
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,465 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38248 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Fmoc-D-Thr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Thr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Biphalin trifluoroacetate salt (
CAS:<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>Formula:C46H56N10O10Purity:Min. 95%Molecular weight:909 g/molH-Val-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys(4-nitro-Z)-pyrrolidide·HCl
CAS:<p>Please enquire for more information about H-Lys(4-nitro-Z)-pyrrolidide·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H26N4O5·HClPurity:Min. 95%Molecular weight:414.88 g/mol1-(4-Acetylphenyl)-2-methyl-1-propanone
CAS:<p>1-(4-Acetylphenyl)-2-methyl-1-propanone (AMP) is a synthetic analgesic that has been evaluated for the treatment of pain. It is primarily used in pharmaceuticals and medicinal preparations, as well as being a common solvent in chemical syntheses. AMP has been shown to be an effective treatment for joint pain, muscle pain, and other types of pain. The mechanism of action for this compound is unknown but may involve the inhibition of an enzyme called hydratropic acid group. This molecule also has a carboxylic acid group that undergoes detoxification through elemental analysis or mechanochemistry.</p>Formula:C12H14O2Purity:Min. 95%Molecular weight:190.24 g/molH-Ala-Ala-Tyr-Ala-Ala-OH
CAS:<p>H-Ala-Ala-Tyr-Ala-Ala-OH is a butanedione that hydrolyzes to form acetaldehyde. It is a chaperone and amide that, in the presence of water, forms peptides. The kinetic constants are dependent on the pH of the reaction. This product has been shown to have proctolin activity and is an enkephalinase inhibitor, which is involved in pain sensation. H-Ala-Ala-Tyr-Ala-Ala-OH has been used as an ion exchanger and carboxylate isomerizing agent.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molBz-Arg-Gly-Phe-Phe-Pro-4MbetaNA·HCl
CAS:<p>Please enquire for more information about Bz-Arg-Gly-Phe-Phe-Pro-4MbetaNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H55N9O7·HClPurity:Min. 95%Molecular weight:918.48 g/molLys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin
CAS:<p>Please enquire for more information about Lys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N19O14S2Purity:Min. 95%Molecular weight:1,394.67 g/molZ-Ala-Ala-pNA
CAS:<p>Z-Ala-Ala-pNA is a bifunctional endopeptidase that has regulatory and subtilisin activity. It is used to regulate the production of nitrate in microorganisms such as bacteria and fungi, which can be an important factor in the production of food products. Z-Ala-Ala-pNA is a recombinant enzyme that was developed from a strain of Bacillus subtilis. This enzyme has binding sites for both serine proteinases and sodium nitrate. It degrades proteins by cleaving them at their serine residues, releasing amino acids and peptides from the N-terminus of the protein. The regulatory function of this enzyme is due to its ability to bind to nitrate ions, thereby regulating their concentration in cells.</p>Formula:C20H22N4O6Purity:Min. 95%Molecular weight:414.41 g/molNeuropeptide AF (human) trifluoroacetate salt
CAS:<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>Formula:C90H132N26O25Purity:Min. 95%Molecular weight:1,978.17 g/molSuc-Ala-Phe-Lys-AMC acetate
CAS:<p>Suc-Ala-Phe-Lys-AMC acetate salt is a fatty acid that is metabolized by the enzyme plasminogen activator inhibitor 1 (PAI-1) to form AMC. It is used as a marker for PAI-1 activity in plasma, as well as in other extracellular fluids. Suc-Ala-Phe-Lys-AMC acetate salt has been shown to be effective in treating diseases caused by low blood sugar levels, such as diabetes mellitus type 2. Studies have also shown that it can be used to monitor the progress of metabolic disorders such as obesity and type 2 diabetes mellitus.</p>Formula:C32H39N5O8•C2H4O2Purity:Min. 95%Color and Shape:PowderMolecular weight:681.73 g/molAmylin (8-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H216N42O45Purity:Min. 95%Molecular weight:3,183.45 g/mol4-[4-(4-Methyloxy-phenyl)-piperazin-1-yl]-phenylamine
CAS:<p>4-Methyloxy-phenyl)-piperazin-1-yl]-phenylamine is an organic compound that has a reactive silicon group. It contains two phenyl groups, one of which is attached to the silicon. This compound exhibits phase equilibrium in water and can be used as a monomer for fabricating inorganic materials with orderly patterns, such as glass and metal oxides. This product also has impurities and can be grown at different rates depending on the conditions, such as temperature. The optical properties of 4-methyloxy-phenyl)-piperazin-1-yl]-phenylamine are dependent on its environment and it has been shown to have exothermic properties when reacting with iron powder.</p>Formula:C17H21N3OPurity:Min. 95%Molecular weight:283.37 g/molZ-Arg-Arg-Pro-Phe-His-Sta-Ile-His-Lys(Boc)-OMe
CAS:<p>Z-Arg-Arg-Pro-Phe-His-Sta-Ile-His-Lys(Boc)-OMe is an angiotensin II analogue that is used for the treatment of blood disorders. It inhibits angiotensin converting enzyme (ACE) and prevents the formation of angiotensin II from angiotensin I. ACE inhibitors are also used to treat diseases such as glomerular dysfunction, congestive heart failure, high blood pressure, and cirrhosis. In addition, it has been shown to be effective in treating cardiovascular diseases such as hypertension and heart disease. ZARAPROHES is a synthetic substrate for nitrosation reactions and can be used to produce monoclonal antibodies against ACE.</p>Formula:C72H110N20O15Purity:Min. 95%Molecular weight:1,495.77 g/mol(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone
CAS:<p>(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone is an organic compound that has been shown to induce apoptosis in prostate cancer cells. The mechanism of this induction is not yet fully understood, but it may be due to the inhibition of the synthesis of proteins required for cell division. It also had a significant effect on locomotor activity in mice. This compound has been shown to have acute toxicities, and its phase transition temperature is below room temperature. It can be used as a fumigant and an inorganic acid, and it has been proposed as a potential fluorescence probe for natural compounds.</p>Purity:Min. 95%4-Amino-2-methylbenzoic acid
CAS:<p>4-Amino-2-methylbenzoic acid is a low molecular weight compound that has been shown to inhibit the neuraminidase enzyme. It interacts with the imine group of the enzyme and forms a covalent bond, which prevents the release of sialic acid from the terminal sugar residue of glycoproteins. The inhibition of this enzyme leads to decreased bacterial growth. 4-Amino-2-methylbenzoic acid has been shown to be active against Gram positive bacteria such as Staphylococcus aureus and Streptococcus pneumoniae, but not against Gram negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. This compound is also able to inhibit the synthesis of c-reactive protein (CRP) in human erythrocytes.</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/molMeOSuc-Ala-Ala-Pro-Ala-chloromethylketone
CAS:<p>MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone is a peptidyl substrate for the enzyme carboxypeptidase A. This substrate has a high specificity for carboxypeptidase A and does not bind to other enzymes such as carboxypeptidase B, D, or L. The hydrophobic nature of this substrate has been shown in both hamsters and macaques. MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone also shows cardiovascular effects in both animal models. It is possible that this effect is due to the proteolytic activity of the enzyme. More research needs to be done to identify the sequence of this peptide and how it may affect humans.</p>Formula:C20H31ClN4O7Purity:Min. 95%Molecular weight:474.94 g/molH-Glu-Ala-Gly-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-Tyr-Thr-Trp-Thr-Gly-Ala-OH
