogels containing flurbiprofen for topical application and to characterize microemulsion systems of isopropyl palmitate, water and 2:1 Brij 97, and 1-butanol by different experimental techniques. This Ther</p>Formula:CH3(CH2)14CO2CH(CH3)2Purity:85%Color and Shape:Liquid, Clear colorlessMolecular weight:298.515-Hexenyl acetate, 97%
CAS:<p>(4E,7Z)-4,7-Tridecadienyl acetate,a component of the sex pheromone was synthesized from 5-hexenyl acetate. CM of 5-decene with 5-hexenyl acetate is used to produce the insect pheromone. Used in olefin cross metathesis. This Thermo Scientific Chemicals brand product was originally part of the Alfa Ae</p>Formula:C8H14O2Purity:97%Color and Shape:LiquidMolecular weight:142.2Ethyl trimethylacetate, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C7H14O2Purity:99%Color and Shape:Clear colorless, LiquidMolecular weight:130.193-(3-Fluorophenyl)propionic acid, 97%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C9H9FO2Purity:97%Color and Shape:White to cream or pale yellow, Crystals or powder or crystalline powderMolecular weight:168.17Tricarballylic acid, 98%
CAS:<p>It is used as an alternative to DMDHEU (formaldehyde releasing cross- linking agent). This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item</p>Formula:C6H8O6Purity:98%Color and Shape:White to cream to pale brown, Crystals or powder or crystalline powderMolecular weight:176.12n-Butylidenephthalide, (E)+(Z), 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C12H12O2Purity:95%Color and Shape:Clear, yellow, LiquidMolecular weight:188.23Dehydroacetic acid, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C8H8O4Purity:98%Color and Shape:Powder, White to cream or pale yellowMolecular weight:168.151-Naphthylacetic acid, 95%, may cont. up to 5% 2-isomer
CAS:<p>1-Naphthylacetic acid is used as a plant growth regulator and for plant tissue culture. It is used for the vegetative propagation of plants from stem and leaf cutting, abscission promoter and substrate for auxin inducers of specific plant enzymes. Further, it stimulates root formation in cuttings of</p>Formula:C12H10O2Purity:95%Color and Shape:White to cream to yellow or pale brown, Crystalline powder or powderMolecular weight:186.21Cycloheptylacetic acid, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C9H16O2Purity:99%Color and Shape:Clear colorless, LiquidMolecular weight:156.231-Cyclohexene-1-carboxylic acid, 97%
CAS:<p>1-Cyclohexene-1-carboxylic acid is an intermediate in benzoic acid anaerobic decomposition by methanogenic consortium. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The o</p>Formula:C7H10O2Purity:97%Color and Shape:Powder or crystalline powder or fused solid or clear liquid as melt, Colorless or white to pale cream or pale yellowMolecular weight:126.16Dimethyl fumarate, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H8O4Purity:99%Color and Shape:Crystals or crystalline powder or flakes, White to cream to pale brownMolecular weight:144.134-(Methoxycarbonyl)cyclohexane-1-carboxylic acid, 97%
CAS:<p>4-(Methoxycarbonyl)cyclohexane-1-carboxylic acid is used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / i</p>Formula:C9H14O4Purity:97%Molecular weight:186.21Hydantoin-5-acetic acid, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C5H6N2O4Purity:98%Color and Shape:Crystalline powder, WhiteMolecular weight:158.11Sodium DL-lactate, 60% w/w aq. soln.
