
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,464 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38247 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Z-Pro-Met-OH
CAS:<p>Z-Pro-Met-OH is a potent inhibitor of protein kinases. It has been shown to be resistant to peptidyl and sulphonium activation and also inhibits trypsin and other proteases. Z-Pro-Met-OH is a chloromethane derivative that is both an inhibitor of protein kinases and a substrate for the enzyme, which generates a constant concentration of product in the presence of enzyme. Z-Pro-Met-OH is more sensitive than other inhibitors tested to date, with the exception of staurosporine. It has sequence similarity to mammalian proteins, but lacks homology with any known protein.</p>Formula:C18H24N2O5SPurity:Min. 95%Molecular weight:380.46 g/molH-Phe-Leu-Glu-Glu-Val-OH
CAS:<p>H-Phe-Leu-Glu-Glu-Val-OH is a synthetic amino acid molecule that is used as a substrate for protein synthesis. The solubilized and biochemically active H-Phe-Leu-Glu-Glu-Val-OH can be prepared by the reaction of glutamic acid with phenylalanine, leucine, and glycine. This product is an irreversible enzyme that has been conjugated to a linker to form a reversible linkage. A spectrometer can be used to analyze the chemical structure of this compound. It is soluble in water and has a molecular weight of 310. It contains two carboxyl groups and one amino group that are linked by amide bonds.</p>Formula:C30H45N5O10Purity:Min. 95%Molecular weight:635.71 g/mol(Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H286N54O56Purity:Min. 95%Molecular weight:4,222.63 g/molFmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H40N4O7Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:628.71 g/molH-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Homophe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Homophe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-(4-Methoxybenzoyl)acrylic acid
CAS:<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H10O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.19 g/molAc-Gln-Gln-OH
CAS:<p>Glutamine is a non-essential amino acid that is found in the cell in large amounts. It functions as a precursor of glutamate, an important neurotransmitter and intermediate in protein synthesis. Glutamine also has antioxidant properties, which may be due to its ability to donate hydrogen atoms or act as a reducing agent. Glutamine can be synthesized by glutaminase from glutamate and ammonia, but it can also be obtained from dietary sources. The uptake of glutamine is rapid at low concentrations, but becomes slower at higher concentrations. Glutamine is catabolized by the liver and kidney into glutamate and ammonia.<br>Glutamate dehydrogenase (GLDH) catalyzes the conversion of glutamate to α-ketoglutarate, producing NADH and H+.<br>The genetic mechanisms underlying the synthesis of glutamine are not well understood; however, one hypothesis states that glutamine could be synthesized from alpha-ketoglutarate via the reverse transamination reaction during periods when glucose</p>Formula:C12H20N4O6Purity:Min. 95%Molecular weight:316.31 g/molH-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH
CAS:<p>H-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH is a synthetic peptide that has been shown to have a homologous sequence with the amino acid sequence of a primary tumor. This peptide has strong binding affinity to tyrosine kinase, which is an enzyme involved in cellular signal transduction. H-Arg-Arg-Leu-Ile-Glu-Asp-Asn Glu Tyr Thr Ala Arg Gly OH has been shown to inhibit the growth of tumors and can be used as an analytical method for identifying carcinoma cells in vitro. HAAGLTEIGDATASNTTAHARGLTRALAGRGGYOH is also a potential drug for cardiovascular diseases, as it can be taken up intracellularly and may inhibit the proliferation of vascular smooth muscle cells.</p>Formula:C66H109N23O23Purity:Min. 95%Molecular weight:1,592.71 g/mol4-Nitro-Z-Gly-Trp-Gly-OH
CAS:<p>Please enquire for more information about 4-Nitro-Z-Gly-Trp-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H23N5O8Purity:Min. 95%Molecular weight:497.46 g/molZ-Leu-Arg-Gly-Gly-AMC acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Leu-Arg-Gly-Gly-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H44N8O8Purity:Min. 95%Molecular weight:692.76 g/molSuc-Ala-Ala-Val-Ala-pNA
CAS:<p>Suc-Ala-Ala-Val-Ala-pNA is a synthetic peptide that is structurally similar to the natural peptide Vasoactive Intestinal Peptide. The amino acid sequence of this peptide is identical to that of the natural peptide with the exception of two additional amino acids, Ala and Val. Suc-Ala-Ala-Val-Ala-pNA has been shown to have vasoactive properties and it can be used for the treatment of inflammatory diseases such as Crohn's disease. This peptide has also been shown to inhibit protease activity by binding to the reactive site on serine proteases, which are involved in the degradation of extracellular proteins.</p>Formula:C24H34N6O9Purity:Min. 95%Molecular weight:550.56 g/molH-D-Ala-Leu-Lys-AMC hydrochloride salt
CAS:<p>H-D-Ala-Leu-Lys-AMC hydrochloride salt is a zymogen that is the substrate for tissue plasminogen activator (tPA). It has been shown to inhibit the activity of fibrinogen and thrombin, two proteins involved in coagulation. H-D-Ala-Leu-Lys-AMC hydrochloride salt also inhibits the hydrolysis of fibrin clots by serine proteases and prevents the formation of new clots by inhibiting the activation of annexin. This drug has been shown to be effective in animal models with established atherosclerosis.</p>Formula:C25H37N5O5Purity:Min. 95%Molecular weight:487.59 g/molH-D-Val-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%5-Methoxy-3,4-dihydro-2H-pyrrole
CAS:<p>5-Methoxy-3,4-dihydro-2H-pyrrole is a chemical compound that contains a pyrrole ring. It can be found in the form of dehydrogenation and intramolecular hydrogen. 5-Methoxy-3,4-dihydro-2H-pyrrole has been shown to have antibacterial effects against Mycobacterium tuberculosis and other bacteria. 5-Methoxy-3,4-dihydro-2H-pyrrole also reacts with nitroacetate to form an aziridine, which is an intermediate in the synthesis of several pharmaceuticals. This chemical compound is used in the preparation of bipyrrole compounds such as naphthalene and alicyclic compounds such as nitrophenols.</p>Formula:C5H9NOPurity:Min. 95%Molecular weight:99.13 g/molSeminalplasmin Fragment (SPF) Analog
CAS:<p>Seminalplasmin Fragment (SPF) is a potent antibacterial agent that has been shown to inhibit the growth of Leishmania. It binds to the target cells, forming a covalent bond with the surface of the cell membrane. The SPF analog H-Pro-Lys-Leu-Leu-Lys-Thr-Phe-Leu-Ser-Lys-Trp-Ile-Gly-OH has been shown to have an increased antimicrobial spectrum due to its increased stability in acidic environments. This analog is also active against Gram positive bacteria and can be synthesized using cyclic peptide chemistry. This drug has been shown to have hemolytic activity, meaning that it inhibits red blood cell lysis by binding to phospholipids on the surface of red blood cells.</p>Formula:C76H123N17O16Purity:Min. 95%Molecular weight:1,530.89 g/molFmoc-Asn(Dod)-OH
CAS:<p>Fmoc-Asn(Dod)-OH is a pentafluorophenyl ester of the N-terminal tryptophan residue of an asparagine peptide. It is activated by alkylation with pentafluorophenyl bromoacetic acid, which attaches to the carbonyl carbon of the peptide backbone. The activated ester undergoes dehydration and amide formation in the presence of 4-methylbenzenesulfonyl chloride. This reagent can be used for efficient synthesis of peptides, such as proteins and enzymes.</p>Formula:C34H32N2O7Purity:Min. 95%Molecular weight:580.63 g/mol(Met(O2)35)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Met(O2)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O62SPurity:Min. 95%Molecular weight:4,546.04 g/molLQEQ-19 (human) trifluoroacetate salt