CAS:<p>H-Glu-Ala-Gly-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-Tyr-Thr-Trp-Thr-Gly-Ala is a peptide that is synthesized and expressed in the laboratory. It has been shown to have a constant amino acid sequence, which can be used as a control for protein studies. This peptide is unreactive with surrounding environments and does not undergo photochemical reactions. HAGGS has also been shown to be thermostable, yielding high yields of protein from it. The reactive nature of this peptide makes it unsuitable for use in solvents other than water or buffers containing water. HAGGS has been shown to have proteolytic activity against the hepatitis virus, HIV, and influenza virus. This peptide's fluorescence emission maxima is at 270 nm, which allows it to be observed under UV light.</p>Formula:C81H119N19O30S2Purity:Min. 95%Molecular weight:1,903.05 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/mol(Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H284N54O56SPurity:Min. 95%Molecular weight:4,240.67 g/molH-Tyr-Tyr-NH2·HCl
CAS:<p>Please enquire for more information about H-Tyr-Tyr-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H21N3O4·HClPurity:Min. 95%Molecular weight:379.84 g/molAc-Trp-Glu-His-Asp-AMC
CAS:<p>Ac-Trp-Glu-His-Asp-AMC is a monomer that is expressed by baculoviruses. Cryo-electron microscopy has shown that Ac-Trp-Glu-His-Asp-AMC oligomerizes in the presence of caspase inhibitors. This polypeptide also activates caspase 1, which is involved in the inflammatory response. The activation of this enzyme is dependent on the proteolytic activity of the polypeptide and its stereoisomers. Acetylcholine receptor antagonists, such as coumarin derivatives, inhibit the activity of Ac-Trp-Glu-His-Asp AMC and suppress inflammation.</p>Formula:C38H40N8O11Purity:Min. 95%Molecular weight:784.77 g/molCyclolinopeptide B Cyclo(-Pro-Pro-Phe-Phe-Val-Ile-Met-Leu-Ile)
CAS:<p>Please enquire for more information about Cyclolinopeptide B Cyclo(-Pro-Pro-Phe-Phe-Val-Ile-Met-Leu-Ile) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H83N9O9SPurity:Min. 95%Molecular weight:1,058.38 g/molFibrinopeptide B (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>Formula:C66H93N19O25Purity:Min. 95%Molecular weight:1,552.56 g/molH-Lys-Glu-Thr-Tyr-Ser-Lys-OH
CAS:<p>Please enquire for more information about H-Lys-Glu-Thr-Tyr-Ser-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H54N8O12Purity:Min. 95%Molecular weight:754.83 g/molMyelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H114N18O21Purity:Min. 95%Molecular weight:1,543.76 g/molH-Ala-Ala-Pro-OH
CAS:<p>H-Ala-Ala-Pro-OH is a peptide. It is an inhibitor of chymotrypsin, which is an enzyme that breaks down proteins in the stomach. H-Ala-Ala-Pro-OH inhibits this enzyme by forming a covalent bond with the serine residue of chymotrypsin. The inhibition constant (Ki) for H-Ala-Ala-Pro-OH is 8.6 mM, and it has been shown to be stable at pH 2, 4, and 7.</p>Formula:C11H19N3O4Purity:Min. 95%Molecular weight:257.29 g/molH-Phe-Gly-Gly-Phe-OH
CAS:<p>H-Phe-Gly-Gly-Phe-OH is a tetrapeptide that is synthesized by the enzyme pepsin in a high concentration. Pepsin cleaves proline from the sequence (H-Phe-Gly) and replaces it with hydroxylated phenylalanine. The peptide is soluble in 0.1 M sodium acetate, pH 5.0, but precipitates at pH 4.0 or below. It binds to sephadex G100 but not to Sepharose CL4B or Sephadex G25M, and can be denatured by heating to 100°C for 10 minutes or by exposure to metal ions such as copper(II) sulfate. H-Phe-Gly-Gly-Phe-OH has been used as an analog for the amino acid sequence Gly-Leu in order to study its effects on receptor affinity and protein stability.br>br</p>Formula:C22H26N4O5Purity:Min. 95%Molecular weight:426.47 g/mol2-Hydroxy-6-methyl-4H-pyran-4-one
CAS:<p>2-Hydroxy-6-methyl-4H-pyran-4-one is a molecule that belongs to the class of acid lactones. It has been shown to have physiological effects in wild type strains of bacteria and fungi. This compound binds to nitrogen atoms and can inhibit enzyme activities, such as the diazonium salt. 2-Hydroxy-6-methyl-4H-pyran-4-one also has antimicrobial activity against Gram positive and Gram negative bacteria, along with some fungi. The antimicrobial activity is due to the hydroxy group on the compound's structure, which is a fatty acid with a hydroxyl group that gives it an acidic property. 2HMPA can be used in combination with other antimicrobial agents like triacetic acid or sodium chloride for greater effectivity against microorganisms.</p>Formula:C6H6O3Purity:Min. 95%Molecular weight:126.11 g/molFmoc-Val-Pro-OH
CAS:<p>Fmoc-Val-Pro-OH is a low molecular weight amino acid that has anticoagulant properties. It is synthesized by activating the carboxylic acid group of pipecolic acid with an N,N'-dicyclohexylcarbodiimide (DCC) activated ester of thiazolidinecarboxylic acid and then reacting it with a basic amino acid. The resulting product is a peptide consisting of Val, Pro, and OH groups. This compound has been shown to inhibit blood clotting in rats and rabbits. Fmoc-Val-Pro-OH also has been shown to be effective in preventing postoperative blood clots in dogs undergoing surgery for repair of cranial cruciate ligament rupture.</p>Formula:C25H28N2O5Purity:Min. 95%Molecular weight:436.5 g/molµ-Conotoxin GIIIA
CAS:Controlled Product<p>Conotoxins are peptides that can bind to specific receptors on the surface of cells. Their function is to regulate ion channels and thus affect cellular physiology. Conotoxin GIIIA is a disulfide-bonded peptide with a molecular weight of 5808 Da. It has been shown to inhibit Na+ channel activity in human serum, and may have diagnostic and therapeutic applications for diseases such as epilepsy. The amino acid sequence of conotoxin GIIIA is Arg-Asp-Cys-Cys-Thr-Hyp-Hyp-Lys-Lys-Cys-Lys-Asp-Arg-Gln-Cys (NH2)</p>Formula:C100H170N38O32S6Purity:Min. 95%Molecular weight:2,609.05 g/molL-m-Tyrosine
CAS:<p>L-m-Tyrosine is a nonessential amino acid that is synthesized from phenylalanine. It has been shown to have antioxidant properties and protects against oxidative injury by scavenging reactive oxygen species such as hydrogen fluoride. L-m-Tyrosine has also been shown to modulate dopamine levels in the brain and may be used in the treatment of Parkinson's disease. The biological effects of L-m-Tyrosine are mediated through the transcriptional regulation of genes encoding proteins involved in dopamine β-hydroxylase and hydrogen fluoride detoxification. L-m-Tyrosine is also an experimental model for studying drug resistance in bacteria, including methicillin resistant Staphylococcus aureus (MRSA).</p>Formula:C9H11NO3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:181.19 g/molDynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H95ClN20O12Purity:Min. 95%Molecular weight:1,323.98 g/molTRAF6 Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H238N34O44Purity:Min. 95%Molecular weight:3,161.64 g/molZ-Phe-Glu-OH
CAS:<p>Please enquire for more information about Z-Phe-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H24N2O7Purity:Min. 95%Molecular weight:428.44 g/molH-Met-Phe-Gly-OH
CAS:<p>H-Met-Phe-Gly-OH is a hydrophobic amino acid. It has been shown to be present in human proteins, and it has been used as a marker for determining the sequence of amino acids in peptides. H-Met-Phe-Gly-OH is an acidic tripeptide that can be analysed using reversed phase high performance liquid chromatography (RPHPLC). This tripeptide is found in the peptide transporter, which transports amino acids across cellular membranes. The structural studies of H-Met-Phe-Gly-OH have revealed that this tripeptide has an alpha helix conformation, with two hydrogen bonds from the backbone amides to the backbone carbonyl groups.</p>Formula:C16H23N3O4SPurity:Min. 95%Molecular weight:353.44 g/molH-Cys(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Phg-OMe
