Inhibitors
Inhibitors are molecules that bind to enzymes, receptors, or other proteins to reduce or block their biological activity. These compounds are widely used in research to study biological pathways, understand disease mechanisms, and develop therapeutic drugs. Inhibitors play a crucial role in the treatment of various diseases, including cancer, cardiovascular diseases, and infections. At CymitQuimica, we provide a diverse range of high-quality inhibitors to support your research in biochemistry, cell biology, and pharmaceutical development.
Subcategories of "Inhibitors"
- Angiogenesis(2,687 products)
- Apoptosis(6,097 products)
- Cell Cycle/Checkpoint(4,691 products)
- Chromatin/Epigenetics(2,376 products)
- Cytoskeletal Signaling(1,472 products)
- DNA Damage/DNA Repair(2,921 products)
- Endocrinology/Hormones(3,611 products)
- Enzyme(3,655 products)
- GPCR/G-Protein(8,755 products)
- Immunology and Inflammation(3,765 products)
- Influenza Virus(298 products)
- JAK/STAT signaling(407 products)
- MAPK Signaling(1,230 products)
- Membrane Transporter/Ion Channel(2,947 products)
- Metabolism(9,940 products)
- Microbiology/Virology(7,347 products)
- Neuroscience(10,240 products)
- Other Inhibitors(36,533 products)
- Oxidation-Reduction(43 products)
- PI3K/Akt/mTOR Signaling(1,437 products)
- Proteases/Proteasome(1,675 products)
- Stem Cell and Derivatives(830 products)
- Tyrosine Kinase/Adaptors(2,028 products)
- Ubiquitination(1,682 products)
Show 16 more subcategories
Found 66582 products of "Inhibitors"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LL-37, acetylated,amidated
LL-37 peptide: acetylated at N-terminus, amidated at C-terminus; crucial in initial infection defense.Formula:C207H343N61O53Purity:98%Color and Shape:SolidMolecular weight:4534.4FiVe1
CAS:<p>FiVe1 is a vimentin-binding compound that disrupts mitosis in cancer cells, causing cell death, with an IC50 of 234 nM in FOXC2-HMLER.</p>Formula:C18H16Cl2N4Purity:99.67%Color and Shape:SolidMolecular weight:359.25Angelol B
CAS:The absorption and transport of angelol A and Angelol B are passive diffusion as the dominating process in Caco-2 cell monolayer model.Formula:C20H24O7Purity:98%Color and Shape:SolidMolecular weight:376.4β-Carboline-1-propanoic acid
CAS:<p>Beta-carboline-1-propanoic acid: synthetic precursor, used for indole derivatives, studies indole conformation & reactivity.</p>Formula:C14H12N2O2Purity:98%Color and Shape:SolidMolecular weight:240.262AM5992
CAS:<p>AM5992 (example 195) is a potent CDK4 and CDK6 inhibitor (CDK4, IC50= 0.013 μM). AM5992 can be used for the research of CDK4-mediated disorders.</p>Formula:C27H33FN8OPurity:98%Color and Shape:SoildMolecular weight:504.6Korepimedoside C
CAS:Korepimedoside C (Epimedin I) - a flavonol glycoside from Epimedium koreanum, used in Chinese medicine for impotence and more.Formula:C41H52O21Color and Shape:SolidMolecular weight:880.84Nonylbenzene-PEG8-OH
CAS:Nonylbenzene-PEG8-OH is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C31H56O9Color and Shape:SolidMolecular weight:572.78Psi Cb
CAS:Psi Cb is a natural product that can be used as a reference standard. The CAS number of Psi Cb is 138078-50-9.Formula:C18H34O4Color and Shape:SolidMolecular weight:314.466VYN00459
VYN00459, a tripeptide linker NH2-Glu(OBu-t)-Val-Cit, has a protected Glu side chain and is enzymatically cleavable.Formula:C20H37N5O7Color and Shape:SolidMolecular weight:459.54Rucosopasem manganese
CAS:<p>Rucosopasem manganese (GC4711), a selective SOD mimetic, converts superoxide to peroxide for cancer research.</p>Formula:C27H45MnN5O4Color and Shape:SolidMolecular weight:558.626L-AP3
CAS:L-AP3 blocks mGluR, inhibits D/L-phosphoserine (IC50: 368/2087 μM).Formula:C3H8NO5PColor and Shape:White Hygroscopic SolidMolecular weight:169.073CB 3988
CAS:CB 3988 is a bio-active chemical.Formula:C26H23F3N4O6Color and Shape:SolidMolecular weight:544.48SST-02
SST-02: simple one-step-synthesized cationic lipid for siRNA-LNPs with a 0.02 mg/kg ID50 in FVII model; safe at 3 mg/kg in rats.Formula:C39H73NOColor and Shape:SolidMolecular weight:572.02GLR-19
CAS:GLR-19 is an anti-HIV peptide with demonstrated antiviral activity against HSV-2 [1] [2].Formula:C102H194N40O20Purity:98%Color and Shape:SolidMolecular weight:2300.89Lopinavir M-3/M-4
CAS:Lopinavir M-3/M-4 is a Lopinavir secondary metabolite.Formula:C37H48N4O6Color and Shape:SolidMolecular weight:644.8Esculentoside E
Esculentoside E is a useful organic compound for research related to life sciences and the catalog number is T124459.Formula:C35H54O11Color and Shape:SolidMolecular weight:650.806Boc-NH-PEG9-azide
CAS:Boc-NH-PEG9-azide is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C25H50N4O11Purity:98%Color and Shape:SolidMolecular weight:582.68DAPK Substrate Peptide
CAS:<p>DAPK Substrate Peptide is a synthetic peptide substrate for death-associated protein kinase (DAPK) (Km = 9 μM).</p>Formula:C70H115N25O17Purity:98%Color and Shape:SolidMolecular weight:1578.82Prepro VIP (81-122), human
CAS:Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122.Formula:C202H325N53O64SPurity:98%Color and Shape:SolidMolecular weight:4552.13Mifamurtide
CAS:Mifamurtide is a drug against osteosarcoma, is an immunomodulator with antitumor effects.Formula:C59H109N6O19PPurity:98%Color and Shape:SolidMolecular weight:1237.5pGlu-Pro-Arg-MNA