<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C106H170N30O34Purity:Min. 95%Molecular weight:2,408.67 g/molZ-Leu-Ala-OH
CAS:<p>Z-Leu-Ala-OH is a casein extract that has been processed by ultrafiltration to remove impurities. It is used in the diagnosis of dermatophyte infections and other diseases. Z-Leu-Ala-OH has been shown to inhibit the growth of Trichophyton mentagrophytes, an organism that causes skin infections, as well as the growth of some bacteria and fungi. In addition, this extract can be used to diagnose collagen diseases such as pancreatic disease and fibrinogen disorders.</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/mol(Pyr 110)-Prepro-Urotensin II (110-123) (rat)
CAS:<p>Please enquire for more information about (Pyr 110)-Prepro-Urotensin II (110-123) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H102N18O20S2Purity:Min. 95%Molecular weight:1,663.88 g/molAbz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N17O13Purity:Min. 95%Molecular weight:1,124.25 g/molKemptamide trifluoroacetate salt
CAS:<p>Kemptamide is a peptide that has been shown to have cytotoxic and anti-proliferative effects on renal cancer cells. It is a synthetic analogue of an endogenous peptide, Lys-Lys-Arg-Pro-Gln-Arg-Ala-Thr-Ser-Asn-Val-Phe, that is found in porcine kidney. Kemptamide’s cytotoxic activity may be due to its ability to inhibit the activity of phosphatases. Kemptamide also has regulatory properties and can modulate the expression of genes that are involved in cell growth and apoptosis. This peptide has been shown to be reactive with kidney cells, which may lead to its therapeutic effect on renal cancer.</p>Formula:C65H112N24O18Purity:Min. 95%Molecular weight:1,517.74 g/molCecropin A (1-8)-Melittin (1-18) amide
CAS:<p>Please enquire for more information about Cecropin A (1-8)-Melittin (1-18) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H233N33O29Purity:Min. 95%Molecular weight:2,794.51 g/molHIV Protease Substrate III
CAS:<p>HIV protease is a large protein that cleaves the polyprotein of HIV. This enzyme is essential for viral replication and so any drug that inhibits its function will inhibit HIV infectivity. The HIV protease substrate III, which contains histidine at position 3, has been used to study the effects of HIV proteases on different tissue types. It has been shown that this substrate can be detected in the cytoplasm and vacuole of cells infected with HIV, indicating that it may be involved in the transport process. The addition of an acidic amino acid (p-nitro-phenylalanine) to the substrate increases its antiviral activity by increasing its stability against proteolytic enzymes and allowing it to penetrate into cells more easily.</p>Formula:C58H95N19O16Purity:Min. 95%Molecular weight:1,314.49 g/molH-Phe-D-Pro-OH·HCl
CAS:<p>Please enquire for more information about H-Phe-D-Pro-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18N2O3·HClPurity:Min. 95%Molecular weight:298.77 g/mol(Lys4)-Sarafotoxin C acetate salt
CAS:<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>Formula:C105H153N27O36S5Purity:Min. 95%Molecular weight:2,529.83 g/molFmoc-Gly-Thr(Psi(Me ,Me)pro)-OH
CAS:<p>Fmoc-Gly-Thr(Psi(Me,Me)pro)-OH is a high-performance liquid chromatography (HPLC) phase. It is used for the separation of peptides and amino acids. Fmoc-Gly-Thr(Psi(Me,Me)pro)-OH is used in industrial applications to reduce pressure, as well as in the production of large quantities of liquid chromatography.</p>Formula:C24H26N2O6Purity:Min. 95%Molecular weight:438.47 g/molN-Boc-cis-4-hydroxy-L-proline methyl ester
CAS:<p>N-Boc-cis-4-hydroxy-L-proline methyl ester is a synthetic molecule that can be used to synthesize amides. It is typically prepared through a multistep process that begins with the condensation of an acid chloride and an amine. The reaction product is then treated with methyl chloroformate to produce the desired compound, which can be purified by recrystallization. N-Boc-cis-4-hydroxy-L-proline methyl ester has been used in the synthesis of nucleophilic and reactive molecules, as well as industrial processes.</p>Formula:C11H19NO5Purity:Min. 95%Color and Shape:White PowderMolecular weight:245.27 g/molZ-Tyr-Leu-OH
CAS:<p>Please enquire for more information about Z-Tyr-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O6Purity:Min. 95%Molecular weight:428.48 g/molFmoc-D-Arg(Pbf)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Cys(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Tyr-Val-Lys(biotinyl)-Asp-2,6-dimethylbenzoyloxymethylketone
CAS:<p>Ac-Tyr-Val-Lys(biotinyl)-Asp-2,6-dimethylbenzoyloxymethylketone belongs to a group of active compounds and is a cleavage product of the caspase family. It has been shown to induce apoptosis in kidney cells by cleaving the polymeric form of the protein caspase 3, which is induced by viral infection or bacterial infection. This compound is used for coinfection with HIV and HCV. Ac-Tyr-Val-Lys(biotinyl)-Asp-2,6-dimethylbenzoyloxymethylketone can also be used for detecting apoptosis in other types of cells such as erythrocytes and neutrophils.</p>Formula:C46H63N7O12SPurity:Min. 95%Molecular weight:938.1 g/mol2-(Boc-Aminomethyl)pyrrolidine
CAS:<p>Please enquire for more information about 2-(Boc-Aminomethyl)pyrrolidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O2Purity:Min. 95%Molecular weight:200.28 g/molBoc-Pro-Leu-Val-OMe
CAS:<p>Boc-Pro-Leu-Val-OMe is a peptide analog of Dolastatin 10 which has been shown to inhibit the production of ATP in mitochondria. The compound binds to the active site of bacterial topoisomerase IV, and this binding prevents the enzyme from cleaving DNA. Boc-Pro-Leu-Val-OMe is a small molecule that has an intramolecular structure, and it interacts with DNA to form a stable complex.</p>Formula:C22H39N3O6Purity:Min. 95%Molecular weight:441.56 g/mol(D-Ala2)-Leu-Enkephalin amide
CAS:<p>Hyaluronic acid is a natural component of connective tissue and synovial fluid in animals. It is a linear, unbranched polysaccharide consisting of alternating D-glucuronic acid and N-acetyl-D-glucosamine. Hyaluronic acid has been shown to be useful in the treatment of long-term diseases such as heart disease or skin conditions like eczema. It is important for the efficient production of vaccines, which are used to prevent infectious diseases such as streptococcal infections. Hyaluronic acid can also be used as a microcontroller for minimally invasive procedures. This molecule can be used as an additive in the production of metallocene catalysts to increase the efficiency of these reactions, while reducing impurities during the process. The use of hyaluronic acid has been studied extensively, with many techniques employed to study its properties and functions. Genetic factors have also been found to play a role in</p>Formula:C29H40N6O6Purity:Min. 95%Molecular weight:568.66 g/molHIV (gp120) Fragment (421-438) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H148N24O25S2Purity:Min. 95%Molecular weight:2,138.51 g/molpTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C186H313N53O44S2Purity:Min. 95%Molecular weight:4,059.94 g/molUrocortin III (mouse) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C186H312N52O52S2Purity:Min. 95%Molecular weight:4,172.92 g/molAc-Leu-Glu-His-Asp-chloromethylketone
