Amino Acids (AA)

<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>

<p>Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Asp(OcHex)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>

<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (7-34) amide (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-His-Leu-OH is a monoclonal antibody that is used in the diagnosis and treatment of prostate cancer. This drug binds to the extracellular domain of the human prostate epithelial cell antigen (PSA), which is overexpressed in prostate cancers. Z-Phe-His-Leu-OH can be used in combination with other drugs for the treatment of prostate hyperplasia, such as angiotensin II receptor antagonists or 5α reductase inhibitors. The conformational epitope of this antibody has been demonstrated by immunohistochemical analysis on human tissues.</p>

<p>Please enquire for more information about Fmoc-Leu-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Oxytocin is a hormone that is released from the pituitary gland. It has been shown to have a variety of biological effects, including stimulation of uterine contractions, breast milk production, and social behaviors such as bonding and sexual behavior. Oxytocin has also been shown to regulate the release of gamma-aminobutyric acid (GABA) in the brain. This effect may be due to oxytocin's ability to stimulate GABA receptors. In addition, oxytocin can inhibit lipolysis by inhibiting the release of fatty acids from adipose tissue. The effect on fatty acid release is due to an inhibition of phosphodiesterase activity. Oxytocin can also cause membrane hyperpolarization by increasing potassium ion flow through channels in the cell membrane. Oxytocin has also been shown to act as a growth factor for certain types of cells, such as smooth muscle cells and osteoblasts.</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Leu6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ranamargarin H-Asp-Asp-Ala-Ser-Asp-Arg-Ala-Lys-Lys-Phe-Tyr-Gly-Leu-Met-NH2 is a compound that has been shown to bind to the dopamine receptor in rats. It has been shown to have low potency and is not active in clinical trials. Ranamargarin H-Asp-Asp-Ala-Ser--Asp--Arg--Ala--Lys--Lys--Phe--Tyr--Gly--Leu---Met---NH2 has also been shown to inhibit the production of dopamine in animals and humans, with a maximal response at concentrations of 10 nM. The biological properties of this compound are still being researched, but it appears that it can be used as a lead for developing new drugs for treating Parkinson's disease.</p>

<p>Ac-Cys(farnesyl)-OH is a synthetic chemical that has been shown to inhibit the growth of cells. It inhibits the enzyme form of farnesyl protein transferase, which is involved in the synthesis of basic proteins. Ac-Cys(farnesyl)-OH also binds to and inhibits epidermal growth factor receptor, which plays an important role in cell proliferation. In addition, this compound has been found to have anti-cancer properties. Ac-Cys(farnesyl)-OH has been shown to reduce the frequency of cellular transformation in vitro and in vivo. This effect may be due to its ability to inhibit protease activity.</p>

<p>Please enquire for more information about Z-Ile-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>

<p>1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole is an organic compound that is used in the synthesis of carboxylic acid derivatives. It is a synthetic intermediate, which can be converted to other compounds by intramolecular hydrogen bonding. The efficiency of this method has been shown through a number of experiments. In nature, 1-methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole may be found as a hydrogen bond donor.</p>

<p>Arg-gly-asp is a synthetic peptide that has been shown to have biological activity in vitro. This peptide is an agonist of the receptor for extracellular matrix proteins, such as fibronectin and vitronectin. It has been shown to reversibly inhibit the binding of fibronectin and vitronectin to immobilized antibody in vitro and also to inhibit endometrial cell proliferation in vivo. Arg-gly-asp was found to be dose-dependent with a maximal effect at 1 microgram/mL.</p>

<p>H-Gly-Arg-Gly-Glu-Ser-Pro-OH is a peptide fragment of collagen that has been used in research to study the effects of this protein on fibrosis, bowel disease, and autoimmune diseases. It has also been found to be able to activate stem cells and is being studied for its application as a cell factor. This peptide fragment inhibits the growth of Candida glabrata by stimulating the production of growth factors such as β1 and colony stimulating factor. It also stimulates the production of integrin receptors, which are important for cell adhesion. H-Gly-Arg-Gly-Glu-Ser-Pro-OH has also been shown to have an antiviral effect in vivo models.</p>