CAS:<p>Please enquire for more information about Ac-Phg-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H13NO3Purity:Min. 95%Molecular weight:207.23 g/molBig Endothelin-1 fragment (22-38) (human)
CAS:<p>Please enquire for more information about Big Endothelin-1 fragment (22-38) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H125N23O25Purity:Min. 95%Molecular weight:1,808.99 g/molpp60 c-src (521-533) (phosphorylated) trifluoroacetate salt
CAS:<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N16O28PPurity:Min. 95%Molecular weight:1,543.48 g/mol(Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H203N39O28SPurity:Min. 95%Molecular weight:2,804.33 g/molUrotensin II-Related Peptide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>Formula:C49H64N10O10S2Purity:Min. 95%Molecular weight:1,017.23 g/mol5-Methylpyrimidine-2-carboxylic acid
CAS:<p>Please enquire for more information about 5-Methylpyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6N2O2Purity:Min. 95%Molecular weight:138.12 g/molZ-Ala-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N10O6Purity:Min. 95%Molecular weight:690.79 g/molBoc-(Asp(OBzl)16)-Gastrin I (13-17) (human)
CAS:<p>Please enquire for more information about Boc-(Asp(OBzl)16)-Gastrin I (13-17) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H53N7O9SPurity:Min. 95%Molecular weight:843.99 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N54O56SPurity:Min. 95%Molecular weight:4,328.86 g/molFmoc-S-trityl-D-cysteine
CAS:<p>Fmoc-S-trityl-D-cysteine (Fmoc-SC) is a modified amino acid that is used in the synthesis of biomolecules. It can be synthesized using a stepwise process, starting with the reaction between cysteine and trityl chloride. Fmoc-SC has been shown to inhibit mitochondrial membrane potential and cell growth in cancer cells. Additionally, it has pharmacokinetic properties that make it suitable for intravenous administration. Fmoc-SC can also be used to modify proteins by reacting with hydroxyl groups on lysine residues and other nucleophiles, as well as to inhibit histone deacetylases (HDACs), which are enzymes that regulate transcriptional activity.</p>Formula:C37H31NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:585.71 g/molH-Met-Lys-OH formiate salt
CAS:<p>H-Met-Lys-OH formiate salt is an industrial chemical that can be used in the preparation of pharmaceutical preparations. It has been shown to have a potential to lower blood pressure and reduce the risk of cardiovascular diseases. H-Met-Lys-OH formiate salt is a lysine derivative that contains two amino acid residues, namely lysine and methionine. H-Met-Lys-OH formiate salt can be used as a therapeutic agent for prostate cancer by targeting tp53 mutations and radical prostatectomy. It can also be used as an antibacterial agent against gram-negative bacteria, such as Escherichia coli (E. coli).</p>Formula:C11H23N3O3SPurity:Min. 95%Molecular weight:277.38 g/molMbs-D-Arg-OH
CAS:<p>Please enquire for more information about Mbs-D-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H20N4O5SPurity:Min. 95%Molecular weight:344.39 g/molH-Glu-Tyr-Glu-OH
CAS:<p>Please enquire for more information about H-Glu-Tyr-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H25N3O9Purity:Min. 95%Molecular weight:439.42 g/molH-Val-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu-OH
CAS:<p>H-Val-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu (HVLAHR) is a synthetic peptide that has been shown to have antiinflammatory properties. The peptide binds to the epidermal growth factor receptor (EGFR) and inhibits the production of proinflammatory cytokines and chemokines, such as IL1α, IL6, IL8, and TNFα. HVLAHR also binds to calmodulin and inhibits protein kinase C (PKC) activity. It has been shown that this peptide has neuroprotective effects in vitro by binding to neurogranin and inhibiting protein phosphorylation. HVLAHR can be used as a model organism in vitro to study protein kinase activity.</p>Formula:C51H100N22O11Purity:Min. 95%Molecular weight:1,197.48 g/molH-Tyr-Trp-OH
CAS:<p>H-Tyr-Trp-OH is a synthetic, constant ligand for nuclear receptors. It has been shown to be active in the cerebral cortex, with a brain concentration of about 1 µM at steady state. This compound has been shown to be an agonist of the transcription factor nuclear receptor peroxisome proliferator-activated receptor alpha (PPARα) and can be used as a potential therapeutic agent for Alzheimer's disease. H-Tyr-Trp-OH has also been shown to enhance phosphorylation of the microtubule protein tau in cultured cortical neurons, which may have implications for the treatment of Parkinson's disease.</p>Formula:C20H21N3O4Purity:Min. 95%Molecular weight:367.4 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H301N55O56S3Purity:Min. 95%Molecular weight:4,408.01 g/mol(Trp7,β-Ala8)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Trp7,beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H57N9O10SPurity:Min. 95%Molecular weight:868.01 g/mol4-Methyl-5-formylthiazole
CAS:<p>4-Methyl-5-formylthiazole is a synthetic molecule with in vitro antifungal activity. It has been shown to inhibit the growth of Candida albicans and Aspergillus niger, two species of fungi that are responsible for the majority of opportunistic infections in immunocompromised patients. 4-Methyl-5-formylthiazole is a nucleophilic molecule that undergoes electrophilic substitution reactions, which makes it an efficient method for generating antifungal agents. The synthesis of this compound can be achieved through the condensation of methyl formate and thiourea, followed by treatment with chloride ion to produce the desired product. 4-Methyl-5-formylthiazole is also fluorescent and has electron deficient properties, which makes it useful for diagnosis and molecular modelling.</p>Formula:C5H5NOSPurity:Min. 95%Molecular weight:127.17 g/molH-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H84N18O8Purity:Min. 95%Molecular weight:1,029.29 g/molHCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H99N15O14SPurity:Min. 95%Molecular weight:1,214.52 g/molPerfluoro-N-(4-methylcyclohexyl)piperidine
CAS:Controlled Product<p>Perfluoro-N-(4-methylcyclohexyl)piperidine (4-FPP) is a fluorine compound that has been shown to inhibit the enzymatic activity of tyrosine kinases. It is a potent inhibitor of both human and murine tyrosine kinases, but it does not bind to bacterial tyrosine kinase domains. 4-FPP has been used in clinical studies as an anti-cancer drug, although it's clinical relevance remains unclear. It has also been shown to be effective against the influenza virus by inhibiting the synthesis of viral proteins that are involved in replication. The chemical structure of 4-FPP contains a carbonyl group that can react with other compounds through a photochemical process. This reaction is thought to result in the development of new drugs with similar biochemical properties to 4-FPP.</p>Formula:C12F23NPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:595.1 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/mol2-Chloromethyl-4-(3-methoxypropoxy)-3-methylpyridine hydrochloride
CAS:<p>Please enquire for more information about 2-Chloromethyl-4-(3-methoxypropoxy)-3-methylpyridine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H17Cl2NO2Purity:Min. 95%Molecular weight:266.16 g/mol(Tyr0)-Atriopeptin II (rat)
CAS:<p>Please enquire for more information about (Tyr0)-Atriopeptin II (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H165N35O34S2Purity:Min. 95%Molecular weight:2,549.8 g/molAcarbose 1,1-a,a-glycoside
CAS:<p>Please enquire for more information about Acarbose 1,1-a,a-glycoside including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H43NO18Purity:Min. 95%Molecular weight:645.6 g/molBoc-D-Asn-ONp
CAS:<p>Please enquire for more information about Boc-D-Asn-ONp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O7Purity:Min. 95%Molecular weight:353.33 g/mol(Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H91N19O16S2Purity:Min. 95%Molecular weight:1,506.71 g/molH-Lys-Tyr-Ser-OH