CAS:<p>Ac-Leu-Glu-His-Asp-chloromethylketone is a creatine kinase inhibitor that prevents the conversion of ATP to ADP. It inhibits mitochondrial pathways, leading to apoptotic and proapoptotic effects. Ac-Leu-Glu-His-Asp-chloromethylketone also has a kinetic effect on cells, where it causes necrotic cell death. This compound can cause proteolytic activity, which leads to the activation of caspase 9 and matrix metalloproteinases. Ac-Leu-Glu-His-Asp chloromethylketone has been shown to have antiinflammatory properties in cellular assays, as well as an ability to inhibit the synthesis of cellular proteins.</p>Formula:C24H35ClN6O9Purity:Min. 95%Molecular weight:587.02 g/mol(Lys7)-Phalloidin trifluoroacetate
CAS:<p>Please enquire for more information about (Lys7)-Phalloidin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H49N9O9S•(C2HF3O2)xPurity:Min. 95%Molecular weight:771.88 g/molCyclo(-D-Ala-Val)
CAS:<p>Please enquire for more information about Cyclo(-D-Ala-Val) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O2Purity:Min. 95%Molecular weight:170.21 g/mol(Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H297N55O56SPurity:Min. 95%Molecular weight:4,327.84 g/molH-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt
<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H62N14O16SPurity:Min. 95%Molecular weight:1,051.09 g/molH-Ile-NHOH acetate salt
CAS:<p>H-Ile-NHOH acetate salt is an inhibitor of l-amino acid metabolism. It is a competitive inhibitor of the enzyme L-amino acid oxidase, which catalyzes the conversion of l-amino acids to alpha-keto acids and ammonia. H-Ile-NHOH acetate salt has been shown to inhibit the growth of wild type C. glutamicum in a molecular modeling study. In addition, this compound has been shown to block messenger RNA (mRNA) synthesis in a mutant strain of C. glutamicum that does not have the frameshifting mutation. H-Ile-NHOH acetate salt is also known to be an inhibitor of fatty acid biosynthesis by blocking the activity of acyl carrier protein synthetase and acyl carrier protein reductase.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/mol(2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate
CAS:<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O4Purity:Min. 95%Molecular weight:244.29 g/molBoc-Pen (NPys)-OH
CAS:<p>Please enquire for more information about Boc-Pen (NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N3O6S2Purity:Min. 95%Molecular weight:403.48 g/molAbz-Gly-Ile-Val-Arg-Ala-Lys(Dnp)-OH
CAS:<p>Abz-Gly-Ile-Val-Arg-Ala-Lys(Dnp)-OH is a protease inhibitor that has been shown to inhibit the activity of proteinases, such as collagenase, elastase and cathepsin G. It also inhibits the growth of leishmania parasites. Abz-Gly-Ile-Val-Arg-Ala-Lys(Dnp)-OH was also found to be potent in inhibiting the proteolytic activity of cancer cells. The inhibition is due to its ability to form tight complexes with the active site of enzymes such as trypsin and chymotrypsin. This compound has potential for use in animal experiments and in vitro assays.</p>Formula:C41H61N13O12Purity:Min. 95%Molecular weight:928 g/molH-Lys(4-nitro-Z)-pyrrolidide·HCl
CAS:<p>Please enquire for more information about H-Lys(4-nitro-Z)-pyrrolidide·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H26N4O5·HClPurity:Min. 95%Molecular weight:414.88 g/mol2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride
CAS:<p>Please enquire for more information about 2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H27ClN2O2Purity:Min. 95%Molecular weight:290.83 g/molNeuromedin S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C193H307N57O49SPurity:Min. 95%Molecular weight:4,241.92 g/mol4-Amino-2-methylbenzoic acid
CAS:<p>4-Amino-2-methylbenzoic acid is a low molecular weight compound that has been shown to inhibit the neuraminidase enzyme. It interacts with the imine group of the enzyme and forms a covalent bond, which prevents the release of sialic acid from the terminal sugar residue of glycoproteins. The inhibition of this enzyme leads to decreased bacterial growth. 4-Amino-2-methylbenzoic acid has been shown to be active against Gram positive bacteria such as Staphylococcus aureus and Streptococcus pneumoniae, but not against Gram negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. This compound is also able to inhibit the synthesis of c-reactive protein (CRP) in human erythrocytes.</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/mol3-(Boc-amino)pyridine
CAS:<p>3-(Boc-amino)pyridine is a glycine derivative with a trigonal, chelate ring. It can be hydrolyzed by acid to form 3-aminopyridine. 3-(Boc-amino)pyridine has been shown to react with trimethyltin chloride to form an intramolecular complex in the presence of alkyllithiums. This reaction proceeds through lithiation and methylation of the carboxyl group of 3-(Boc-amino)pyridine. The interaction between 3-(Boc-amino)pyridine and trimethyltin chloride forms an antiaromatic six membered ring that resembles a benzene molecule.</p>Formula:C10H14N2O2Purity:Min. 95%Molecular weight:194.23 g/molH-Arg-Phe-NH2 hydrochloride salt
CAS:<p>H-Arg-Phe-NH2 hydrochloride salt (H-RF) is a physiological agent that has been shown to have effects on the response element binding protein. H-RF is a small, water soluble molecule that has been shown to act as an agonist for peptides and cation channels in vitro. The peptides are involved in the regulation of cardiac function and locomotor activity, while the cation channel regulates the opening and closing of potassium channels. The binding of H-RF to these receptors leads to positive changes in energy metabolism, which may be due to its ability to activate ATPase. H-RF also binds strongly to disulfide bonds found in proteins such as peptide hormones and enzymes. These disulfide bonds are important for maintaining protein structure and function.</p>Formula:C15H24N6O2Purity:Min. 95%Molecular weight:320.39 g/molH-Glu-Ala-Gly-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-Tyr-Thr-Trp-Thr-Gly-Ala-OH
CAS:<p>H-Glu-Ala-Gly-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-Tyr-Thr-Trp-Thr-Gly-Ala is a peptide that is synthesized and expressed in the laboratory. It has been shown to have a constant amino acid sequence, which can be used as a control for protein studies. This peptide is unreactive with surrounding environments and does not undergo photochemical reactions. HAGGS has also been shown to be thermostable, yielding high yields of protein from it. The reactive nature of this peptide makes it unsuitable for use in solvents other than water or buffers containing water. HAGGS has been shown to have proteolytic activity against the hepatitis virus, HIV, and influenza virus. This peptide's fluorescence emission maxima is at 270 nm, which allows it to be observed under UV light.</p>Formula:C81H119N19O30S2Purity:Min. 95%Molecular weight:1,903.05 g/mol(Tyr0)-Apelin-13 (human, bovine, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr0)-Apelin-13 (human, bovine, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H120N24O18SPurity:Min. 95%Molecular weight:1,714 g/molAc-Trp-Glu-His-Asp-AMC
CAS:<p>Ac-Trp-Glu-His-Asp-AMC is a monomer that is expressed by baculoviruses. Cryo-electron microscopy has shown that Ac-Trp-Glu-His-Asp-AMC oligomerizes in the presence of caspase inhibitors. This polypeptide also activates caspase 1, which is involved in the inflammatory response. The activation of this enzyme is dependent on the proteolytic activity of the polypeptide and its stereoisomers. Acetylcholine receptor antagonists, such as coumarin derivatives, inhibit the activity of Ac-Trp-Glu-His-Asp AMC and suppress inflammation.</p>Formula:C38H40N8O11Purity:Min. 95%Molecular weight:784.77 g/molH-Phe-Gly-Gly-Phe-OH