<p>Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vasopressin 3-mercaptopropionyl-Tyr-Phe-Val-Asn-Cys-Pro-D-Arg-Gly-NH2 is a peptide hormone that is involved in the regulation of water balance and blood pressure. It is a vasoconstrictor and has been shown to have an inhibitory effect on cellular targets such as soluble guanylate cyclase, which are involved in the synthesis of cGMP. Vasopressin 3-mercaptopropionyl-Tyr-Phe-Val-Asn-Cys Pro D Arg Gly NH2 also binds to the oxytocin receptor, which may be responsible for its vasodilatory effect.</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Lys-His-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Trp-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-His(1-Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe-Leu <br>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe is a synthetic substrate for κ opioid receptors. It also has antinociceptive properties and may be used as a potential analgesic drug. Dynorphin A (1-13) H-Tyr-Gly-Gly <br>Dynorphin A (1-13) H Tyr Gly Gly Phe Leu D Arg Arg Arg Ile Arg Pro Lys Leu Lys OH has been shown to be effective in the treatment of humans and rats with cardiac or physiological function problems. Dynorphin A (1 13) H Tyr Gly Gly Phe Leu D Arg Arg Arg Ile Arg Pro Lys Leu Lys OH increases serum prolactin levels in humans, which may indicate that it stimulates the hypothalamus to</p>

<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide F trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>

<p>0.4-1.0 mmol/g</p>

<p>Z-Ile-Met-OH is a synthetic protease that has been used in the immobilization of κ-carrageenan. The endopeptidase activity of this protease was proved to be higher than that of trypsin and chymotrypsin. It can also be used as an immobilized enzyme for the hydrolysis of polyacrylamide.</p>

<p>Please enquire for more information about ACTH (1-39) (guinea pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Cys(Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Glu-Asp-OH is a tripeptide that is a marker for endothelial cell proliferation. This peptide sequence has been shown to promote endothelial cell function, as well as to have atherogenic properties. The hydrolysate of H-Glu-Glu-Asp-OH has been shown to inhibit the growth of endothelial cells and functions in vitro.END&gt;<br>END&gt;</p>

<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cholecystokinin Octapeptide (1-3) (desulfated) is a research chemical that has various applications in the field of chemistry and biology. This compound contains a hydrogen atom that plays a crucial role in solvation processes. It can be used in supercritical reactions due to its ability to interact with hydroxyl groups on metallic surfaces like silicon substrates. Additionally, Cholecystokinin Octapeptide (1-3) (desulfated) is utilized in thiol-ene reactions and chromatographic separations.</p>

<p>Please enquire for more information about Boc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Phe-Pro-OH is a sensor molecule that has been used in supramolecular, nanostructured, and biological applications. It is a supramolecular self-assembly process that can be applied to sensors, devices, and modules. Fmoc-Phe-Pro-OH can be used as a biological source for sensing bacteria or other molecules of interest. The structural properties of Fmoc-Phe-Pro-OH have been studied extensively and it has been found to have favorable properties for use in humans. Advances in this field are ongoing with the hope of improving the understanding of biological systems and human health.</p>

<p>Z-Val-Ala-OMe is an anti-leishmanial agent that has been shown to be a more efficient method for the treatment of leishmaniasis than current treatments. It inhibits the growth of Leishmania by inhibiting serine proteases, which are involved in the formation of amorphous material on the surface of these parasites. Z-Val-Ala-OMe is active against both subtilis and licheniformis, with a residue half life of 3 hours at pH 5.5 and 20 degrees Celsius. This drug binds to the surface of Leishmania parasites and inhibits their ability to metabolize phosphite into ethyl esters.<br>The kinetic data obtained from Z-Val-Ala-OMe was measured using immobilized cells in a microtiter plate assay system. The data collected was used to generate a graph showing an initial burst phase followed by a linear phase for up to 72 hours post incubation with the drug</p>