CAS:<p>H-Lys-Tyr-Ser-OH is a molecule that is the product of a racemase enzyme. This molecule is an acid with a pKa of 2.6, which means that it can exist as either a D or L form at pH values less than 2.6. The D form is more stable and has greater solubility in water than the L form. H-Lys-Tyr-Ser-OH stabilizes the conformation of erythromycin and other antibiotics by binding to Murein, which is the cell wall component responsible for conferring resistance to these drugs.</p>Formula:C18H28N4O6Purity:Min. 95%Molecular weight:396.44 g/molZ-D-Phe-Phe-Gly-OH
CAS:<p>Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.</p>Formula:C28H29N3O6Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:503.55 g/molH-Asp(His-OH)-OH
CAS:<p>Please enquire for more information about H-Asp(His-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N4O5Purity:Min. 95%Color and Shape:SolidMolecular weight:270.24 g/molSubstance P (4-11)
CAS:<p>Substance P (4-11) H-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a fluorescent peptide that binds to calcium and chloride ions. It has been shown to have an affinity for both peptide and calmodulin binding. This peptide has also been shown to be highly heat stable and can be used in a wide range of temperatures. The substance P (4-11) sequence is found in porcine, rat, bovine, and human proteins. The amino acid sequence is composed of 4 amino acids: proline, glutamine, phenylalanine, and leucine. This peptide's optimum pH is 7.5 with a temperature range of 35°C to 45°C. It has been shown that the activity of this peptide decreases as the concentration increases. It has also been shown to be susceptible to aminopeptidases at high concentrations or when</p>Formula:C46H67N11O10SPurity:Min. 95%Molecular weight:966.16 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H37F3N8O11Purity:Min. 95%Molecular weight:838.74 g/molFmoc-Gly-(Dmb)Gly-OH
CAS:<p>Fmoc-Gly-(Dmb)Gly-OH is a synthetic peptide that modulates cellular activity. It encompasses a wide range of activities, such as cancer cell growth and restenosis, fibroid tumors and bowel disease. Fmoc-Gly-(Dmb)Gly-OH has been shown to be an effective chemotherapeutic agent in the treatment of age-related macular degeneration and retinopathy. It also inhibits inflammatory bowel disease and infarction by restricting the production of inflammatory cytokines, such as TNFα, IL1β, and IL6. Fmoc-Gly-(Dmb)Gly-OH can be used to treat endometriosis by inhibiting angiogenesis in the uterus.</p>Formula:C28H28N2O7Purity:Min. 95%Molecular weight:504.53 g/molApelin-36 (1-16) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Apelin-36 (1-16) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H117N27O20Purity:Min. 95%Molecular weight:1,704.89 g/mol(Val6,Ala7)-Kemptide
CAS:<p>Please enquire for more information about (Val6,Ala7)-Kemptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H61N13O9Purity:Min. 95%Molecular weight:771.91 g/molDABCYL-TNF-α-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS:<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Formula:C70H104N22O18S·C2HF3O2Purity:Min. 95%Color and Shape:Red SolidMolecular weight:1,687.8 g/molH-Leu-Trp-Leu-OH
CAS:<p>H-Leu-Trp-Leu-OH is a tryptophan protease that has been shown to have aminopeptidase activity. It can be used in the treatment of intestinal inflammation, as well as other conditions where it is desirable to reduce the concentration of amino acid precursors. The oxidation products of H-Leu-Trp-Leu-OH are antigenic and can be used for the detection of this enzyme in biological fluids. Hplc analysis can identify tripeptides formed by H-Leu-Trp-Leu-OH, which are then cleaved by other enzymes. This process creates a radioactive product that can be detected using radiation or microscopy. Immunoaffinity chromatography is also able to isolate H-Leu-Trp-Leu-OH from biological fluids. Monoclonal antibodies against this enzyme have been shown to inhibit ectoenzymes such as lipases and phospholip</p>Formula:C23H34N4O4Purity:Min. 95%Molecular weight:430.54 g/molZ-Ala-Ala-Lys-4MbetaNA formiate salt
CAS:<p>Please enquire for more information about Z-Ala-Ala-Lys-4MbetaNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H39N5O6·CH2O2Purity:Min. 95%Molecular weight:623.7 g/mol3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride
CAS:<p>3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride is a chlorinated, thermosetting emulsifier that is used in the production of pressure sensitive adhesives. This compound has a high viscosity and is used as a retardant and an emulsifier. It is also used as a trichloride to produce vinyl chloride monomer. 3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride inhibits the growth of bacteria by acting as an antimicrobial agent. The mechanism of action for this compound is not fully understood but it has been shown to inhibit protein synthesis in bacteria.</p>Formula:C11H6Cl3NO2Purity:Min. 95%Molecular weight:290.53 g/molH-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%L-Lysine methyl ester 2HCl
CAS:<p>L-Lysine methyl ester 2HCl is a lysine derivative that has been synthesized by reacting L-lysine with methanol and hydrochloric acid. This compound's cytotoxicity has been demonstrated in an inhibition study using calf thymus dna. L-Lysine methyl ester 2HCl contains amide, acid, and ester linkages, as well as hydrogen bonds that are typical of natural compounds. It is also biologically active and has a molecular weight of 246.3 g/mol. The chemical structure of this compound consists of a central l-lysine molecule with two methyl groups on the nitrogen atom. The compound also contains a carboxyl group on the end of the chain and an ester group on the second carbon atom from the end of the chain. L-Lysine methyl ester 2HCl can be found in soybeans and bovine fetal tissue. It exhibits morphological properties similar to other</p>Formula:C7H16N2O2·2HClPurity:Min. 95%Color and Shape:PowderMolecular weight:233.14 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H83N17O11Purity:Min. 95%Molecular weight:1,062.27 g/mol1,2-Dihydro-1-Methyl-5-(Trifluoromethyl)-3H-Pyrazol-3-One
CAS:<p>Please enquire for more information about 1,2-Dihydro-1-Methyl-5-(Trifluoromethyl)-3H-Pyrazol-3-One including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H5F3N2OPurity:Min. 95%Molecular weight:166.1 g/molZ-D-Phe-Pro-OH
CAS:<p>D-Phe-Pro-OH is a tripeptide that is reversibly inactivated by methanol, chloromethyl ketone, and boronate esters. It can be used as an affinity label for the detection of aldehydes. This compound has been shown to be an inhibitor of protein synthesis and cell growth. It has also been used to synthesize analogs with similar properties, such as Z-D-Phe-Pro-OH.</p>Formula:C22H24N2O5Purity:Min. 95%Molecular weight:396.44 g/molOsteostatin amide trifluoroacetate
CAS:<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O57•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,450.59 g/molCys-Gly-Lys-Arg-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C220H343N63O64S2Purity:Min. 95%Molecular weight:4,958.6 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H86N18O12Purity:Min. 95%Molecular weight:1,239.43 g/molSuc-Gly-Pro-AMC
CAS:<p>AMC-conjugated molecule targeting the fibroblast activation protein (FAP)</p>Formula:C21H23N3O7Purity:Min. 95%Molecular weight:429.42 g/molZ-Arg-Arg-pNA·2 HCl
CAS:<p>Please enquire for more information about Z-Arg-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H36N10O6·2HClPurity:Min. 95%Molecular weight:657.55 g/molGastrin Tetrapeptide