CAS:<p>H-Phe-Gly-Gly-Phe-OH is a tetrapeptide that is synthesized by the enzyme pepsin in a high concentration. Pepsin cleaves proline from the sequence (H-Phe-Gly) and replaces it with hydroxylated phenylalanine. The peptide is soluble in 0.1 M sodium acetate, pH 5.0, but precipitates at pH 4.0 or below. It binds to sephadex G100 but not to Sepharose CL4B or Sephadex G25M, and can be denatured by heating to 100°C for 10 minutes or by exposure to metal ions such as copper(II) sulfate. H-Phe-Gly-Gly-Phe-OH has been used as an analog for the amino acid sequence Gly-Leu in order to study its effects on receptor affinity and protein stability.br>br</p>Formula:C22H26N4O5Purity:Min. 95%Molecular weight:426.47 g/mol(D-Ala2)-Dynorphin A (1-9)
CAS:<p>Please enquire for more information about (D-Ala2)-Dynorphin A (1-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H86N18O11Purity:Min. 95%Molecular weight:1,151.36 g/molMethoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H41N9O9Purity:Min. 95%Molecular weight:671.7 g/molTRAF6 Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H238N34O44Purity:Min. 95%Molecular weight:3,161.64 g/molHIV (gp120) Fragment (318-327)
CAS:<p>Please enquire for more information about HIV (gp120) Fragment (318-327) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H80N16O12Purity:Min. 95%Molecular weight:1,073.25 g/molSuc-Phe-Gly-Leu-betaNA
CAS:<p>Suc-Phe-Gly-Leu-betaNA is a synthetic peptide that has been shown to bind to glutathione, an antioxidant. It is used in a method for determining the concentration of antioxidants in a sample by injection into the gas phase. The chemical ionisation (CI) and electrospray ionisation (ESI) are used to produce ions from the peptide. The compounds are then separated using chromatography before being quantified by measuring their mass using a mass spectrometer. This process is repeated until all of the antioxidant has been eluted from the column.</p>Formula:C31H36N4O6Purity:Min. 95%Molecular weight:560.64 g/molFmoc-Lys(Boc)-Wang resin (200-400 mesh)
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Mbs-D-Arg-OH
CAS:<p>Please enquire for more information about Mbs-D-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H20N4O5SPurity:Min. 95%Molecular weight:344.39 g/molLysozyme C (46-61) (chicken) trifluoroacetate salt
CAS:<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>Formula:C72H116N22O29Purity:Min. 95%Molecular weight:1,753.82 g/molH-Ser-Leu-OH
CAS:<p>H-Ser-Leu-OH is a methylvaleric acid that is found in biological tissue and has been studied for its potential use as a pharmacological treatment. It has been shown to have anti-inflammatory effects, which may be due to its inhibition of prostaglandin synthesis. H-Ser-Leu-OH also inhibits the activity of divalent metal ions, such as magnesium and zinc, by binding to their chelating groups. This binding prevents the formation of an enzyme cell wall synthesis complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. H-Ser-Leu-OH has also shown potential as an analytical method for cancer detection. It can be used to detect carcinogenesis by detecting changes in DNA methylation patterns at the promoter region of tumor suppressor genes (e.g., RASSF1A).</p>Formula:C9H18N2O4Purity:Min. 95%Molecular weight:218.25 g/mol(Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molH-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H84N18O8Purity:Min. 95%Molecular weight:1,029.29 g/molBoc-Cys(Bzl)-OSu
CAS:<p>Boc-Cys(Bzl)-OSu is a prodrug that is metabolized by esterases to form the active compound, boc-Cys(Bzl)-OH. This molecule inhibits matrix metalloproteinase (MMP) activity and can be used for the treatment of viral infections, such as hepatitis C and HIV. Boc-Cys(Bzl)-OSu has been shown to inhibit MMPs in a number of different ways including steric interactions with the active site of MMPs and by binding to the receptor protein for these enzymes. It also has antiviral activity against HIV and other viruses.</p>Formula:C19H24N2O6SPurity:Min. 95%Molecular weight:408.47 g/molH-Thr-Lys-Pro-Pro-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H47N9O7Purity:Min. 95%Molecular weight:597.71 g/mol(Tyr0)-Atriopeptin II (rat)
CAS:<p>Please enquire for more information about (Tyr0)-Atriopeptin II (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H165N35O34S2Purity:Min. 95%Molecular weight:2,549.8 g/molH-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H91N19O16S2Purity:Min. 95%Molecular weight:1,506.71 g/molH-Lys-Tyr-Ser-OH
CAS:<p>H-Lys-Tyr-Ser-OH is a molecule that is the product of a racemase enzyme. This molecule is an acid with a pKa of 2.6, which means that it can exist as either a D or L form at pH values less than 2.6. The D form is more stable and has greater solubility in water than the L form. H-Lys-Tyr-Ser-OH stabilizes the conformation of erythromycin and other antibiotics by binding to Murein, which is the cell wall component responsible for conferring resistance to these drugs.</p>Formula:C18H28N4O6Purity:Min. 95%Molecular weight:396.44 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>Formula:C61H110N24O14Purity:Min. 95%Molecular weight:1,403.68 g/molFA-Gly-Nva-NH2
CAS:<p>Please enquire for more information about FA-Gly-Nva-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/molH-Leu-Gly-OtBu·HCl
CAS:<p>Please enquire for more information about H-Leu-Gly-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H24N2O3·HClPurity:Min. 95%Molecular weight:280.79 g/mol(Pyr 5,N-Me-Phe8, Sar 9)-Substance P (5-11)
CAS:<p>Senktide is a substance P analog that has been shown to produce tail-flick responses in animals. The maximum response of the tail-flick test can be enhanced by the administration of either dopamine or serotonin. Inhibition of metabolism is likely to be responsible for these effects, as demonstrated by experiments in Sprague-Dawley rats. Senktide is an experimental model for studying the role of substance P in the regulation of blood pressure and locomotor activity. This compound also has pressor properties that are similar to those of dopamine and serotonin, which may be due to its ability to stimulate alpha-adrenergic receptors and inhibit dopaminergic neurons via a presynaptic mechanism.</p>Formula:C43H61N9O9SPurity:Min. 95%Molecular weight:880.07 g/molProlactin-Releasing Peptide (1-31) (rat)
CAS:<p>Please enquire for more information about Prolactin-Releasing Peptide (1-31) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H242N54O43SPurity:Min. 95%Molecular weight:3,593.99 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H83N17O11Purity:Min. 95%Molecular weight:1,062.27 g/molAc-Leu-Asp-Gln-Trp-Phe-Gly-NH2
CAS:<p>Ac-Leu-Asp-Gln-Trp-Phe-Gly-NH2 is a peptide that was found to inhibit the activity of vasoactive intestinal peptide (VIP). It binds to VIP with high affinity and competitively inhibits its binding to VIP receptors. Ac-Leu-Asp-Gln-Trp-Phe-Gly-NH2 has an inhibitory effect on the maximal response of VIP in tissues, such as the intestine. This peptide also has an irritant effect on the intestine, which may be due to its competitive inhibition of VIP receptor sites. Ac-Leu-Asp-Gln-Trp-Phe Gly NH2 has been shown to have a concentration response curve for inhibiting the activity of Vip.</p>Formula:C39H51N9O10Purity:Min. 95%Molecular weight:805.88 g/molBoc-D-His(3-Bom)-OH
CAS:<p>Please enquire for more information about Boc-D-His(3-Bom)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H25N3O5Purity:Min. 95%Molecular weight:375.42 g/molAngiotensin (1-12) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H109N19O16Purity:Min. 95%Molecular weight:1,508.77 g/molH-Ala-Phe-Gly-OH