CAS:pGlu-Pro-Arg-MNA is a chromogenic substrate.Formula:C23H32N8O7Purity:98%Color and Shape:SolidMolecular weight:532.55UNC3133
<p>UNC3133: selective MerTK inhibitor; IC50=3.0 nM; also targets Axl, Tyro3, FLT3; PO Cmax=0.023; IV T1/2=1.59h; oral bioavailability 16%.</p>Formula:C30H44N6OPurity:98%Color and Shape:SolidMolecular weight:504.72α-Conotoxin PIA TFA
α-Conotoxin PIA TFA, targeting nicotinic acetylcholine receptor (nAChR) subtypes with α6 and α3 subunits, acts as an antagonist.Formula:C81H126F3N27O27S4Purity:98.81%Color and Shape:SolidMolecular weight:2095.3endo-BCN-PEG8-NHS ester
CAS:<p>Endo-BCN-PEG8-NHS ester, a PEG derivative with NHS, links in PROTAC synthesis.</p>Formula:C34H54N2O14Purity:98%Color and Shape:SolidMolecular weight:714.806Kaempferol 3-O-rutinoside 7-O-glucoside
CAS:Kaempferol 3-O-rutinoside 7-O-glucoside is a natural product for research related to life sciences.Formula:C33H40O20Purity:98%Color and Shape:SolidMolecular weight:756.66PROT-IN-1
CAS:<p>PROT-IN-1 is a potent high-affinity inhibitor of L-proline transporter and a candidate compound for the treatment of neurological diseases.</p>Formula:C23H22N2OPurity:98.55%Color and Shape:SolidMolecular weight:342.43Opuntiol
CAS:<p>Opuntiol is a natural product that can be used as a reference standard.</p>Formula:C7H8O4Color and Shape:SolidMolecular weight:156.137SBA Crosslinker
CAS:<p>SBA crosslinker: non-cleavable, reacts with sulfhydryl/amino groups, 1.5Å spacer, for antibody-drug conjugates.</p>Formula:C6H6BrNO4Color and Shape:SolidMolecular weight:236.02ICAM-1988
CAS:<p>ICAM-1988 is a LFA-1 antagonist.</p>Formula:C22H22Cl2N4O6SColor and Shape:SolidMolecular weight:541.4ent-16β,17-Dihydroxy-19-kauranoic acid
CAS:ent-16beta,17-Dihydroxy-19-kauranoic acid is a natural product for research related to life sciences.Formula:C20H32O4Purity:98%Color and Shape:SolidMolecular weight:336.472N-(Propargyl-PEG4-carbonyl)-N-bis(PEG1-methyl ester)
CAS:<p>N-(Propargyl-PEG4-carbonyl)-N-bis(PEG1-methyl ester) is a PEG-based linker for PROTAC synthesis.</p>Formula:C24H41NO11Purity:98%Color and Shape:SolidMolecular weight:519.582-Hydroxyplatyphyllide
CAS:2-Hydroxyplatyphyllide is a natural product from Ligularia songarica.Formula:C14H14O3Purity:98%Color and Shape:SolidMolecular weight:230.264'-O-Methyllariciresinol
CAS:<p>4'-O-Methyllariciresinol is a natural product for research related to life sciences. The catalog number is TN6122 and the CAS number is 73354-09-3.</p>Formula:C21H26O6Purity:98%Color and Shape:SolidMolecular weight:374.433Isoflavidinin
CAS:Isoflavidinin is a natural product from Pholidota articulata.Formula:C16H14O3Purity:98%Color and Shape:SolidMolecular weight:254.28(rel)-PROTAC ERRα Degrader-1
(rel)-PROTAC ERRα Degrader-1 is a relative configuration of PROTAC ERRα Degrader-1, which is an estrogen-related receptor alpha (ERRa) degrader.Formula:C54H49Cl2F6N7O8Purity:98%Color and Shape:SolidMolecular weight:1108.91Nikkomycin
CAS:Nikkomycin is used as an insecticide.Formula:C25H32N6O13Purity:98%Color and Shape:SolidMolecular weight:624.56Drimiopsin D
CAS:<p>Drimiopsin D is a natural product from Scilla scilloides.</p>Formula:C16H14O7Purity:98%Color and Shape:SolidMolecular weight:318.28CDD-1102 HCl
CDD-1102 HCl is a novel BRDT-BD4 / BRD2-BD1302 selective inhibitor that shows non-hormonal contraceptive potential in ex vivo experiments.Formula:C32H31ClN6O3Purity:98.30%Color and Shape:SoildMolecular weight:583.08Gly-PEG3-endo-BCN
CAS:Gly-PEG3-endo-BCN is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C23H39N3O6Purity:98%Color and Shape:SolidMolecular weight:453.58Anti-Mouse PD-1 Antibody (RMP1-14)
Anti-Mouse PD-1 Antibody (RMP1-14) is an IgG2a antibody inhibitor against mouse PD-1 and can block PD-1/PD-L1 signaling. High-Quality, Low-Cost!Purity:14.68mg/ml - >95%Color and Shape:Odour LiquidKadsurenin D
CAS:Kadsurenin D is a natural product for research related to life sciences. The catalog number is TN4365 and the CAS number is 140669-89-2.Formula:C21H24O5Purity:98%Color and Shape:SolidMolecular weight:356.41Propargyl-PEG8-bromide
CAS:Propargyl-PEG8-bromide is a non-cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs)[1].Formula:C19H35BrO8Purity:98%Color and Shape:SolidMolecular weight:471.384-(3,4-Dimethoxyphenyl)-3-butene-1,2-diol
CAS:4-(3,4-Dimethoxyphenyl)-3-butene-1,2-diol is a natural product for research related to life sciences.Formula:C12H16O4Purity:98%Color and Shape:SolidMolecular weight:224.25Horminone
CAS:Horminone has antimicrobial activity, it can inhibit the protein synthesis in several types of bacteria; it can inhibit the in vitro growth of Trypanosoma cruziFormula:C20H28O4Purity:98%Color and Shape:SolidMolecular weight:332.43Tetraethyl octane-1,8-diylbis(phosphonate)
CAS:Tetraethyl octane-1,8-diylbis(phosphonate) is an alkyl chain-based linker compound employed in PROTAC synthesis[1].Formula:C16H36O6P2Purity:98%Color and Shape:SolidMolecular weight:386.4N-Me-N-bis-PEG4
CAS:N-Me-N-bis-PEG4 is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C17H37NO8Purity:98%Color and Shape:SolidMolecular weight:383.48Dalfopristin (mesylate) (112362-50-2 free base)
Dalfopristin, a type A streptogramin antibiotic, inhibits the 50S ribosome; it's combined with type B quinupristin in Synercid.Formula:C34H51N4O9S·CH3SO3Purity:98%Color and Shape:SolidMolecular weight:787PROTAC GDI2 Degrader-1