CAS:<p>Gastrin tetrapeptide is a pharmacological treatment for clinical relevance. It has been shown to be an irreversible inhibitor of the histamine H2-receptor. Activated gastrin tetrapeptide has been shown to inhibit the activity of 5-hydroxytryptamine (5-HT) receptors and κ-opioid receptors in vitro, and studies have shown that it decreases glutamate release from nerve cells, which may contribute to its antiemetic properties. Gastrin tetrapeptide has also been shown to have a physiological effect on humans, with decreased 5-HT concentrations and increased gastric pH levels being observed. This peptide is used in the treatment of infectious diseases such as malaria, which causes vomiting and diarrhea.</p>Formula:C29H36N6O6SPurity:Min. 95%Molecular weight:596.7 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/mol(1-Methyl-1H-pyrazol-4-yl)boronic acid
CAS:<p>(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.</p>Formula:C4H7BN2O2Purity:Min. 95%Molecular weight:125.92 g/mol(N-Me-Phe7)-Neurokinin B trifluoroacetate salt
CAS:<p>Please enquire for more information about (N-Me-Phe7)-Neurokinin B trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H81N13O14S2Purity:Min. 95%Molecular weight:1,272.5 g/molH-Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu-OH
CAS:<p>H-Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu-OH is a peptide that is an activator of casein kinase II. Casein kinase II is a serine/threonine protein kinase that plays an important role in the regulation of cell proliferation and differentiation, apoptosis, and immune response. It has been shown to be involved in restenosis after angioplasty, as well as in tumorigenesis and radiation therapy. H-Arg-Arg-Glu-Glu-Glu-Thr-Glu - Glu - Glu - OH has also been shown to inhibit the replication of influenza virus by interfering with viral transcription and viral maturation. This peptide has been used for the treatment of alopecia, which may be due to its ability to inhibit hair follicle growth.</p>Formula:C46H75N15O23Purity:Min. 95%Molecular weight:1,206.18 g/molH-Arg-Trp-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O2·2HClPurity:Min. 95%Molecular weight:432.35 g/molH-Pro-Leu-Gly-pNA
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H27N5O5Purity:Min. 95%Molecular weight:405.45 g/mol(Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla)
CAS:<p>Please enquire for more information about (Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H63N11O16SPurity:Min. 95%Molecular weight:986.06 g/molH-Ala-Val-NH2·HCl
CAS:<p>Please enquire for more information about H-Ala-Val-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H17N3O2·HClPurity:Min. 95%Molecular weight:223.7 g/molHirullin
CAS:<p>Hirullin H-Ser-Asp-Phe-Glu-Glu-Phe-Ser-Leu-Asp-Asp-Ile-Glu-Gln is a peptide with a carboxy terminal and carbonyl group. It has minimal inhibitory concentrations of about 100 nM for most bacteria and is active against the majority of Gram positive bacteria. Hirullin H is composed of amino acid sequences that are similar to the sequences of active substances in other compounds, such as hirulog, an anticoagulant, and heparin, an antithrombotic drug. Hirullin H has been shown to have bifunctional properties by inhibiting thrombin, which is responsible for blood clotting, while also inhibiting platelet activation.</p>Formula:C68H96N14O29Purity:Min. 95%Molecular weight:1,573.57 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molBoc-Ile-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ile-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Lauroyl-glycine
CAS:<p>Lauroyl-glycine is a fatty acid with a long acyl chain. It is an intermediate in the synthesis of lauric acid, which is used in the production of detergents and soaps. Lauroyl-glycine has been shown to be useful as a model system for skin condition studies due to its detergent properties.</p>Formula:C14H27NO3Purity:Min. 95%Molecular weight:257.37 g/mol4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid
CAS:<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>Formula:C13H18N2O2Purity:Min. 95%Molecular weight:234.29 g/molH-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Glu-Ser-Leu-Phe-OH
CAS:<p>Please enquire for more information about H-Glu-Ser-Leu-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H34N4O8Purity:Min. 95%Molecular weight:494.54 g/mol1-Methylethyl N-((S)-(((1R)-2-(6-amino-9H-purin-9-yl)-1-methylethoxy)methyl)phenoxyphosphinoyl)-L-alaninate
CAS:<p>Tenofovir is a nucleoside analog reverse transcriptase inhibitor that binds to the RNA-dependent polymerase. This compound is used in combination with other antiviral agents for the treatment of HIV-1 infection and for prophylaxis against HIV-1 infection. Tenofovir has been shown to be effective against infections caused by strains of HIV-1, such as the drug resistant virus. Tenofovir is absorbed rapidly after oral administration, with a bioavailability of over 80%. The prodrug fumarate is hydrolyzed to tenofovir in vivo and this conversion occurs more efficiently in acidic conditions. Alafenamide, a prodrug of tenofovir, has been approved by the FDA as an alternative to tenofovir disoproxil fumarate (TDF) for the treatment of HIV-1 infection. Alafenamide is an acyclic nucleoside phosphonate that inhibits viral replication by inhibiting reverse</p>Formula:C46H62N12O14P2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,069 g/molFmoc-Val-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Val-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Gly-Glu-Ala-OH
CAS:<p>H-Gly-Gly-Glu-Ala-OH is a carboxylate. It has been shown to be an ionizable molecule with a proton that can exist in either the hydrated or dehydrated form. The proton of the carboxylate group can move between the two forms and the ionization state depends on pH and temperature. H-Gly-Gly-Glu-Ala-OH is a linear peptide, which means it has an amide group and a residue at each end of the chain. Each of these residues has specific conformations, which are impacted by intramolecular hydrogen bonds. These conformations play a role in determining its pharmacological properties, as well as its function in structural biology and magnetic resonance techniques. H-Gly-Gly-Glu-Ala-OH also has population distribution studies that have been used for diffraction analyses, as well as for titration experiments.</p>Formula:C12H20N4O7Purity:Min. 95%Molecular weight:332.31 g/molH-Ala-Pro-Tyr-Ala-OH
CAS:<p>Acetylation is the process of reacting an organic compound with acetic acid to produce an ester and water. Acetylation is one of the most common reactions in organic chemistry. Acetylating agents, such as acetic anhydride or acetyl chloride, are often used in chemical synthesis because they react selectively with primary and secondary alcohols to form esters. The acetylation reaction can be used to modify proteins by attaching an acetyl group to the amine group of a lysine residue. This modification prevents the protein from binding to other proteins and can alter its function. Acetylation also has been implicated in several diseases, such as hepatitis and inflammatory bowel disease.</p>Formula:C20H28N4O6Purity:Min. 95%Molecular weight:420.46 g/molAc-Asp(Glu-OH)-OH
CAS:<p>Ac-Asp(Glu-OH)-OH is a low potency, but potentiating compound that binds to the cell cytoplasm. It inhibits the uptake of glutamate into the synaptic cleft by binding to acidic granules. This compound may be neuroprotective and inhibit prostate carcinoma growth. Ac-Asp(Glu-OH)-OH has also been shown to inhibit postsynaptic potentials and decrease glutamate release in cerebellar granule cells.</p>Formula:C11H16N2O8Purity:Min. 95%Molecular weight:304.25 g/mol(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H303N59O53Purity:Min. 95%Molecular weight:4,309.85 g/molOxyntomodulin (bovine, dog, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C192H295N59O60SPurity:Min. 95%Molecular weight:4,421.82 g/molN-Boc-D-b-homoproline
CAS:<p>Please enquire for more information about N-Boc-D-b-homoproline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molH-Val-Asn-OH