CAS:<p>Please enquire for more information about H-Ala-Phe-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/mol(3,4-Dehydro-Pro3)-Tuftsin
CAS:<p>Please enquire for more information about (3,4-Dehydro-Pro3)-Tuftsin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H38N8O6Purity:Min. 95%Molecular weight:498.58 g/molAcetyl-L-leucine amide
CAS:<p>Acetyl-L-leucine amide is a drug used to treat symptoms of depression in geriatric patients. It is an amide form of acetyl-L-leucine, which is an amino acid that plays a role in the synthesis of proteins and lipids. Acetyl-L-leucine amide has been shown to have antidepressant effects in geriatric patients with mild to moderate depression. This drug can be used as part of a combination therapy for infectious diseases, such as tuberculosis, when there is no infection or when resistance to other antibiotics has occurred. Acetyl-L-leucine amide has also been shown to be effective against cervical cancer and breast cancer cells. The synthesis of this drug involves two steps: first, reacting L-leucine with acetyl chloride; second, reacting the product with aqueous ammonia solution.</p>Formula:C8H16N2O2Purity:Min. 95%Molecular weight:172.22 g/molH-Ile-Arg-Pro-OH
CAS:<p>Please enquire for more information about H-Ile-Arg-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H32N6O4Purity:Min. 95%Molecular weight:384.47 g/molSeminal Plasma Inhibin (67-94) (human)
CAS:<p>Please enquire for more information about Seminal Plasma Inhibin (67-94) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C150H240N36O43S2Purity:Min. 95%Molecular weight:3,299.86 g/molFmoc-Val-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Val-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Angiotensin II Receptor Ligand Nicotinoyl-Tyr-Lys(Z-Arg)-His-Pro-Ile-OH
CAS:<p>Angiotensin II receptor ligand nicotinoyl-tyrosine-arginine-proline-ile (ANGII) is a peptide that acts as a potent angiotensin II receptor agonist. It can be used to anesthetize rats and cause bradykinin b2 receptor activation. ANGII has been shown to inhibit the growth of several types of tumors, such as human melanoma cells, in animal experiments. This drug also has antiangiogenic properties, which may be due to its ability to induce the production of tumor necrosis factor-α (TNF-α).</p>Formula:C52H69N13O11Purity:Min. 95%Molecular weight:1,052.19 g/molBiphalin trifluoroacetate salt (
CAS:<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>Formula:C46H56N10O10Purity:Min. 95%Molecular weight:909 g/molFmoc-Ile-Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Ile-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H26N2O5Purity:Min. 95%Molecular weight:410.46 g/molFmoc-D-Thr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Thr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Asn-Pro-Glu-Tyr(PO3H2)-OH
CAS:<p>Please enquire for more information about H-Asn-Pro-Glu-Tyr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H32N5O12PPurity:Min. 95%Molecular weight:601.5 g/molPACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>Formula:C203H331N63O53SPurity:Min. 95%Molecular weight:4,534.26 g/molSarafotoxin B trifluoroacetate salt
CAS:<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>Formula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/molAnxiety Peptide acetate salt
CAS:<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>Formula:C81H138N24O29Purity:Min. 95%Molecular weight:1,912.11 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H175N31O35S2Purity:Min. 95%Molecular weight:2,627.95 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molH-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C24H50N16O5Purity:Min. 95%Molecular weight:642.76 g/molAc-Phe-Trp-OH
CAS:<p>Please enquire for more information about Ac-Phe-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23N3O4Purity:Min. 95%Molecular weight:393.44 g/molAmyloid b-Protein (1-40) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molH-Met-His-OH
CAS:<p>H-Met-His-OH is a metabolite of methionine, which has been shown to have insulin sensitizing effects. H-Met-His-OH is produced from the reaction of methionine with hydrochloric acid and water molecule. This compound has been shown to modulate glucose metabolism by increasing insulin sensitivity in diabetic rats. It has also been shown to be able to increase estradiol levels in female mice, which may be due to its ability to inhibit protein synthesis. H-Met-His-OH also binds to histidine residues on the protein surface and may regulate protein kinetics via an unidentate mechanism.</p>Formula:C11H18N4O3SPurity:Min. 95%Molecular weight:286.35 g/mol(Lys8)-Conopressin S
CAS:<p>Please enquire for more information about (Lys8)-Conopressin S including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H73N15O10S2Purity:Min. 95%Molecular weight:1,000.25 g/molFmoc-Arg(Pbf)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Glu(Trp-OH)-OH
CAS:<p>H-Glu(Trp-OH)-OH is a synthetic immunomodulator that is used in vitro to study the immune system. H-Glu(Trp-OH)-OH has been shown to stimulate the production of antibodies by polyclonal antibodies, which inhibits the growth of bacteria. H-Glu(Trp-OH)-OH has also been shown to have anti-inflammatory properties and can inhibit lung damage caused by radiation. H-Glu(Trp-OH)-OH is not active against tuberculosis or other infectious diseases in animals because it does not cause an increase in phagocytic cells or leukocytes.</p>Formula:C16H19N3O5Purity:Min. 95%Molecular weight:333.34 g/mol1-Boc-4-Iodomethyl-Piperidine
CAS:<p>Please enquire for more information about 1-Boc-4-Iodomethyl-Piperidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20INO2Color and Shape:PowderMolecular weight:325.19 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>Formula:C139H231N43O39SPurity:Min. 95%Molecular weight:3,160.65 g/molFmoc-Leu-Ser(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Leu-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O6Purity:Min. 95%Molecular weight:480.55 g/molSuc-Ala-Ala-Val-AMC
CAS:<p>Please enquire for more information about Suc-Ala-Ala-Val-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H32N4O8Purity:Min. 95%Molecular weight:516.54 g/molH-Pro-Leu-Gly-NHOH·HCl
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-NHOH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N4O4·HClPurity:Min. 95%Molecular weight:336.81 g/molH-D-Arg(Pbf)-allyl ester hydrochloride
CAS:<p>Please enquire for more information about H-D-Arg(Pbf)-allyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H34N4O5S•HClPurity:Min. 95%Molecular weight:503.06 g/molZ-Pro-D-Leu-D-Ala-NHOH
CAS:<p>Z-Pro-D-Leu-D-Ala-NHOH is a neutralizing peptide that inhibits the activity of elastase and collagenase. It also has potent inhibitory activities against experimental infection with various microorganisms, including Streptococcus pyogenes, Staphylococcus aureus, and Pseudomonas aeruginosa. This peptide is a molecule consisting of 11 amino acids, which is synthesized in vivo by the host as a response to bacterial infections. Z-Pro-D-Leu-D-Ala-NHOH can be used for pharmaceutical preparations or techniques that require an enzyme inhibitor. The biological function of this peptide is not fully understood but it has been shown to have antiestrogenic effects.</p>Formula:C22H32N4O6Purity:Min. 95%Molecular weight:448.51 g/molBiotinyl-Asp-Glu-Val-Asp-aldehyde (pseudo acid)