<p>PROTAC GDI2 Degrader-1 (Compound 21) is a potent degrader of PROTAC GDI2, demonstrating outstanding antitumor activity in vivo within pancreatic xenograft</p>Purity:98%Color and Shape:Odour SolidBradykinin (1-3)
CAS:<p>Bradykinin (1-3) is a fragment of Bradykinin. Bradykinin is an activates pain receptors.</p>Formula:C16H28N6O4Purity:98%Color and Shape:SolidMolecular weight:368.43ω-Conotoxin Bu8
<p>ω-Conotoxin Bu8 is a 25-amino-acid-residue ω-conotoxin that features three disulfide bridges.</p>Formula:C103H174N42O35S6Purity:98%Color and Shape:SolidMolecular weight:2753.13Endothelin-2 (49-69), human TFA
Endothelin-2 (49-69), human (TFA) is a 21-amino acid vasoactive peptide that binds to ET-RA and ET-RB.Formula:C117H161N26F3O34S4Purity:98%Color and Shape:SolidMolecular weight:2660.94Jatamanvaltrate B
CAS:<p>Jatamanvaltrate B is cytotoxic to A549, PC-3M, HCT-8, and Bel7402 cancer cells.</p>Formula:C32H50O13Purity:98%Color and Shape:SolidMolecular weight:642.73MethADP sodium salt
CAS:<p>MethADP is a specific CD73 inhibitor.</p>Formula:C11H17N5NaO9P2Purity:98%Color and Shape:SolidMolecular weight:448.22Adenostemmoic acid G
CAS:Adenostemmoic acid G is a natural product for research related to life sciences. The catalog number is TN5623 and the CAS number is 130217-26-4.Formula:C20H30O5Purity:98%Color and Shape:SolidMolecular weight:350.455Laidlomycin propionate potassium
CAS:<p>Laidlomycin propionate potassium is a growth stimulant (Veterinary).</p>Formula:C40H65KO13Color and Shape:SolidMolecular weight:793.0317(S)-HETE
CAS:<p>Arachidonic acid and its CYP450 metabolite, 17(S)-HETE, regulate kidney electrolytes; 17(S)-HETE reduces proximal tubule ATPase activity by 70% at 2 μM.</p>Formula:C20H32O3Color and Shape:SolidMolecular weight:320.473CDK8-IN-12
CAS:CDK8-IN-12: selective CDK8 inhibitor (Ki 14 nM), oral anticancer, blocks GSK-3α/β, PCK-θ, halts MV4-11 cell growth.Formula:C21H20ClN3O2Purity:98.55% - 99.22%Color and Shape:SoildMolecular weight:381.86Anguinomycin A
CAS:<p>Anguinomycin A, an antibiotic from Streptomyces, is like leptomycin B, kills mouse leukemia cells, and fights lung cancer in mice.</p>Formula:C31H44O6Color and Shape:SolidMolecular weight:512.687m-PEG-CH2COOH (MW 20000)
m-PEG-CH2COOH (MW 20000) serves as a PEG-based PROTAC linker for the synthesis of PROTACs[1].Purity:98%Color and Shape:SolidMolecular weight:N/AS-Ruxolitinib
CAS:<p>S-Ruxolitinib can be used in related research in the field of life sciences. Its product number is T3066 and CAS number is 1160597-27-2.</p>Formula:C17H18N6Purity:98%Color and Shape:SolidMolecular weight:306.37Geranylgeranyl pyrophosphate
CAS:<p>Geranylgeranyl pyrophosphate: a metabolite for protein modification and diterpenoid precursor, used in cancer research.</p>Formula:C20H36O7P2Color and Shape:SolidMolecular weight:450.44Microcolin B
CAS:<p>Microcolin B: strong acylpeptide immunosuppressant with proline, from Lyngbya majuscule algae.</p>Formula:C39H65N5O8Color and Shape:SolidMolecular weight:731.976YAP-TEAD-IN-3
CAS:YAP-TEAD-IN-3 inhibitor YAP/TAZ-TEAD interactions Avi-human TEAD (4217-434) YAP-TEAD-IN-3 inhibits YAP reporter gene expression and NCI-H2052 cell proliferationFormula:C27H26ClF2N3O4Purity:97.55% - 98.71%Color and Shape:SoildMolecular weight:529.96JNJ-16567083
CAS:<p>JNJ-16567083 is a bioactive chemical.</p>Formula:C20H25NO2Color and Shape:SolidMolecular weight:311.42Ribavirin 5'-monophosphate (lithium salt)
CAS:<p>Ribavirin 5'-monophosphate (lithium salt) directly inhibits IMP dehydrogenase (converts IMP to XMP).</p>Formula:C8H11Li2N4O8PColor and Shape:SolidMolecular weight:336.05ADTN
CAS:ADTN is an agonist of the dopamine receptor.Formula:C10H13NO2Purity:98%Color and Shape:SolidMolecular weight:179.22PGLa
CAS:PGLa is a cationic antimicrobial peptide (AMP) originally isolated from frog. It has been shown to have antibacterial,antifungal,and antiviral,activities.Formula:C88H162N26O22SPurity:98%Color and Shape:SolidMolecular weight:1968.453-O-Methyltolcapone D7
<p>Deuterated 3-O-Methyltolcapone (Ro 40-7591 D7), a Tolcapone metabolite and potent COMT inhibitor for Parkinson's.</p>Formula:C15H6D7NO5Purity:98%Color and Shape:SolidMolecular weight:294.31Fmoc-Tyr(3-F,tBu)-OH
CAS:<p>Fmoc-Tyr(3-F,tBu)-OH: Cyclic peptide with high permeability, target-specific affinity. Sourced from WO2018225864A1.</p>Formula:C28H28FNO5Color and Shape:SolidMolecular weight:477.532Sulfo-SNPB
CAS:Sulfo-SNPB is a cleavable linker that is used for making antibody-drug conjugate (ADC).Formula:C13H13N3O9S3Purity:98%Color and Shape:SolidMolecular weight:451.45FRATide
CAS:<p>FRATtide inhibits the phosphorylation of Axin and β-catenin, inhibits GSK-3 binding to Axin, and is a peptide derived from the GSK-3 binding protein.</p>Formula:C55H102N2O2Color and Shape:SolidMolecular weight:823.433Coagulin L
CAS:<p>Coagulin L is a useful organic compound for research related to life sciences. The catalog number is T125335 and the CAS number is 216164-64-6.</p>Formula:C34H50O12Color and Shape:SolidMolecular weight:650.762Thalidomide-NH-C10-COOH
<p>Compound 6b is a synthetic Thalidomide-VHL E3 ligase-linker for PROTACs.</p>Formula:C24H31N3O6Purity:98%Color and Shape:SolidMolecular weight:457.52QST4