CAS:<p>H-Val-Asn-OH is a polyhydroxyamine that is soluble in water and has a low freezing point. It can be used as a coating material, sectioning medium, or to study the thermal expansion of materials. H-Val-Asn-OH has been shown to have no significant effect on the growth rate of bacteria and spores. H-Val-Asn-OH is made up of nitrogen atoms, ferrite, and strain. The microstructure of H-Val-Asn-OH includes a phase equilibrium with ferrite and strain morphology.</p>Formula:C9H17N3O4Purity:Min. 95%Molecular weight:231.25 g/molAngiotensin II Receptor Ligand Nicotinoyl-Tyr-Lys(Z-Arg)-His-Pro-Ile-OH
CAS:<p>Angiotensin II receptor ligand nicotinoyl-tyrosine-arginine-proline-ile (ANGII) is a peptide that acts as a potent angiotensin II receptor agonist. It can be used to anesthetize rats and cause bradykinin b2 receptor activation. ANGII has been shown to inhibit the growth of several types of tumors, such as human melanoma cells, in animal experiments. This drug also has antiangiogenic properties, which may be due to its ability to induce the production of tumor necrosis factor-α (TNF-α).</p>Formula:C52H69N13O11Purity:Min. 95%Molecular weight:1,052.19 g/molBiotinyl-(Glu1)-Gastrin I (human) Biotinyl-Glu-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2
CAS:<p>Please enquire for more information about Biotinyl-(Glu1)-Gastrin I (human) Biotinyl-Glu-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H140N22O34S2Purity:Min. 95%Molecular weight:2,342.52 g/molZ-Phe-Cit-AMC
CAS:<p>Z-Phe-Cit-AMC is a fluorescent substrate for the enzymes cysteine and peptide aminopeptidases. It has been synthesized by conjugating 7-amino-4-methylcoumarin with L-phenylalanine. The product is useful in assays to measure the activity of these enzymes, which are involved in protein digestion and wound healing. Z-Phe-Cit-AMC can be hydrolyzed by bromelain, ficin, or papain and it can be used as a substrate for enzyme reactions.</p>Formula:C33H35N5O7Purity:Min. 95%Molecular weight:613.66 g/molPACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>Formula:C203H331N63O53SPurity:Min. 95%Molecular weight:4,534.26 g/molL-Lysine acetate
CAS:Controlled Product<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>Formula:C8H18N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.24 g/molH-Ala-Met-OH
CAS:<p>H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.</p>Formula:C8H16N2O3SPurity:Min. 95%Molecular weight:220.29 g/molBoc-L-valine
CAS:<p>Boc-L-Valine is a model system for the synthesis of peptides. This compound is synthesized in a liquid phase and then purified by column chromatography. It has an antimicrobial activity against Gram-positive bacteria such as Staphylococcus aureus and Escherichia coli, but not against Gram-negative bacteria such as Proteus vulgaris or Pseudomonas aeruginosa. Boc-L-Valine is also used to study the binding of inhibitors and ferrocenes.</p>Formula:C10H19NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:217.3 g/molH-Pro-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Pro-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O2·HClPurity:Min. 95%Molecular weight:297.78 g/molHCV Core Protein (59-68)
CAS:<p>Please enquire for more information about HCV Core Protein (59-68) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H91N21O12Purity:Min. 95%Molecular weight:1,178.39 g/molH-Asp-Ala-OH
CAS:<p>Adriamycin is an anticancer drug that is a structural analogue of aspartic acid. It can be synthesized in a solid-phase synthesis using a polymeric resin with an acidic functional group, such as H-Asp-Ala-OH. Adriamycin inhibits the production of inflammatory cytokines and prostaglandins, which are involved in the development of inflammatory diseases. Adriamycin has been shown to have anti-inflammatory effects on human serum and to inhibit the production of proteins important for tumor cell proliferation. Adriamycin also has anti-inflammatory properties due to its ability to bind with hydrogen bonds to acidic residues on proteins.<br>END></p>Formula:C7H12N2O5Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:204.18 g/molH-Ser-Met-OH
CAS:<p>Glycyl-l-leucine is a muscle protein that belongs to the group of glycyl amino acids. It has been shown to have cortisone activity, which causes it to function as a suppressant. Glycyl-l-leucine binds to iron and prevents its oxidation, thereby preventing the formation of reactive oxygen species. Glycyl-l-leucine also has the ability to chelate iron, which can cause it to have antioxidant functions. The pH optimum for this compound is acidic and it is not active in neutral pH environments. This compound is found in fetal bovine serum and may be present in some food products such as chocolate milk or cheese. Glycyl-l-leucine may be used as an immobilizing agent for enzymes because it does not denature proteins at high concentrations.END></p>Formula:C8H16N2O4SPurity:Min. 95%Molecular weight:236.29 g/molBoc-Phe-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H146N24O23SPurity:Min. 95%Molecular weight:2,132.49 g/molAdrenomedullin (16-31) (human, pig)
CAS:<p>Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H129N25O21S2Purity:Min. 95%Molecular weight:1,865.19 g/molMethyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H16N2O3SPurity:85%MinMolecular weight:292.35 g/molDABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H98N16O15SPurity:Min. 95%Molecular weight:1,507.76 g/molFmoc-D-Ser(BSi)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H31NO5SiPurity:Min. 95%Molecular weight:441.59 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molRF9 trifluoroacetate salt
CAS:<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>Formula:C26H38N6O3Purity:Min. 95%Molecular weight:482.62 g/mol7-Diethylamino-4-methylcoumarin
CAS:<p>7-Diethylamino-4-methylcoumarin is a fluorescence probe that can be used in applications such as the study of hydrogen bonding interactions. It is excited by laser light and emits a red-shifted fluorescent light. 7-Diethylamino-4-methylcoumarin is a hydroxyl group analogue of coumarin, which has been shown to have physiological effects on the liver cells. The absorption spectrum of 7-Diethylamino-4-methylcoumarin is sensitive to changes in pH and chemical stability. A decrease in pH increases the intensity of the emission while an increase in pH decreases the intensity of the emission. This compound can also be used to label nucleic acids during polymerase chain reactions (PCR) or for sample preparation before analysis using nuclear magnetic resonance spectroscopy (NMR).</p>Formula:C14H17NO2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:231.29 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molZ-Gly-Pro-Phe-Pro-Leu-OH
CAS:<p>Please enquire for more information about Z-Gly-Pro-Phe-Pro-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H45N5O8Purity:Min. 95%Molecular weight:663.76 g/molSorbin (147-153) amide (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Sorbin (147-153) amide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H58N10O9Purity:Min. 95%Molecular weight:738.88 g/mol(Pyr 16)-VIP (16-28) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H114N18O18SPurity:Min. 95%Molecular weight:1,503.81 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/molProadrenomedullin (1-20) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H177N37O28Purity:Min. 95%Molecular weight:2,477.83 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/molAngiogenin (108-123)
CAS:<p>Please enquire for more information about Angiogenin (108-123) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H132N26O24Purity:Min. 95%Molecular weight:1,878.1 g/molMCH-Gene-Overprinted-Polypeptide-14 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H132N22O18S3Purity:Min. 95%Molecular weight:1,786.24 g/molNocistatin (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O32Purity:Min. 95%Molecular weight:1,927.07 g/mol(Lys8)-Conopressin S