CAS:<p>Biotinyl-Asp-Glu-Val-Asp-aldehyde (pseudo acid) is a biotinylated amino acid, which can be used to study the affinity of caspases and other proteases. Biotin binds to the peptide through an amide bond and the amino group on the biotin molecule reacts with reactive groups on proteins, such as lysine, cysteine, histidine, or arginine. This reaction leads to the formation of a stable link between biotin and the target protein. The biotinylated peptide can then be purified from a sample by using an affinity chromatography column that has been pre-coated with streptavidin.<br>Biotin is not toxic because it does not bind to DNA.</p>Formula:C28H42N6O12SPurity:Min. 95%Molecular weight:686.73 g/molH-Trp-Glu-OH
CAS:<p>H-Trp-Glu-OH is a fatty acid that is involved in the synthesis of proteins. It is involved in the transcription-polymerase chain reaction, which is a technique used to amplify DNA sequences. H-Trp-Glu-OH is also used in sample preparation and in the treatment of neurological disorders and diabetes. H-Trp-Glu-OH has been shown to inhibit neuronal death by inhibiting uptake and cell proliferation through hydrogen bonds with human serum and peroxisome proliferation. This compound has also been shown to have diagnostic properties for diabetes, as it can be detected in human serum after an insulin stimulus.</p>Formula:C16H19N3O5Purity:Min. 95%Molecular weight:333.34 g/molH-D-Met-Met-Met-OH
CAS:<p>Please enquire for more information about H-D-Met-Met-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H29N3O4S3Purity:Min. 95%Molecular weight:411.61 g/molFmoc-D-Cys(Mob)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Cys(Mob)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5SPurity:Min. 95%Molecular weight:463.55 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/mol4-Methylsalicylamide
CAS:<p>4-Methylsalicylamide is a chemical compound that belongs to the class of isonicotinic amides. It is a potent anti-inflammatory agent with minimal inhibitory concentration (MIC) values of 4 µg/mL for gram-positive bacteria and 8 µg/mL for gram-negative bacteria. This compound has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. 4-Methylsalicylamide has been shown to have an inhibitory effect on ring-opening, which may be due to its ability to acetylate mitochondrial membranes, altering the membrane potential. The molecular modeling studies also showed that 4MSAM binds at the same site as antibiotics such as penicillin and erythromycin in bacterial ribos</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/molFmoc-D-Ala-OH
CAS:<p>Fmoc-D-Ala-OH is a synthetic cyclic peptide that has been shown to have anticancer properties. This compound was synthesized by solid-phase chemistry and exhibits an inhibitory effect on cancer cells. Fmoc-D-Ala-OH blocks the synthesis of proteins in cancer cells, leading to cell death. It also inhibits the activity of serine proteases such as degarelix acetate, which are important for cancer cell growth and metastasis.</p>Formula:C18H17NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:311.33 g/molCRF (6-33) (human, rat)
CAS:<p>CRF (6-33) is a neuropeptide that is found in the human cerebral cortex and rat liver. It has been shown to inhibit protein synthesis and sequenced by Edmond H. Fischer, who also discovered corticotropin-releasing factor (CRF). CRF (6-33) binds to its receptor CRFR1, which activates phospholipase C and generates inositol 1,4,5-triphosphate. This leads to the release of calcium from intracellular stores and the activation of protein kinase C. The release of calcium ions into the cytosol causes an increase in intracellular levels of cAMP, which activates a series of reactions responsible for the cellular effects of CRF. CRF (6-33) has been shown to be involved in depression by controlling neurotransmitter levels.br></p>Formula:C141H231N41O43SPurity:Min. 95%Molecular weight:3,220.66 g/molH-Lys-Asn-Asn-Gln-Lys-Ser-Glu-Pro-Leu-Ile-Gly-Arg-Lys-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Lys-Asn-Asn-Gln-Lys-Ser-Glu-Pro-Leu-Ile-Gly-Arg-Lys-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H133N25O23Purity:Min. 95%Molecular weight:1,741 g/molVIP sulfoxide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H238N44O43SPurity:Min. 95%Molecular weight:3,341.8 g/molRFRP-3 (rat)
CAS:<p>Please enquire for more information about RFRP-3 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H134N26O25S2Purity:Min. 95%Molecular weight:2,020.3 g/molFmoc-Ala-(Dmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Ala-(Dmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N2O7Purity:Min. 95%Molecular weight:518.56 g/mol4-Formyl-phenyloxymethyl polystyrene resin (200-400 mesh)
<p>4-Formylphenyloxymethyl polystyrene resin (200-400 mesh) is a polymer that can be used in the synthesis of amide, aminoacylation, halides, piperidine, yields, imine, reductive amination and heterocycles. It has been shown to be especially useful for the synthesis of diazepinones. The resin is soluble in solvents such as dichloromethane and ethanol. 4-Formylphenyloxymethyl polystyrene resin can be prepared by reacting styrene with formaldehyde and phenol in a solvent such as tetrahydrofuran or pyridine at a temperature between 0°C and 50°C. This process is usually conducted under an inert atmosphere such as nitrogen or argon gas. The resin is then washed with diethylether followed by benzene to remove residual formaldehyde.</p>Purity:Min. 95%Fmoc-Tyr-Ala-OH
CAS:<p>Fmoc-Tyr-Ala-OH is a biochemical that is expressed in mammalian cells. It has been shown to activate enzymes and the production of proteins, which are essential for cell growth. Fmoc-Tyr-Ala-OH is also proteolytic and hydrolyzing, meaning it can be used to cleave proteins into smaller pieces. It has been shown to have acidic and neutral properties at different pH levels. This enzyme also has an inhibitory effect on the production of monoclonal antibodies in mcf-7 cells, which are derived from mouse mammary epithelial cells.</p>Formula:C27H26N2O6Purity:Min. 95%Molecular weight:474.51 g/molFibronectin CS-1 Fragment (1978-1982)
CAS:<p>Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is a heterocyclic peptide that has inhibitory effects on the muscle cells. It inhibits the enzyme guanosine triphosphatase, which is responsible for releasing calcium ions from its intracellular storage site. Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is an analog of the human protein fibronectin, and it can be used as a synthetic molecule to study how integrin receptors interact with different sequences of amino acids.</p>Formula:C26H45N5O10Purity:Min. 95%Molecular weight:587.66 g/molNeuropeptide FF (5-8) acetate salt
CAS:<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H39N9O5Purity:Min. 95%Molecular weight:545.63 g/molFmoc-b-(2-thienyl)-L-alanine
CAS:<p>Please enquire for more information about Fmoc-b-(2-thienyl)-L-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H19NO4SPurity:Min. 95%Molecular weight:393.46 g/molH-Gly-Gly-bNA·HBr
CAS:<p>Please enquire for more information about H-Gly-Gly-bNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O2·HBrPurity:Min. 95%Molecular weight:338.2 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H229N45O37Purity:Min. 95%Molecular weight:3,050.52 g/molAcetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH
CAS:<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N17O15Purity:Min. 95%Molecular weight:1,338.51 g/mol(R)-2-Methylmorpholine