CAS:<p>QST4 possessed antitubercular and antifungal activities with a MIC value of 6.25 μM in Mycobacterium tuberculosis Mycobacterium tuberculosis H37Rv.</p>Formula:C16H13ClN4O2S2Purity:≥98%Color and Shape:SoildMolecular weight:392.88Neonuezhenide
CAS:<p>Neonuezhenide is a phenolic compound isolated from Ligustrum officinale, which has strong antioxidant effects on free radical-induced hemolysis of red blood</p>Formula:C31H42O18Purity:97.56%Color and Shape:SolidMolecular weight:702.65m-PEG3-Boc
CAS:m-PEG3-Boc is a PROTAC linker derived from PEG and alkyl/ether, utilized in the synthesis of PROTACs[1].Formula:C12H24O5Purity:98%Color and Shape:SolidMolecular weight:248.32ARN19689
CAS:<p>ARN19689, a potent non-covalent human NAAA inhibitor, IC50=0.042μM.</p>Formula:C19H27N5O4SColor and Shape:SolidMolecular weight:421.51GABA receptor Antagonist 1
<p>GABA receptor Antagonist 1 (compound 7w) effectively inhibits the Px RDL1 GABAR at an IC50 of 7.08 nmol/L and demonstrates insecticidal efficacy against P.</p>Purity:98%Color and Shape:Odour SolidGuanfu base H
CAS:<p>Guanfu base H, a diterpenoid from Aconitum coreanum, inhibits malaria strains TM4/8.2 and K1CB1 with IC50s of 4 μM, 3.6 μM.</p>Formula:C22H34ClNO2Purity:98%Color and Shape:SolidMolecular weight:379.96Larsucosterol sodium
CAS:<p>Larsucosterol sodium: a liver-derived cholesterol byproduct; modulates lipid synthesis, inflammation, and cell death regulation.</p>Formula:C27H46NaO5SColor and Shape:SolidMolecular weight:505.71Isocucurbitacin B
CAS:Isocucurbitacin B has significant activities against HeLa and HT-29 human cancer cells with IC50 values ranging from 0.93 to 9.73uM.Formula:C32H46O8Purity:99.84%Color and Shape:SolidMolecular weight:558.7Lividomycin
CAS:<p>Lividomycin is a representative of the pseudo-tetrasaccharide group among the NEO-type AGAs.</p>Formula:C29H55N5O18Color and Shape:SolidMolecular weight:761.776Psammaplin A
CAS:<p>Psammaplin A: marine-derived, inhibits HDAC/DNA methyltransferases, strong DAC1 blocker (IC50=0.9nM), antimicrobial against Gram-positive bacteria, anticancer.</p>Formula:C22H24Br2N4O6S2Color and Shape:SolidMolecular weight:664.389-O-Feruloyl-5,5'-dimethoxylariciresinol
CAS:<p>(+)-9'-O-trans-feruloyl-5,5'-dimethoxylariciresinol potentially inhibits histamine and is cytotoxic to some cancer cells; ED50 9.86-12.68 µg/ml.</p>Formula:C32H36O11Purity:98%Color and Shape:SolidMolecular weight:596.62(±)13(14)-DiHDPA
CAS:(±)13(14)-DiHDPA is a metabolite of docosahexaenoic acid that is produced via oxidation by cytochrome P450 epoxygenases.Formula:C22H34O4Color and Shape:SolidMolecular weight:362.51Biotin-Vitamin B12
Biotin-Vitamin B12, a biotinylated form, is crucial for brain, nervous system function, and blood formation.Formula:C73H102CoN16O16PSColor and Shape:SolidMolecular weight:1581.66Antiviral agent 38
CAS:(6R)-6-Tert-butyl-10-(3-methoxypropoxy)-dihydro-2-oxo-indazole carboxylic acid has antiviral and antibacterial properties, useful for Hepatitis B research.Formula:C23H27N3O5Purity:99.99%Color and Shape:SoildMolecular weight:425.48Bis-5,5-nortrachelogenin
CAS:Bis-5,5-nortrachelogenin has anti-allergic activity, it inhibited NO production with IC50 value of 48.6 microM.Formula:C40H42O14Purity:98%Color and Shape:SolidMolecular weight:746.75N-(Boc-PEG2)-N-bis(PEG3-azide)
CAS:N-(Boc-PEG2)-N-bis(PEG3-azide) is a polyethylene glycol (PEG)-derived linker used for the synthesis of proteolysis targeting chimeras (PROTACs)[1].Formula:C28H53N7O11Purity:98%Color and Shape:SolidMolecular weight:663.76Triptohypol F
CAS:Triptohypol F is a natural product for research related to life sciences. The catalog number is TN5184 and the CAS number is 268541-26-0.Formula:C31H52O2Purity:98%Color and Shape:SolidMolecular weight:456.74ω-Conotoxin CVIF
<p>ω-Conotoxin CVIF is a selective inhibitor of Ca v 2.2 channels, demonstrating an IC50 value of 34.3 nM in isolated rat DRG neurons.</p>Formula:C101H170N40O33S6Purity:98%Color and Shape:SolidMolecular weight:2665.076-Chloro-2,4-dibromophenol
CAS:<p>6-Chloro-2,4-dibromophenol (2,4-dibromo-6-chlorophenol) is a marine derived natural products found in Pseudoalteromonas luteoviolacea.</p>Formula:C6H3Br2ClOPurity:99.92%Color and Shape:SolidMolecular weight:286.35N,N'-Diacetyl-L-cystine
CAS:<p>DiNAC is a disulphide dimer with immune-modulating effects and reduces atherosclerosis in WHHL rabbits; also modulates rodent sensitivity reactions.</p>Formula:C10H16N2O6S2Purity:98.76%Color and Shape:White PowderMolecular weight:324.37Gly6
CAS:Gly6 is a linear peptide with six amino acids.Formula:C12H20N6O7Purity:98%Color and Shape:White To Off- White PowderMolecular weight:360.32Prometaphanine
CAS:Prometaphanine is a natural product for research related to life sciences. The catalog number is TN4832 and the CAS number is 6858-85-1.Formula:C20H25NO5Purity:98%Color and Shape:SolidMolecular weight:359.422Isoelemicin
CAS:Isoelemicin is a natural product of Erythrina, Fabaceae.Formula:C12H16O3Purity:98%Color and Shape:SolidMolecular weight:208.25Daphniyunnine B
CAS:Daphniyunnine B is a natural product from Daphniphyllum macropodum Miq.Formula:C21H29NO3Purity:98%Color and Shape:SolidMolecular weight:343.46Motilin, canine
CAS:<p>Motilin canine, a 22-amino acid peptide, functions as a robust gastrointestinal smooth muscle contraction agonist.</p>Formula:C120H194N36O34Purity:98%Color and Shape:SolidMolecular weight:2685.05Ptelatoside B