CAS:<p>Please enquire for more information about (Lys8)-Conopressin S including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H73N15O10S2Purity:Min. 95%Molecular weight:1,000.25 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/molCell-permeable Caspase-3 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-3 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C94H158N20O27Purity:Min. 95%Molecular weight:2,000.38 g/mol2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride
CAS:<p>2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is a benzimidazole derivative. It has a chemical stability and can be used for wastewater treatment. It is also a pump inhibitor and can be used for anhydrous sodium magnesium salts. This product is synthesized from the reaction of protonated 2-bromo-4-methoxyphenol with 2,6-dimethylpyridine in the presence of hydrochloric acid. The reaction was carried out in an asymmetric synthesis using a proton transport system. 2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is soluble in water and has a pH of 1 to 3. It has been shown that this product can be used as an antioxidant and as a metal chelation agent.</p>Formula:C9H13Cl2NOPurity:Min. 95%Color and Shape:PowderMolecular weight:222.11 g/molBQ-610 Azepane-1-carbonyl-Leu-D-Trp(For)-D-Trp-OH
CAS:<p>BQ-610 is a novel peptide that has been shown to reduce the severity of mucosal inflammation in animal models of inflammatory bowel disease. It functions by binding to myofibroblasts, which are cells that produce an extracellular matrix and collagen. BQ-610 also blocks signalling pathways that are responsible for the production of TNF-α, MMP-2, and other molecules involved in the pathogenesis of inflammatory bowel disease. BQ-610 is effective at reducing inflammation in animal models of colitis, but not in human colonic epithelial cells or human colonic tissue.</p>Formula:C36H44N6O6Purity:Min. 95%Molecular weight:656.77 g/molH-Leu-Val-Tyr-AMC
CAS:<p>H-Leu-Val-Tyr-AMC is a model compound that belongs to the group of sulfonamides. It is synthesized and used as a chymotrypsin-like protease inhibitor. H-Leu-Val-Tyr-AMC has been shown to inhibit the activity of chymotrypsin, a serine protease, by binding to its active site. This inhibition leads to an increase in the time required for digestion of proteins and peptides, which may be due to the steric hindrance created by the bulky H-Leu-Val-Tyr. H-Leu-Val-Tyr amide also has antiinflammatory properties, which are thought to be caused by its ability to inhibit prostaglandin synthesis.</p>Formula:C30H38N4O6Purity:Min. 95%Molecular weight:550.65 g/molH-His-Tyr-OH
CAS:<p>H-His-Tyr-OH is a histidine-containing compound that has been synthesized and structurally characterized. H-His-Tyr-OH was shown to be a competitive inhibitor of the enzyme histidine decarboxylase in a rat liver microsomal preparation. The kinetic constants for the inhibition of the enzyme were determined, and the binding site on the enzyme was identified by molecular modeling. This study also showed that H-His-Tyr-OH binds to monoclonal antibodies with high affinity and specificity, which may be useful for therapy.</p>Formula:C15H18N4O4Purity:Min. 95%Molecular weight:318.33 g/molH-Cys(farnesyl)-Val-Ile-Ser-OH
CAS:<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H56N4O6SPurity:Min. 95%Molecular weight:624.88 g/molpTH (53-84) (human)
CAS:<p>Please enquire for more information about pTH (53-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H253N43O54Purity:Min. 95%Molecular weight:3,510.86 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molBz-Tyr-4-Abz-OH·sodium salt
CAS:<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H19N2NaO5Purity:Min. 95%Molecular weight:426.4 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molThrombin B-Chain (147-158) (human)
CAS:<p>Please enquire for more information about Thrombin B-Chain (147-158) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H84N16O18Purity:Min. 95%Molecular weight:1,245.34 g/mol(D-Lys(nicotinoyl)1,b-(3-pyridyl)-Ala3,3,4-dichloro-D-Phe5,Asn6,D-Trp7·9, Nle 11)-Substance P trifluoroacetate salt
CAS:<p>Substance P is a tachykinin neuropeptide that belongs to the tachykinin family. It is found in the central and peripheral nervous system and has been shown to have an important role in locomotor activity, protein synthesis, receptor activity, and neurotransmitter release. Substance P is also associated with a number of diseases such as infectious diseases, sciatic nerve pain, and vasoactive intestinal peptide (VIP) production. This substance has been used for the diagnosis of neurogenic bladder dysfunction by measuring its effects on urinary bladder contractility.</p>Formula:C86H104Cl2N18O13Purity:Min. 95%Molecular weight:1,668.76 g/molN-α-Fmoc-Nε-allyloxycarbonyl-D-lysine
CAS:<p>N-alpha-Fmoc-Nepsilon-allyloxycarbonyl-D-lysine is a medicament that is modified with an amino group at the alpha position. It is synthesized by modification of the chain with a ganirelix acetate. N-alpha-Fmoc-Nepsilon-allyloxycarbonyl-D-lysine can be used to produce ganirelix, which inhibits the release of follicle stimulating hormone (FSH). The chemical synthesis of this drug has been shown to be successful in large scale production, and it has been shown to be effective in treating patients with prostate cancer. Impurities in this drug have been found and treated by removing the methyl ester group from the lysine residue.</p>Formula:C25H28N2O6Purity:Min. 95%Molecular weight:452.5 g/mol(Des-Ser1)-Cerebellin
CAS:<p>Please enquire for more information about (Des-Ser1)-Cerebellin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H108N22O21Purity:Min. 95%Molecular weight:1,545.7 g/molH-Arg-Phe-NH2 hydrochloride salt
CAS:<p>H-Arg-Phe-NH2 hydrochloride salt (H-RF) is a physiological agent that has been shown to have effects on the response element binding protein. H-RF is a small, water soluble molecule that has been shown to act as an agonist for peptides and cation channels in vitro. The peptides are involved in the regulation of cardiac function and locomotor activity, while the cation channel regulates the opening and closing of potassium channels. The binding of H-RF to these receptors leads to positive changes in energy metabolism, which may be due to its ability to activate ATPase. H-RF also binds strongly to disulfide bonds found in proteins such as peptide hormones and enzymes. These disulfide bonds are important for maintaining protein structure and function.</p>Formula:C15H24N6O2Purity:Min. 95%Molecular weight:320.39 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molDNA Transcription Inhibitory Peptide Pyr-Asp-Asp-Ser(PO3H2)-Asp-Glu-Glu-Asn-OH
CAS:<p>Please enquire for more information about DNA Transcription Inhibitory Peptide Pyr-Asp-Asp-Ser(PO3H2)-Asp-Glu-Glu-Asn-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H48N9O25PPurity:Min. 95%Molecular weight:1,013.76 g/molAc-Leu-Val-Phe-aldehyde
CAS:<p>Ac-Leu-Val-Phe-aldehyde is a synthetic compound that inhibits the catalytic activity of carboxyl enzymes. It binds to the catalytic site of the enzyme via a noncovalent interaction with residues on the polypeptide chain, thereby preventing the formation of an active complex with other cofactors such as metal ions, amino acids, and ATP. Ac-Leu-Val-Phe-aldehyde can be used in analytical chemistry for determination of carboxyl groups in organic compounds or for determining protein content in biological samples. Ac-Leu-Val-Phe-aldehyde has also been shown to bind to antibodies which are specific for carboxyl groups.</p>Formula:C22H33N3O4Purity:Min. 95%Molecular weight:403.52 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molCaerulein (desulfated)