CAS:<p>(R)-2-Methylmorpholine is a protease inhibitor that has been shown to inhibit HIV-1 protease, a class of enzymes that are involved in the replication of HIV-1. It is used as a research tool to study the structure and function of HIV-1 protease. (R)-2-Methylmorpholine binds to the active site of the enzyme by forming hydrophobic interactions with residues in the active site. This binding leads to an inhibitory effect on ligand binding, protein synthesis, and other cellular processes. Molecular modeling studies have shown that (R)-2-Methylmorpholine inhibits HIV-1 protease by blocking the catalytic cleft and preventing access to substrate residues.</p>Formula:C5H11NOPurity:Min. 95%Molecular weight:101.15 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H49FN4O14Purity:Min. 95%Molecular weight:876.88 g/mol(Nle 10)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Nle 10)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H56N8O10Purity:Min. 95%Molecular weight:748.87 g/mol(D-Cys(tBu)2,Thr(tBu)6)-Leu-Enkephalin-Thr
CAS:<p>Leu-Enkephalin is a synthetic opioid peptide that exhibits potent analgesic effects and is used in the treatment of a variety of pain syndromes. Leu-Enkephalin has been shown to have an inhibitory effect on δ-opioid receptors, which are involved in the transmission of pain signals. Leu-Enkephalin has also been shown to have an inhibitory effect on other enzymes such as aminopeptidases, proteases, and kinases. This drug has been used in the treatment of autoimmune diseases, cancer, and inflammatory diseases. Leu-Enkephalin is also known to increase locomotor activity and reduce sensitivity to pain.</p>Formula:C41H62N6O9SPurity:Min. 95%Molecular weight:815.03 g/molAc-DL-Lys(Ac)-OH
CAS:<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N2O4Purity:Min. 95%Molecular weight:230.26 g/molFmoc-α-Me-Lys(Boc)-OH
CAS:<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>Formula:C27H34N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:482.57 g/mol(Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molAmyloid β-Protein (1-37) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-37) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H274N50O55SPurity:Min. 95%Molecular weight:4,074.49 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/molL-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide
CAS:<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>Formula:C19H31N3O6Purity:Min. 95%Molecular weight:397.47 g/molH-Ala-Abu-OH
CAS:<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H14N2O3Purity:Min. 90%Color and Shape:PowderMolecular weight:174.2 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molAF-16 trifluoroacetate salt
CAS:<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>Formula:C71H119N25O25SPurity:Min. 95%Molecular weight:1,754.92 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H84N20O13Purity:Min. 95%Molecular weight:1,329.47 g/molIGF-I Analog
CAS:<p>Please enquire for more information about IGF-I Analog including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H88N14O15S2Purity:Min. 95%Molecular weight:1,249.5 g/molpTH (73-84) (human)
CAS:<p>Please enquire for more information about pTH (73-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H96N16O19Purity:Min. 95%Molecular weight:1,273.44 g/molFmoc-Tyr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-4-(Boc-amino)-L-phenylalanine
CAS:<p>Fmoc-4-(Boc-amino)-L-phenylalanine is a useful building block, which is used in the synthesis of complex compounds and research chemicals. It is also a reaction component in the synthesis of compounds. Fmoc-4-(Boc-amino)-L-phenylalanine has CAS No. 174132-31-1 and can be used as a versatile building block to produce high quality reagents.</p>Formula:C29H30N2O6Purity:Min. 98 Area-%Color and Shape:SolidMolecular weight:502.56 g/molCarboxymethyl-Phe-Leu-OH
CAS:<p>Carboxymethyl-Phe-Leu-OH (CMPLE) is a metalloprotease inhibitor that inhibits the activity of proteases, such as serine proteases and cysteine proteases. CMPLE is used to treat infectious diseases caused by bacteria, fungi, or parasites. CMPLE also has been shown to inhibit the formation of inflammatory responses in autoimmune and inflammatory diseases. This drug can be used in combination with benzalkonium chloride or monoclonal antibodies to treat hematopoietic cells. The optimum pH for this drug is 7.5, and it denatures at high temperatures. It also binds to epithelial surface glycoproteins in the gastrointestinal tract and may be useful for treating ulcers caused by Helicobacter pylori infection.</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molZ-D-Arg(Z)2-OH
CAS:<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H32N4O8Purity:Min. 95%Molecular weight:576.6 g/molFmoc-4-Cpa-4-Cpa-OH
<p>Fmoc-4-Cpa-4-Cpa-OH is a versatile building block that can be used to synthesize complex compounds with interesting biological activity. It is a reagent, speciality chemical, and useful scaffold for research chemicals. Fmoc-4-Cpa-4-Cpa-OH has been used in the synthesis of a number of biologically active compounds and as an intermediate for the synthesis of other chemical compounds.</p>Formula:C33H28Cl2N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:603.49 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>Formula:C23H34N6O9Purity:Min. 95%Molecular weight:538.55 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/mol(Pyr 6,Pro9)-Substance P (6-11)
CAS:<p>(Pyr 6,Pro 9)-Substance P (6-11) Pyr-Phe-Phe-Pro-Leu-Met-NH2 is a peptide that has been shown to have locomotor activity in rats, receptor activity, and physiological effects. This peptide binds to the κ opioid receptor and the neurokinin 1 receptor. It was found to have antimicrobial properties against gram positive bacteria and gram negative bacteria. In addition, it has been shown to be an inhibitor of fatty acid synthesis. This molecule also has been studied for its ability to treat metabolic disorders by inhibiting malonic acid production in animals.</p>Formula:C39H53N7O7SPurity:Min. 95%Molecular weight:763.95 g/molDecanoyl-Arg-Val-Arg-Lys-chloromethylketone
CAS:<p>Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is a potent activin antagonist that has been shown to inhibit follicle development in ovary cells. It also blocks the protease activity of leishmania, which is a parasite that causes cutaneous leishmaniasis. This drug binds to proteases and inhibits their activity by competing with substrates for the active site. Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is not expressed in the submandibular gland or the submaxillary gland, which are salivary glands.</p>Formula:C34H66ClN11O5Purity:Min. 95%Molecular weight:744.41 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>Formula:C11H16ClNO3Purity:Min. 95%Color and Shape:White to off white solid.Molecular weight:245.7 g/molHIV (gp120) Fragment (254-274)
CAS:<p>Please enquire for more information about HIV (gp120) Fragment (254-274) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H162N28O30SPurity:Min. 95%Molecular weight:2,208.54 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N54O56SPurity:Min. 95%Molecular weight:4,328.86 g/molErythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt
CAS:<p>Please enquire for more information about Erythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C72H99N17O17S2Purity:Min. 95%Molecular weight:1,538.79 g/molZ-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>Formula:C18H23N3O6Purity:Min. 95%Molecular weight:377.39 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/molZ-His-p-nitro-Phe-Phe-OMe