CAS:<p>Ptelatoside B is a natural product of Pteridium, Pteridiaceae.</p>Formula:C20H28O10Purity:98%Color and Shape:SolidMolecular weight:428.4314-Deoxy-11,12-didehydroandrographiside
CAS:14-Deoxy-11,12-didehydroandrographiside is a natural product of Andrographis, Acanthaceae.Formula:C26H38O9Purity:98%Color and Shape:SolidMolecular weight:494.57Palmitoyl thio-PC
CAS:<p>Thioester glycerophospholipids with Ellman's react for colorimetric PL activity measurement; absorb at 412 nm.</p>Formula:C40H80NO7PSColor and Shape:SolidMolecular weight:750.11MS023 (hydrochloride) (1831110-54-3 free base)
MS023 is a type I PRMT inhibitor (IC50: 20, 119, 83, 8, and 8 nM for PRMT1, 3, 4, 6, and 8, respectively).Formula:C17H25N3O·3HClPurity:98%Color and Shape:SolidMolecular weight:396.8JC-10
CAS:JC-10 is a potent inhibitor of metalloproteinases and is often used as a probe.Formula:C25H29Cl2IN4Purity:95%Color and Shape:SolidMolecular weight:583.34Guamecycline
CAS:<p>Guamecycline is a biochemical.</p>Formula:C29H38N8O8Color and Shape:SolidMolecular weight:626.671MT189
CAS:<p>MT189 (Antiproliferative agent-14) inhibits tubulin polymerization (IC50 3.41 μM), arrests G2/M cell cycle, and is highly antiproliferative.</p>Formula:C21H18FN3O2Purity:98.52%Color and Shape:SoildMolecular weight:363.38GLP-1(32-36)amide acetate
<p>GLP-1(32-36)amide acetate, a pentapeptide from GLP-1, inhibits weight gain and regulates glucose in diabetic mice.</p>Formula:C27H54N10O7Purity:97.93%Color and Shape:SoildMolecular weight:630.78Pam2CSK4 Biotin
biotinylated Pam2CSK4, a toll-like receptor 2/6 agonistFormula:C87H162N14O16S2Purity:98%Color and Shape:SolidMolecular weight:1724.44Botryodiplodin
CAS:Antibiotic botryodiplodin from Botryodiplodia has anti-leukemia effects, turns skin pink in 2-3 hrs, and comes from Penicillium carneo-lutescens.Formula:C7H12O3Purity:98%Color and Shape:SolidMolecular weight:144.17(15:3)-Anacardic acid
CAS:<p>(15:3)-Anacardic acid is a useful organic compound for research related to life sciences. The catalog number is T126498 and the CAS number is 103904-73-0.</p>Formula:C22H30O3Color and Shape:SolidMolecular weight:342.479Dolastatin 10 trifluoroacetate
<p>Dolastatin 10 trifluoroacetate, a marine-derived antimitotic polypeptide, inhibits tubulin polymerization and vincristine binding, aiding antitumor treatments.</p>Formula:C44H69F3N6O8SPurity:98%Color and Shape:SolidMolecular weight:899.11Peptide T
CAS:Peptide T, an HIV-1 derived octapeptide, may inhibit gp120 binding to CD4 and cytokines, and affect VIP receptors.Formula:C35H55N9O16Purity:98%Color and Shape:SolidMolecular weight:857.86PROTAC BRD4 ligand-2 hydrochloride
<p>PROTAC BRD4 Ligand-2 Hydrochloride serves as a ligand targeting the BRD4 protein, specifically designed for use with PROTAC CFT-2718.</p>Formula:C22H18Cl2N6Purity:98%Color and Shape:SolidMolecular weight:437.32NO2-SPP-sulfo
CAS:NO2-SPP-sulfo is a cleavable linker vital in ADC synthesis.Formula:C14H15N3O9S3Color and Shape:SolidMolecular weight:465.481-Bromo-1,1-dichloroacetone
CAS:<p>1-Bromo-1,1-dichloroacetone, classified as a chlorine dioxide disinfection byproduct (DBP), is present in drinking water.</p>Formula:C3H3BrCl2OColor and Shape:SolidMolecular weight:205.87Boc-NH-PEG23-CH2CH2N3
<p>Boc-NH-PEG23-CH2CH2N3 is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.</p>Formula:C53H106N4O25Purity:98%Color and Shape:SolidMolecular weight:1199.42PC-Biotin-PEG4-NHS carbonate
CAS:<p>PC-Biotin-PEG4-NHS carbonate is a polyethylene glycol (PEG) derived linker employed for the synthesis of proteolysis-targeting chimeras (PROTACs)[1].</p>Formula:C35H50N6O14SPurity:98%Color and Shape:SolidMolecular weight:810.87Xuelianlactone
CAS:<p>Xuelianlactone is a biochemical.</p>Formula:C15H20O3Color and Shape:SolidMolecular weight:248.32Persicoside
CAS:Persicoside exhibits radical scavenging activity against 2,2-diphenyl-1-picrylhydrazyl (DPPH) radical.Formula:C23H26O11Purity:98%Color and Shape:SolidMolecular weight:478.45AcrB-IN-2
CAS:Efflux pump-IN-2 is an AcrB inhibitor that boosts antibiotic effects and blocks Nile Red efflux, non-toxic to nematodes.Formula:C30H35NO6Color and Shape:SolidMolecular weight:505.60Thiol-PEG9-alcohol
Thiol-PEG9-alcohol is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C18H38O9SPurity:98%Color and Shape:SolidMolecular weight:430.55TMRM
CAS:<p>TMRM is a cell-permeant cationic lipophilic red fluorescent dye (λex: 530 nm, λem: 592 nm).</p>Formula:C25H25N2O3Purity:98%Color and Shape:SolidMolecular weight:401.48Lathodoratin
CAS:<p>Lathodoratin is a bioactive chemical.</p>Formula:C11H10O4Color and Shape:SolidMolecular weight:206.19SL-01
CAS:SL-01, an oral gemcitabine derivative, potently induces apoptosis to hinder breast cancer more effectively than gemcitabine.Formula:C18H18ClNO3Purity:98%Color and Shape:White PowderMolecular weight:331.79Isonardoperoxide
CAS:Isonardoperoxide shows strong antimalarial activity against Plasmodium falciparum malaria (6.0 × 10-7 M).Formula:C15H22O4Purity:98%Color and Shape:SolidMolecular weight:266.33Danshenol B
<p>Danshenol B is a natural product that can be used as a reference standard.</p>Formula:C22H26O4Color and Shape:SolidMolecular weight:354.446Myricananin A