<p>Please enquire for more information about H-Tyr-Ile-Tyr-Gly-Ser-Phe-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-Leu-OH is a protease inhibitor that belongs to the group of peptidyl-protease inhibitors. It inhibits the activity of a wide range of proteases and is specifically active against carboxypeptidases A and B. Z-Phe-Leu-OH has been shown to be specific for these enzymes, with no inhibitory activity against other proteases such as aminopeptidases, serine proteases, or metalloproteases. The amino acid composition of this protease inhibitor is different from other inhibitors that have been studied in detail. This agent was found to be more effective than phenylmethylsulfonyl fluoride (PMSF) at inhibiting carboxypeptidase A and B.<br>Z-Phe-Leu-OH has been shown to be an acidic compound with a pKa of 5.5; however, it does not react with chloromethyl ketone</p>

<p>H-Gly-Tyr-NH2·HCl is a peptide that has been shown to have an inhibitory effect on 5-hydroxytryptamine (5-HT) receptors. It can be used as a diluent for pharmaceuticals and as a potential treatment for autoimmune diseases, which are caused by the immune system attacking healthy cells. H-Gly-Tyr-NH2·HCl has also been shown to have antiestrogenic effects in breast cancer cells. This compound may be useful for treating inflammation associated with infectious diseases, such as Stenotrophomonas maltophilia, and other inflammatory diseases, such as inflammatory bowel disease. The amide group in this peptide may also be important for its antimicrobial properties against gram negative bacteria, such as Escherichia coli.</p>

<p>Please enquire for more information about 2-Chloromethyl-4-(3-methoxypropoxy)-3-methylpyridine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>

<p>N-Methyl-4-oxo-4,5-dihydropyridine-3-carboxamide is a fine chemical that can be used as a reagent or intermediate. It is a versatile building block that can be used in the production of useful scaffolds or useful intermediates. This compound has been shown to react with many different types of chemicals, including alcohols and amines. N-Methyl-4-oxo-4,5-dihydropyridine-3-carboxamide can also be used as a reaction component in the synthesis of diverse compounds.</p>

<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pyr-Trp-OEt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Met-Met-OH is a synthetic, antifungal drug that inhibits the synthesis of fatty acids. It has been shown to inhibit the growth of E coli K-12, which is responsible for the production of toxic substances in the intestine. H-Met-Met-Met-OH inhibits peptidase activity and fatty acid synthesis by competing with other substrates for uptake into the cell. H-Met-Met-Met-OH also inhibits sugar transport, leading to a decrease in glycolysis and energy production. The drug has been used in clinical trials against Candida albicans and Cryptococcus neoformans.</p>

<p>Please enquire for more information about ACTH (3-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt is a long acting analog of LHRH. It is a biocompatible polymeric drug that has been shown to have long term efficacy in treating various autoimmune diseases and infections. The drug's efficacy may be due to its ability to bind to the specific receptors on the surface of cells that are involved in the immune response. DesGly10,D-His(Bzl)6,ProNHEt9)-LHRH acetate salt Pyr His Trp Ser Tyr D His(Bzl)-Leu Arg Pro NHEt acetate salt is an analog of LHRH and has been shown to be effective in treating cancer and allergic symptoms as well.</p>

<p>H-Ala-Pro-Ala-OH is a fluorescent amino acid residue that can be used to study the structures of proteins. This amino acid is derived from histidine, and its fluorescence intensity increases when it binds to tryptophan residues near the active site of an enzyme. H-Ala-Pro-Ala-OH has been used for the structural analysis of mutant enzymes that have been engineered to show differences in substrate binding sites. This molecule also has a fluorogenic substrate, which can be used as a replacement for traditional substrates in order to highlight specific regions of a protein or enzyme. The quantum theory was used to calculate the x-ray diffraction data, which were then analyzed using software programs such as MOLMOL and XPLOR. These datasets were then used to create molecular models of H-Ala-Pro-Ala-OH.</p>