CAS:<p>Please enquire for more information about Z-His-p-nitro-Phe-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H34N6O8Purity:Min. 95%Molecular weight:642.66 g/mol1,2-Distearoyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Distearoyl-rac-glycero-3-phosphocholine is a synthetic phospholipid, which is typically derived from the hydrogenation of naturally occurring lecithins. This compound serves as a key structural component in lipid bilayers, joining polar heads with hydrophobic tails to form stable membranes.</p>Formula:C44H88NO8PPurity:Min. 95%Molecular weight:790.15 g/molH-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N4O4Purity:Min. 95%Molecular weight:260.29 g/molACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Formula:C44H59N13O10SPurity:Min. 95%Molecular weight:962.09 g/molKisspeptin-13 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H107N21O18Purity:Min. 95%Molecular weight:1,626.81 g/molH-Leu-Trp-Met-Arg-Phe-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-OH acetate salt is a molecule that transports amino acids across the cell membrane of bacteria, preventing bacterial growth. It is produced by proctolin and functional groups in dental plaque. This compound has been shown to inhibit the growth of bacteria in vitro by binding to hypochlorous acid, which is part of the antimicrobial activity of human neutrophils. H-Leu-Trp-Met-Arg-Phe-OH acetate salt has been used as a tracer for studying amino acid transport in E. coli cells and its uptake into extracellular vesicles. The product can also be used as an antiplaque agent due to its ability to inhibit the acid transport system and uptake of amino acids from the environment.</p>Formula:C37H53N9O6SPurity:Min. 95%Molecular weight:751.94 g/mol(d(CH2)51,Tyr(Et)2,Val4,Arg8,des-Gly-NH29)-Vasopressin
CAS:<p>Please enquire for more information about (d(CH2)51,Tyr(Et)2,Val4,Arg8,des-Gly-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H73N11O11S2Purity:Min. 95%Molecular weight:1,080.32 g/molIndole-3-acetic-L-alanine
CAS:<p>Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.</p>Formula:C13H14N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:246.26 g/molZ-Ile-His-OH
CAS:<p>Please enquire for more information about Z-Ile-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N4O5Purity:Min. 95%Molecular weight:402.44 g/mol1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine
CAS:<p>Please enquire for more information about 1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H76NO8PPurity:Min. 95%Molecular weight:718 g/molZ-Gly-Pro-pNA
CAS:<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>Formula:C21H22N4O6Purity:Min. 95%Molecular weight:426.42 g/molPrion Protein (118-135) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H112N18O22S2Purity:Min. 95%Molecular weight:1,597.86 g/molInsulin B (22-25)
CAS:<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N7O5Purity:Min. 95%Molecular weight:525.6 g/molPmc-S-methylisothiourea
CAS:<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Formula:C16H24N2O3S2Purity:Min. 95%Color and Shape:PowderMolecular weight:356.51 g/molLHRH (sea bream)
CAS:<p>Please enquire for more information about LHRH (sea bream) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H68N14O14Purity:Min. 95%Molecular weight:1,113.18 g/molFmoc-Gly-Phe-OH
CAS:<p>Fmoc-Gly-Phe-OH is a photolytic residue that has been synthesized by solid-phase techniques. This molecule is an immobilized linker that can be used in photolabile devices to analyze the kinetics of biological processes. Fmoc-Gly-Phe-OH can also be used in supramolecular devices and regenerative medicine to measure the diameter of cells, as well as for regenerative purposes in humans.</p>Formula:C26H24N2O5Purity:Min. 95%Molecular weight:444.48 g/molAc-Gly-Arg-Gly-NH2
CAS:<p>Please enquire for more information about Ac-Gly-Arg-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23N7O4Purity:Min. 95%Molecular weight:329.36 g/molSubstance P (5-11) trifluoroacetate salt
CAS:<p>Substance P is a bifunctional neuropeptide that acts as both a neurotransmitter and a neurohormone. The amino acid sequence of Substance P is H-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2. It is found in the brain and spinal cord, but also in other tissues such as the parotid gland and stomach. This peptide is released from nerve cells when they are stimulated by pain or anxiety, and it causes contraction of smooth muscles in the lungs, uterus, and gastrointestinal tract. Animal studies have shown that Substance P can be toxic to neonatal animals, leading to hypothyroidism and death. In vitro studies have shown that this peptide can induce the growth of glioma cells and tumors.</p>Formula:C41H60N10O9SPurity:Min. 95%Molecular weight:869.04 g/mol3-Fluoro-4-methoxybenzoic acid
CAS:<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>Formula:C8H7FO3Purity:Min. 95%Color and Shape:PowderMolecular weight:170.14 g/molLeech Osmoregulatory Factor
CAS:<p>Leech Osmoregulatory Factor H-Ile-Pro-Glu-Pro-Tyr-Val-Trp-Asp-OH (LOF) is a polyunsaturated peptide that regulates osmotic pressure. It has been purified from the leech Hirudo medicinalis and can be used in diagnosis or treatment of eye disorders, such as diabetic neuropathy, or in the treatment of diseases associated with high blood viscosity. LOF binds to the surface of cells and induces changes in cell shape. The binding of LOF to receptors on the cell membrane triggers receptor binding and subsequent activation of ion channels. This leads to an increase in water permeability across the cell membrane and increases the glomerular filtration rate. LOF also binds to monoclonal antibodies that are specific for eye disorders or other conditions associated with high blood viscosity, which may be useful for diagnosis or treatment.</p>Formula:C50H67N9O14Purity:Min. 95%Molecular weight:1,018.12 g/molFmoc-D-Asp(OMpe)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asp(OMpe)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29NO6Purity:Min. 95%Molecular weight:439.5 g/molBiotinyl-Neuropeptide W-23 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H197N37O30S2Purity:Min. 95%Molecular weight:2,810.31 g/mol(Tyr69,Ala71·72,Lys74)-C3a (69-77)
CAS:<p>Please enquire for more information about (Tyr69,Ala71·72,Lys74)-C3a (69-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H77N13O11Purity:Min. 95%Molecular weight:976.17 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molTAT 2-4 trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C132H240N66O29Purity:Min. 95%Molecular weight:3,215.75 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/molH-Leu-Leu-Tyr-OH
CAS:<p>H-Leu-Leu-Tyr-OH is a water soluble polymer that is produced by the enzymatic polymerization of L-leucine and L-tyrosine. This polymer is cytotoxic and has been shown to bind to DNA in the cell nucleus, as well as inhibit protein synthesis. H-Leu-Leu-Tyr-OH was developed as an alternative to polyethylene glycol (PEG) due to its low toxicity, high biocompatibility, and ability to be easily synthesized.</p>Formula:C21H33N3O5Purity:Min. 95%Molecular weight:407.5 g/molFmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H36N2O8Purity:Min. 95%Color and Shape:PowderMolecular weight:552.62 g/molBoc-D-Asn-ONp
CAS:<p>Please enquire for more information about Boc-D-Asn-ONp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O7Purity:Min. 95%Molecular weight:353.33 g/molNociceptin (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H100N22O15Purity:Min. 95%Molecular weight:1,381.59 g/mol(Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H300N54O59S2Purity:Min. 95%Molecular weight:4,432.95 g/mol(Val6,Ala7)-Kemptide
CAS:<p>Please enquire for more information about (Val6,Ala7)-Kemptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H61N13O9Purity:Min. 95%Molecular weight:771.91 g/mol