CAS:Myricadenin A exhibits anti-inflammatory activities in the iNOS assay with EC50 values of 18.1 uM.Formula:C20H24O5Purity:98%Color and Shape:SolidMolecular weight:344.407OT antagonist 3 analog
OT antagonist 3 analog is an analog of OT antagonist 3.Formula:C20H18N6O2Purity:98%Color and Shape:SolidMolecular weight:374.49AzNue5Ac
CAS:<p>9AzNue5Ac is a Neu5Ac analog that is metabolized in vivo in living cells and in mice.9AzNue5Ac binds to sialoglycans.</p>Formula:C11H18N4O8Purity:≥98%Color and Shape:SolidMolecular weight:334.28Pluviatolide
CAS:(-)-Pluviatolide can inhibit electrically-induced and acetylcholine-induced contraction in the isolated guinea-pig ileum.Formula:C20H20O6Purity:98%Color and Shape:SolidMolecular weight:356.37PROTAC CDK9 degrader-6
CAS:PROTAC CDK9 degrader-6 targets and degrades CDK9 isoforms via proteasome, with DC50 of 0.10μM and 0.14μM.Formula:C42H49Cl2N9O8Purity:98%Color and Shape:SolidMolecular weight:878.8Propargyl-PEG9-bromide
CAS:Propargyl-PEG9-bromide is a non-cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs)[1].Formula:C21H39BrO9Purity:98%Color and Shape:SolidMolecular weight:515.43PDE4 inhibitor intermediate 1
CAS:<p>PDE4 inhibitor intermediate 1 is a PDE4 inhibitor synthesis intermediate.</p>Formula:C21H29NO5Purity:98%Color and Shape:SolidMolecular weight:375.46Isosaxalin
CAS:Isosaxalin, heraclenin and heraclenol 3'-Me ether have melanin biosynthesis inhibitory activities.Formula:C16H15ClO5Purity:98%Color and Shape:SolidMolecular weight:322.74JNK2-IN-1
<p>JNK2-IN-1 (Compound J27), a selective JNK2 inhibitor with a dissociation constant (Kd) of 79.2 µM, exhibits anti-inflammatory effects by attenuating TNF-α and</p>Formula:C30H26N4O5Purity:98%Color and Shape:SolidMolecular weight:522.55OT-551 HCl
CAS:<p>OT-551 HCl is an NF-Κb inhibitor, a disubstituted hydroxylamine with antioxidant properties can be used for the treatment of cataracts and age-related macular</p>Formula:C13H24ClNO3Purity:99.71%Color and Shape:SolidMolecular weight:277.79Z 300
CAS:<p>Z 300 is a histamine H2-receptor antagonist. Z 300 inhibits acid secretion and promotes gastric mucus metabolism in the corpus region.</p>Formula:C19H30N2O3SColor and Shape:SolidMolecular weight:366.52Bromoacetamido-PEG3-azide
CAS:Bromoacetamido-PEG3-azide is a polyethylene glycol (PEG)-based linker used for the synthesis of proteolysis-targeting chimeras (PROTACs)[1].Formula:C10H19BrN4O4Purity:98%Color and Shape:SolidMolecular weight:339.19Isokaempferide
CAS:Isokaempferide shows hepatoprotective, antiproliferative, and anti-inflammatory effects, the anti-inflammatory effects can be explained, at least in part, byFormula:C16H12O6Purity:98%Color and Shape:SolidMolecular weight:300.26Ara-F-NAD+
CAS:<p>Ara-F-NAD+, an arabino analogue of NAD + , is a potent, slow-binding CD38 NADase inhibitor, with a K i of 169 nM.</p>Formula:C21H26FN7O13P2Color and Shape:SolidMolecular weight:665.421Fenthion-ethyl
CAS:<p>Fenthion-ethyl is an agricultural chemical.</p>Formula:C12H19O3PS2Color and Shape:SolidMolecular weight:306.38KYN-101
CAS:<p>KYN-101 is an and aryl hydrocarbon receptor (AHR) inhibitor with anticancer activity. KYN-101 is used for the study of breast cancer and acute myeloid leukemia.</p>Formula:C22H19FN6Purity:98.35%Color and Shape:SolidMolecular weight:386.43TPU-0037C
CAS:<p>TPU-0037C, derived from S. platensis, resembles lydicamycin and fights Gram-positive bacteria, MRSA; ineffective on Gram-negative bacteria.</p>Formula:C46H72N4O9Color and Shape:SolidMolecular weight:825.1014''-methyloxy-Genistin
CAS:4''-methyloxy-Genistin is a natural productFormula:C22H22O10Purity:98%Color and Shape:SolidMolecular weight:446.4N3-PEG3-C2-PFP ester
CAS:N3-PEG3-C2-PFP ester: a stable 3-unit PEG linker for making antibody-drug conjugates.Formula:C15H16F5N3O5Purity:98%Color and Shape:SolidMolecular weight:413.3K-252b
CAS:<p>K-252b, an indolocarbazole derived from the actinomycete Nocardiopsis, functions as a protein kinase C (PKC) inhibitor.</p>Formula:C26H19N3O5Purity:98%Color and Shape:Ready-To-Use SolutionMolecular weight:453.4517-phenyl trinor Prostaglandin F2α cyclopropyl amide
CAS:<p>17-phenyl trinor Prostaglandin F2α cyclopropyl amide (17-phenyl trinor PGF2α cyclopropyl amide) is a novel analog of 17-phenyl trinor PGF2α ethyl amide.</p>Formula:C26H37NO4Color and Shape:SolidMolecular weight:427.585Bilirubin Conjugate (sodium salt)
CAS:<p>Bilirubin conjugate is a stable, water-soluble ditaurate derivative of bilirubin meant to mimic endogenous bilirubin glucuronide derivatives.</p>Formula:C37H46N6Na2O10S2Color and Shape:SolidMolecular weight:844.91Crotonyl-CoA
CAS:<p>Crotonyl-CoA: key in butyric acid fermentation, lysine and tryptophan metabolism, crucial for fatty and amino acid processing.</p>Formula:C25H40N7O17P3SColor and Shape:SolidMolecular weight:835.61Fmoc-NH-ethyl-SS-propionic NHS ester
CAS:<p>Fmoc-NH-ethyl-SS-propionic NHS ester is a cleavable ADC linker for stable drug-antibody bonding.</p>Formula:C24H24N2O6S2Purity:98%Color and Shape:SolidMolecular weight:500.59Cyclogrifolin
CAS:Cyclogrifolin is a natural product for research related to life sciences. The catalog number is TN3743 and the CAS number is 1660156-04-6.Formula:C22H30O2Purity:98%Color and Shape:SolidMolecular weight:326.47Rankinidine