<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>

<p>Z-Asp-Glu-Val-Asp-chloromethylketone is a reactive compound that inhibits the activity of proteases and induces neuronal death. Z-Asp-Glu-Val-Asp-chloromethylketone has been shown to induce necrotic cell death in malignant brain cells and has neurotrophic properties. It also causes mitochondrial membrane depolarization, which leads to mitochondrial cytochrome c release and subsequent apoptosis. The reaction mechanism is still unclear but it may involve hydrogen bonding between the ketone group and the amide nitrogen atom of the aspartate residue.</p>

<p>H-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH is a synthetic peptide that has been shown to have a homologous sequence with the amino acid sequence of a primary tumor. This peptide has strong binding affinity to tyrosine kinase, which is an enzyme involved in cellular signal transduction. H-Arg-Arg-Leu-Ile-Glu-Asp-Asn Glu Tyr Thr Ala Arg Gly OH has been shown to inhibit the growth of tumors and can be used as an analytical method for identifying carcinoma cells in vitro. HAAGLTEIGDATASNTTAHARGLTRALAGRGGYOH is also a potential drug for cardiovascular diseases, as it can be taken up intracellularly and may inhibit the proliferation of vascular smooth muscle cells.</p>

<p>Please enquire for more information about Tyr-Proinsulin C-Peptide (55-89) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-beta-Ala-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about MeOSuc-Lys(2-picolinoyl)-Ala-Pro-Val-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6-Bromo-1-methylindazole is an industrial chemical that can be synthesized by the reaction of formate, methanol, and indazole. The synthesis method involves the esterification of methyl formate with indazole to produce 6-bromo-1-methylindazole. It can also be synthesized by the annulation of methyl formate and cyclopentadiene followed by hydrolysis. This chemical has several isomers that are distinguished from each other based on their synthesis methods. 6-Bromo-1-methylindazole has been shown to have a hydrolysis reaction when it reacts with water, producing methyl bromide and hydrogen bromide.</p>

<p>2,3-Dibromo-N-methylmaleimide is a synthetic compound that can be used as an anticancer agent. It inhibits the proliferation of endothelial cells and induces apoptosis in cancer cells. The molecular structure of 2,3-Dibromo-N-methylmaleimide is similar to bisindolylmaleimides, which are naturally occurring compounds found in plants. 2,3-Dibromo-N-methylmaleimide is synthesized by cross coupling with magnesium and hydroxyl group using a vibrational spectroscopy technique called nmr spectra. This molecule also has amine groups that can be used for drug conjugation or activation.</p>

<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>BPP 5a is an amide-based enzyme inhibitor with potent activity against bradykinin b2 receptor. It binds to the b2 receptor and inhibits its enzymatic activity, leading to a decrease in blood pressure. BPP 5a is orally administered and has been shown to be safe and effective in clinical trials. It also has potentiation effects that are mediated by the inhibition of kininases, which leads to a decrease in circulating levels of bradykinin. BPP 5a is used as a diagnostic aid for porcine kidney disease and has been shown to inhibit the production of monoclonal antibodies.</p>

<p>Suc-Ala-Ala-Pro-Met-pNA is a proteolytic enzyme that is active at acidic pH and cleaves casein to produce smaller peptides. It has been shown to have anti-inflammatory effects in animal models of inflammatory diseases by inhibiting the production of vasoactive intestinal peptide and other inflammatory mediators. Suc-Ala-Ala-Pro-Met-pNA also has a high salt tolerance and can survive in the presence of chloromethyl ketone, which is used as a chemical tool for protein sequencing. The enzyme produces dodecyl as its cleavage product, which can be used to determine the optimal reaction conditions for this enzyme.</p>

<p>2,3,5,6-Tetra-methyl-pyrazine is a chemical compound that is structurally similar to ATP. It has been shown to inhibit the mitochondrial membrane potential and induce apoptosis in rat heart cells. 2,3,5,6-Tetra-methyl-pyrazine has also been shown to inhibit ATP synthase activity and increase lactate levels in the presence of glucose. This compound inhibits cyclase activity and increases microdialysis probe signal pathways. 2,3,5,6-Tetra-methyl-pyrazine may be useful for the treatment of myocardial infarcts.</p>