CAS:<p>Useful chiral synthon; building block for depsipeptides</p>Formula:C3H5NaO3Purity:60%Molecular weight:112.061-Methylindazole-3-carboxylic acid, 97%
CAS:<p>1-Methylindazole-3-carboxylic acid is used as important raw material and intermediate used in organic Synthesis, pharmaceuticals, agrochemicals and dyestuff. It is also used as a pharmaceutical adjuvant, Granisetron Impurity D. This Thermo Scientific Chemicals brand product was originally part of th</p>Formula:C9H8N2O2Purity:97%Color and Shape:Powder, White to creamMolecular weight:176.18Adipic dihydrazide, 97%
CAS:<p>Adipic dihydrazide is used as a formaldehyde scavenger and reacts with formaldehyde, thereby preventing the volatilizing of formaldehyde in the air. It is also employed as a paint additive and coating additive. It is also used as an intermediate. Further, it is used for cross-linking water-based emu</p>Formula:C6H14N4O2Purity:97%Color and Shape:White to pale cream or pale yellow, Powder or crystalline powderMolecular weight:174.20Ethyl cyanoformate, 99%
CAS:<p>Ethyl cyanoformate is used as reagent in the preparation of N-substituted amindinoformic acid and ethyl-4-quinazoline -2-carboxylate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the leg</p>Formula:C4H5NO2Purity:99%Color and Shape:Clear or slightly turbid colorless, LiquidMolecular weight:99.093-Nitrophthalimide, 98%
CAS:<p>3-Nitrophthalimide is a useful dye for biological research purposes. It is a nitro heterocyclic compounds found to exhibit potential antifungal activities. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label informatio</p>Formula:C8H4N2O4Purity:98%Color and Shape:Pale yellow to yellow, Crystals or powder or crystalline powderMolecular weight:192.13Ammonium acetate, 97%
CAS:<p>Ammonium acetate is widely utilized as a catalyst in the Knoevenagel condensation. It is the primary source of ammonia in the Borch reaction in organic synthesis. It is used with distilled water to make a protein precipitating reagent. It acts as a buffer for electrospray ionization (ESI) mass spect</p>Formula:C2H7NO2Purity:97%Color and Shape:Crystals or powder or crystalline powder, WhiteMolecular weight:77.08Ref: 02-A16343
Discontinued productCyclopentanecarboxylic acid, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H10O2Purity:99%Color and Shape:Liquid, Clear colorless to pale yellowMolecular weight:114.143-Acetoxy-2-butanone, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H10O3Purity:98%Color and Shape:Liquid, Clear colorless to pale yellowMolecular weight:130.14Methyl 3-methoxythiophene-2-carboxylate, 97%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C7H8O3SPurity:97%Color and Shape:White to pale brown, Crystals or powder or crystalline powderMolecular weight:172.201-Cyclohexene-1-acetic acid
CAS:<p>1-Cyclohexene-1-acetic acid used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU referenc</p>Formula:C8H12O2Molecular weight:140.18Strontium oxalate, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C2O4SrPurity:95%Color and Shape:White, Powder or lumpMolecular weight:175.64Methyl 1-methylpyrrole-2-carboxylate, 99%
CAS:<p>Methyl 1-methylpyrrole-2-carboxylate is used as chemical and organic Intermediates. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item c</p>Formula:C7H9NO2Purity:99%Color and Shape:Clear colorless to yellow to orange, LiquidMolecular weight:139.15o-Cresolphthalein complexone, indicator grade
CAS:<p>Indicator for complexometric titration of Mg, Ca, Sr and Ba. It is used as an alkaline earth metal ion indicator. Suggested to be colorless at pH 11, but turns pink in the presence of alkaline earth metals. Also utilized in an auto analyzer to determine serum calcium. This Thermo Scientific Chemical</p>Formula:C32H32N2O12Color and Shape:White to cream, PowderMolecular weight:636.61N-(4-Bromobutyl)phthalimide, 96%
CAS:<p>N-(4-Bromobutyl)phthalimide is used in organic synthesis and the production of pharmaceutical. It can react with 1-phenyl-piperazine to get N-[4-(4-phenyl-piperazin-1-yl)-butyl]-phthalimide. It is a useful synthesis reagent used to synthesize B-cyclodextrin derivatives. This Thermo Scientific Chemic</p>Formula:C12H12BrNO2Purity:96%Color and Shape:White to cream, PowderMolecular weight:282.142-Phenylethyl acetate, 98%
CAS:<p>Phenylethyl acetate mantains the typical rose notes of Phenylethanol with a more intense honey profile which is perfect for fruit and alcoholic drink applications. It is used as a pharmaceutical intermediate and also it holds application in gas chromatography and liquid chromatography. This Thermo S</p>Formula:C10H12O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:164.20Methyl cyclopentanecarboxylate, 97%
CAS:<p>Methyl cyclopentanecarboxylate This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the</p>Formula:C7H12O2Purity:97%Color and Shape:Clear colorless to pale yellow, LiquidMolecular weight:128.17Benzeneacetic acid, methyl ester
CAS:Formula:C9H10O2Purity:98%Color and Shape:LiquidMolecular weight:150.1745