CAS:<p>Rankinidine, as an oxindole alkaloid, is isolated from Gelsemium rankinii.</p>Formula:C20H24N2O3Color and Shape:SolidMolecular weight:340.423Pancreatic Polypeptide, human
CAS:<p>Endogenous high affinity agonist for human NPY Y4 receptor (Ki = 0.056 nM). Believed to play an important role in the function of the gastrointestinal tract.</p>Formula:C185H287N53O54S2Purity:98%Color and Shape:SolidMolecular weight:4181.712,3,16,20,25-Pentahydroxycucurbita-5-ene-11,22-dio
CAS:2,3,16,20,25-Pentahydroxycucurbita-5-ene-11,22-dio is a useful organic compound for research related to life sciences.Formula:C36H58O12Color and Shape:SolidMolecular weight:682.848Mcl-1 inhibitor 3
CAS:Mcl-1 inhibitor 3 shows good pharmacokinetic properties and excellent in vivo efficacy without toxicity.Mcl-1 inhibitor 3 is a highly potent and orally activateFormula:C40H52ClF2N5O7SPurity:98%Color and Shape:SolidMolecular weight:820.39Acryl42-10
<p>Acryl42-10 serves as a covalent inhibitor for the SARS-CoV-2 Nsp14 N7-Methyltransferase, exhibiting an inhibition concentration (IC50) of 7 μM [1].</p>Formula:C20H24ClN3O4Purity:98%Color and Shape:SolidMolecular weight:405.88Tertiapin-RQ
<p>Tertiapin-RQ, an inward rectifier potassium (K+) channel-blocking peptide, exhibits antidepressant effects [1].</p>Formula:C106H175N37O25S4Purity:98%Color and Shape:SolidMolecular weight:2496.0216-phenoxy tetranor Prostaglandin F2α methyl ester
CAS:<p>Prostaglandin F2α (PGF2α) drives luteolysis and smooth muscle contraction by activating the FP receptor.</p>Formula:C23H32O6Color and Shape:SolidMolecular weight:404.5031,2-O-Dilinoleoyl-3-O-β-D-Galactopyranosylracglycerol
CAS:<p>1,2-O-Dilinoleoyl-3-O-Beta-D-Galactopyranosylracglycerol is a natural product for research related to life sciences.</p>Formula:C45H78O10Purity:98%Color and Shape:SolidMolecular weight:779.09Altersetin
<p>Altersetin is a useful organic compound for research related to life sciences and the catalog number is T130665.</p>Formula:C24H33NO4Color and Shape:SolidMolecular weight:399.5311,3-Bis(3-phenoxyphenoxy)benzene
CAS:<p>1,3-Bis(3-phenoxyphenoxy)benzene is a bioactive chemical.</p>Formula:C30H22O4Color and Shape:SolidMolecular weight:446.49Guanfu base G
CAS:Guan-fu base G is derived from the tuberous root of the Aconitum aurantium plant.Formula:C26H33NO7Purity:98%Color and Shape:SolidMolecular weight:471.551-Palmitoyl Lysophosphatidic Acid (sodium salt)
CAS:1-Palmitoyl LPA: a palmitic acid-containing LPA analog, targets GPCRs, affects cell responses, and boosts β-lactam antibiotics against Pseudomonas aeruginosa.Formula:C19H38NaO7PColor and Shape:SolidMolecular weight:432.46Cholesteryl Homo-γ-Linolenate
CAS:<p>Cholesteryl homo-γ-linolenate is a cholesterol ester.</p>Formula:C47H78O2Color and Shape:SolidMolecular weight:675.139C.I. 13900
CAS:<p>C.I. 13900: Yellow powder dye, turns brown in concentrated/diluted sulfuric acid. Used on wool, silk, nylon, leather, and for direct printing.</p>Formula:C16H12CrN4NaO9SPurity:98%Color and Shape:Dark Yellow To Brown Fine PowderMolecular weight:511.34Soyasaponin IV
CAS:<p>Soyasaponin IV has hepatoprotective activity.It also has antimutagenic activity in mammalian cells.</p>Formula:C41H66O13Purity:98%Color and Shape:SolidMolecular weight:766.95MC-PEG2-C2-NHS ester
CAS:MC-PEG2-C2-NHS ester, a noncleavable 2-unit polyethylene glycol (PEG) linker, is employed in the synthesis of antibody-drug conjugates (ADCs).Formula:C21H29N3O9Purity:98%Color and Shape:SolidMolecular weight:467.47Ginsenoside Rh7
CAS:Ginsenoside Rh7 is a natural productFormula:C36H60O9Purity:98%Color and Shape:SolidMolecular weight:636.86Rosamultic acid
<p>Rosamultic acid is a useful organic compound for research related to life sciences and the catalog number is T125342.</p>Formula:C30H46O5Color and Shape:SolidMolecular weight:486.69311-Hydroxyjasmonic acid
CAS:11-Hydroxyjasmonic acid is a natural product of Stephania, Menispermaceae.Formula:C12H18O4Purity:98%Color and Shape:SolidMolecular weight:226.271,6-Dimethyl-5-vinyl-9,10-dihydrophenanthren-2-ol
CAS:1,6-Dimethyl-5-vinyl-9,10-dihydrophenanthren-2-ol is a natural product for research related to life sciences.Formula:C18H18OPurity:98%Color and Shape:SolidMolecular weight:250.33(+)-Conocarpan
CAS:Conocarpan: antinociceptive; fights S. aureus/B. subtilis (MIC 6.25μg/ml), M. tuberculosis (MIC 15.6μg/ml); inhibits T. cruzi (IC50 8μg/ml).Formula:C18H18O2Purity:98%Color and Shape:SolidMolecular weight:266.34Tri(Amino-PEG4-amide)-amine
<p>Tri(Amino-PEG4-amide)-amine is a polyethylene glycol (PEG)-based linker compound utilized for the synthesis of proteolysis-targeting chimeras (PROTACs)[1].</p>Formula:C39H81N7O15Purity:98%Color and Shape:SolidMolecular weight:888.13-chloro-1H-indole
CAS:<p>3-chloro-1H-indole (ZINC6117681) is a marine derived natural products found in Ptychodera flava.</p>Formula:C8H6ClNPurity:97.39%Color and Shape:SolidMolecular weight:151.592'-O-Methylbroussonin C
CAS:2'-O-Methylbroussonin C is a natural product for research related to life sciences. The catalog number is TN2499 and the CAS number is 376362-03-7.Formula:C21H26O3Purity:98%Color and Shape:SolidMolecular weight:326.43Guajadial D
CAS:Guajadial D shows cytotoxicity against five human cancer cell lines.Formula:C30H34O5Purity:98%Color and Shape:SolidMolecular weight:474.5920-Deoxocarnosol