<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt is a peptide that binds to the α5β1 integrin receptor. It has been shown to inhibit the growth of carcinoma cell lines and induce apoptosis in tumor cells by binding to receptors on the surface of cancer cells. H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt has also been shown to be effective against damaged tissue, such as adhesions, and promote wound healing by stimulating collagen production. This agent also has genotoxic effects and can cause DNA damage. H-Gly-Arg-Ala-Asp-Ser-Pro -OH trifluoroacetate salt may also have an antiapoptotic effect through its ability to bind with basic proteins, proapoptotic proteins, and epidermal growth factor receptor.</p>

<p>Neurotensin (NT) is a peptide that has been implicated in the regulation of feeding behavior, cardiovascular function, and pain perception. The neurotensin receptor is a G-protein coupled receptor with seven transmembrane domains. Neurotensin binds to the receptor and activates it by inducing intracellular calcium mobilization and neurotransmitter release. This activation can be dose-dependent, as seen in experiments using rat brain slices incubated with different concentrations of NT. Neurotensin also induces maximal activation at low concentrations, which may be due to its ability to bind to both extracellular and intracellular receptors. NT binds selectively to ventral tegmental area neurons from rats, leading to increased spontaneous firing rates. Cancer cells have been shown to express high levels of neurotensin receptors on their surface membrane, which may contribute to tumorigenesis and metastasis. Neurodegenerative diseases such as Alzheimer’s disease are thought to involve alterations in the expression or</p>

<p>Please enquire for more information about For-Met-Leu-p-iodo-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-1 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Lys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-3-(2-naphthyl)-L-alanine is a supramolecular compound that functions as an inhibitor of prostate cancer cells. It inhibits the uptake of metal chelates by prostate cancer cells and stabilizes them, which may lead to a diagnostic and therapeutic agent for prostate cancer. Fmoc-3-(2-naphthyl)-L-alanine has also been shown to inhibit the growth of human serum prostate cancer cells in vitro and in vivo models. This molecule is a bifunctional compound that can be used as both an antigen and a surrogate for cytosolic prostate specific antigen (PSA) levels. Fmoc-3-(2-naphthyl)-L-alanine has been shown to bind to the PSA protein, which is normally found on the surface of prostate epithelial cells. This binding prevents it from being released into the blood circulation, where it would otherwise be measured by a PSA test</p>

<p>Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-D-Gln-OH is a chiral molecule that has been used to identify the presence of cholinergic receptors in ventricular myocytes. It is a substrate for the enzyme acetylcholinesterase, which breaks down acetylcholine, an important neurotransmitter. H-Gly-D-Gln-OH binds to nicotinic and muscarinic acetylcholine receptor sites in cardiac muscle cells and can be detected in platelet membranes after injection. The dose of H-Gly-D-Gln-OH that is injected into mice will depend on the animal's weight.</p>

<p>(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin is a vasopressor analog that has been shown to be an effective treatment for congestive heart failure by acting as an agonist at the V1 receptor. It has been shown to stimulate cyclase activity and increase levels of adenosine 3',5'-cyclic monophosphate (cAMP). This drug also stimulates the production of immunoglobulin A antibodies in mice and increases the expression of leucine aminopeptidase and immunofluorescence in rat kidney cells. Vasopressin analogs are used primarily for their vasoconstrictive properties.</p>

<p>(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone is an organic compound that has been shown to induce apoptosis in prostate cancer cells. The mechanism of this induction is not yet fully understood, but it may be due to the inhibition of the synthesis of proteins required for cell division. It also had a significant effect on locomotor activity in mice. This compound has been shown to have acute toxicities, and its phase transition temperature is below room temperature. It can be used as a fumigant and an inorganic acid, and it has been proposed as a potential fluorescence probe for natural compounds.</p>