CAS:20-Deoxocarnosol: antioxidant, decays DPPH radical; nonspecific antiprotozoal via cytotoxicity.Formula:C20H28O3Purity:98%Color and Shape:SolidMolecular weight:316.441pp60 c-src (521-533) (phosphorylated)
CAS:<p>Peptide binds pp60c-src/v-src SH2, inhibiting kinase, phosphorylated at Tyr527.</p>Formula:C62H95N16O28PPurity:98%Color and Shape:Lyophilized PowderMolecular weight:1543.5Lanceolarin
CAS:Lanceolarin is a natural product for research related to life sciences. The catalog number is TN4407 and the CAS number is 15914-68-8.Formula:C27H30O14Purity:98%Color and Shape:SolidMolecular weight:578.52ent-16α,17-Dihydroxyatisan-3-one
CAS:ent-16alpha,17-Dihydroxyatisan-3-one and ent-16alpha,17-dihydroxykauran-3-one have apoptosis induction activities on L5178 human MDR1 gene-transfected mouseFormula:C20H32O3Purity:98%Color and Shape:SolidMolecular weight:320.4731-Hydroxy-2-prenylnaphthalene
CAS:1-Hydroxy-2-prenylnaphthalene is a natural product for research related to life sciences. The catalog number is TN2536 and the CAS number is 16274-34-3.Formula:C15H16OPurity:98%Color and Shape:SolidMolecular weight:212.29Exendin-4 peptide derivative
<p>Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.</p>Purity:98%Color and Shape:SolidMolecular weight:3692.15Cefquinome
CAS:<p>Cefquinome is a cephem antibiotic that inhibits Enterobacteriaceae (family [1]).</p>Formula:C23H24N6O5S2Purity:98%Color and Shape:SolidMolecular weight:528.6Oblongine
CAS:<p>Oblongine chloride lowers blood pressure in a dose-dependent manner without affecting α2-adrenergic receptors.</p>Formula:C19H24NO3Purity:98%Color and Shape:SolidMolecular weight:314.404D-Sedoheptulose 7-phosphate
CAS:<p>D-Sedoheptulose 7-phosphate, a precursor to group III heptaic acid and group IV hygromycin B, converts to NDP-heptose via similar pathways.</p>Formula:C7H15O10PPurity:98%Color and Shape:SolidMolecular weight:290.16Betamethasone acibutate
CAS:Betamethasone acibutate, a glucocorticoid, is derived from Betamethasone.Formula:C28H37FO7Purity:98%Color and Shape:SolidMolecular weight:504.59α-Isowighteone
CAS:alpha-Isowighteone is a natural product for research related to life sciences. The catalog number is TN3386 and the CAS number is 65388-03-6.Formula:C20H18O5Purity:98%Color and Shape:SolidMolecular weight:338.35BAD (103-127) (human) acetate
BAD (103-127) (human) acetate is a 25-mer Bad polypeptide from the BAD BH3 domain that antagonizes the effects of Bcl-xl.Formula:C139H216N42O41SPurity:96.97%Color and Shape:SolidMolecular weight:3163.52Enalapril
CAS:Enalapril is a dicarbocyl-containing peptide and angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity.Formula:C20H28N2O5Purity:99.47%Color and Shape:SolidMolecular weight:376.45Levorin
CAS:Levorin is a polyene series antibiotic, obtained from cultures of Actinomyces levoris.Formula:C59H84N2O18Purity:98%Color and Shape:SolidMolecular weight:1109.317Gly-Phe β-naphthylamide acetate
<p>Gly-Phe β-naphthylamide acetate is the substrate of Cathepsin C and can be used for research on the function of cathepsin C, intralysosomal hydrolysis and</p>Formula:C23H25N3O4Purity:99.56%Color and Shape:SolidMolecular weight:407.46VHL Ligand-Linker Conjugates 17
VHL Ligand-Linker Conjugates 17 are chemical compounds that consist of a VHL ligand specialized for the E3 ubiquitin ligase, as well as a PROTAC linker.Formula:C37H42N4O7Purity:98%Color and Shape:SolidMolecular weight:654.75Theogallin
CAS:Theogallin is an active ingredient in decaffeinated green tea extract, has cognition enhancing effect and antidepressive.Formula:C14H16O10Purity:98%Color and Shape:SolidMolecular weight:344.27Gizzerosine HCl
CAS:<p>Gizzerosine HCl induces histopathologic lesions in broiler chicks that increase intracellular cAMP levels in isolated chickens of origin.</p>Formula:C11H22Cl2N4O2Purity:99.53%Color and Shape:SoildMolecular weight:313.2216-O-Acetyldarutigenol
CAS:16-O-Acetyldarutigenol is a natural product of Siegesbeckia, Asteraceae.Formula:C22H36O4Purity:98%Color and Shape:SolidMolecular weight:364.52MC-VC-PABC-DNA31
CAS:MC-VC-PABC-DNA31: ADC drug-linker with DNA31 for potent cancer treatment via RNA polymerase inhibition.Formula:C77H96N10O21Purity:98%Color and Shape:SolidMolecular weight:1497.664Galanin-Like Peptide (rat)
CAS:<p>Galanin-Like Peptide (rat), a neuropeptide comprising 60 amino acids, plays a crucial role in regulating feeding, body weight, and energy metabolism [1].</p>Formula:C288H461N87O83SPurity:98%Color and Shape:SolidMolecular weight:6502.34Gersizangitide acetate
<p>Gersizangitide acetate is an inhibitor of angiogenesis.</p>Formula:C113H171N29O30Purity:98%Color and Shape:SolidMolecular weight:2415.74Isopropyl palmitate
CAS:<p>Isopropyl palmitate is the isopropyl alcohol and palmitic acid ester. It is a moisturizer, emollient, anti-static agent, and thickening agent.</p>Formula:C19H38O2Purity:98%Color and Shape:Colorless Liquid LiquidMolecular weight:298.512',5,6',7-Tetraacetoxyflavanone
CAS:<p>2',5,6',7-Tetraacetoxyflavanone is a natural product for research related to life sciences. The catalog number is TN2724 and the CAS number is 80604-17-7.</p>Formula:C23H20O10Purity:98%Color and Shape:SolidMolecular weight:456.4Thiol-PEG4-Boc
CAS:Thiol-PEG4-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C15H30O6SPurity:98%Color and Shape:SolidMolecular weight:338.46