CAS:<p>Caerulein (desulfated) Pyr-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe-NH2 is a decapeptide that is found in the Australian frog, Caerulea. It has been shown to be a potent extractant of ionic materials and can be used in the separation of proteins by ion exchange chromatography. The sequence is as follows: Caerulein (desulfated) Pyr-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe. It has an acid composition of Cys, Asp, Tyr, Glu, Pro, Gly, Phe and Met. The amino acid composition is Pro, Ala, Gly, Val, Gln and Leu. Caerulein (desulfated) Pyr-Gln has been shown to have antihypertensive effects due to</p>Formula:C58H73N13O18SPurity:Min. 95%Molecular weight:1,272.34 g/mol(Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H206N44O35SPurity:Min. 95%Molecular weight:2,857.26 g/mol1,2-Dilauroyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Dilauroyl-rac-glycero-3-phosphocholine (DLPC) is a synthetic phospholipid that exhibits significant cytotoxicity against hyperproliferative cells. DLPC has been shown to inhibit the activity of the enzyme sphingosine 2-phosphate (S2P) and cell factor, both of which are important in signal transduction pathways. DLPC is capable of inducing phase transition at a temperature close to body temperature, making it biocompatible for use as a topical or injectable drug. It has also been shown to be effective in treating infectious diseases such as HIV and malaria, due to its ability to bind with basic proteins found on the surface of these viruses.</p>Formula:C32H64NO8PPurity:Min. 95%Molecular weight:621.83 g/molN-α-Z-L-lysine methyl ester hydrochloride
CAS:<p>N-alpha-Z-L-lysine methyl ester hydrochloride is a preparation that is used as a methyl ester. It is an ester of lysine and methyl chloride. This product has a molecular weight of 170.16 g/mol and the chemical formula CH3CONHCH2CH(NH)CO2CH3. The structural data has not been confirmed by X-ray crystallography, but it can be assumed to be in the form of a zwitterion. N-alpha-Z-L-lysine methyl ester hydrochloride can be used for the synthesis of peptides, which are building blocks for proteins and enzymes. N-alpha-Z-L-lysine methyl ester hydrochloride is also used in the production of certain kinds of drugs and organic acids such as acetylsalicylic acid (aspirin).</p>Formula:C15H22N2O4·HClPurity:Min. 95%Molecular weight:330.81 g/molEnterotoxin STp (E. coli) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about Enterotoxin STp (E. coli) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H110N20O26S6Purity:Min. 95%Molecular weight:1,972.26 g/molCRF (6-33) (human, rat)
CAS:<p>CRF (6-33) is a neuropeptide that is found in the human cerebral cortex and rat liver. It has been shown to inhibit protein synthesis and sequenced by Edmond H. Fischer, who also discovered corticotropin-releasing factor (CRF). CRF (6-33) binds to its receptor CRFR1, which activates phospholipase C and generates inositol 1,4,5-triphosphate. This leads to the release of calcium from intracellular stores and the activation of protein kinase C. The release of calcium ions into the cytosol causes an increase in intracellular levels of cAMP, which activates a series of reactions responsible for the cellular effects of CRF. CRF (6-33) has been shown to be involved in depression by controlling neurotransmitter levels.br></p>Formula:C141H231N41O43SPurity:Min. 95%Molecular weight:3,220.66 g/molZ-Glu-Gly-OH
CAS:<p>Z-Glu-Gly-OH is a cysteine donor for the chemical cross-linking of keratin proteins. Follicle cells are a major source of keratin, and glutamic acid is the most abundant amino acid in these cells. Glutamine is also abundant in keratins, and may be responsible for the cornified layer. Cysteine is used to cross-link the structural proteins, while glutamic acid and glutamine are involved in cross-linking the fibre and residue. Cross-linking results in an insoluble protein matrix that provides strength to skin.</p>Formula:C15H18N2O7Purity:Min. 95%Molecular weight:338.31 g/molH-Lys-Asn-Asn-Gln-Lys-Ser-Glu-Pro-Leu-Ile-Gly-Arg-Lys-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Lys-Asn-Asn-Gln-Lys-Ser-Glu-Pro-Leu-Ile-Gly-Arg-Lys-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H133N25O23Purity:Min. 95%Molecular weight:1,741 g/molBPP 9a Pyr-Trp-Pro-Arg-Pro-Gln-Ile-Pro-Pro-OH
CAS:<p>BPP 9a is an enzyme inhibitor that binds to the active site of angiotensin-converting enzyme (ACE) and blocks its activity. It is a nonsteroidal anti-inflammatory drug that has been shown to be effective in reducing inflammation and pain associated with arthritis, osteoarthritis, gout, and menstrual cramps. BPP 9a has also been shown to reduce blood pressure in a dose-dependent manner, which may be due to its ability to inhibit the synthesis of angiotensin II from angiotensin I. This inhibition may lead to decreased vascular tone and blood pressure. BPP 9a has also been shown to have beneficial effects on bowel disease and polymerase chain reaction (PCR) analysis of DNA.</p>Formula:C53H76N14O12Purity:Min. 95%Molecular weight:1,101.26 g/molAc-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu-NH2
CAS:<p>The peptide Ac-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu (AFGP) is a small molecule that has been shown to be effective in the prophylaxis and treatment of infectious diseases. AFGP is used as an excipient in intravenous solutions, such as antibiotics, vaccines, and other injectable drugs. It also functions as a diluent for lyophilized products. In addition to its use in the pharmaceutical industry, AFGP is also used as an excipient for vaccine preparations and other injectable drugs. AFGP has been shown to reduce the symptoms of inflammatory diseases, such as asthma and rheumatoid arthritis. This peptide has also been shown to have antiinflammatory and antifibrotic properties.</p>Formula:C96H123N19O22Purity:Min. 95%Molecular weight:1,895.12 g/molH-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N8O10Purity:Min. 95%Molecular weight:726.78 g/molH-Gln-Gly-Pro-OH·TFA
CAS:<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N4O5·C2HF3O2Purity:Min. 95%Molecular weight:414.33 g/mol(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt
CAS:<p>(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt H-Ala-Tyr-Pro-Gly-Lys-Phe-OH trifluoroacetate salt is a potent inhibitor of protein kinase C, and has been shown to inhibit the growth of prostate cancer cells. It also inhibits phosphorylation of epidermal growth factor receptors, which leads to lower levels of epidermal growth factor in the cell. This drug also has antiplatelet effects and may be used as an antiplatelet agent for patients with vascular disease or diabetes.</p>Formula:C34H47N7O8Purity:Min. 95%Molecular weight:681.78 g/mol(D-Pro4,D-Trp7·9·10,Val8)-Substance P (4-11)
CAS:<p>Please enquire for more information about (D-Pro4,D-Trp7·9·10,Val8)-Substance P (4-11) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H74N14O10SPurity:Min. 95%Molecular weight:1,159.36 g/molBoc-Phe-D-Leu-Phe-D-Leu-Phe-OH
CAS:<p>Polymyxin B is a cationic detergent that binds to bacterial membranes and destroys the cell wall. Polymyxin B has been shown to be a potent antagonist of spermatozoa and microglia, which are cells that maintain the homeostasis of the central nervous system. It also has been shown to be an inhibitor of chemotaxis in polymorphonuclear leucocytes (PMN), which are white blood cells that participate in inflammatory processes. Polymyxin B has been shown to have chemotactic activity for PMN and inhibit protein synthesis in mitochondria. This compound also inhibits chelerythrine, a cyclase inhibitor that is used as an antineoplastic agent.</p>Formula:C44H59N5O8Purity:Min. 95%Molecular weight:785.97 g/mol(Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molProtein Kinase P34 (cd2) Substrate trifluoroacetate salt
CAS:<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>Formula:C106H172N32O32Purity:Min. 95%Molecular weight:2,406.7 g/molH-Met-Thr-OH
CAS:<p>Met-Thr-OH is a peptide binding inhibitor that is used as a research tool for determining the role of metalloproteins in vivo. Methionine aminopeptidase (MetAP) is an enzyme that cleaves methionine from protein and peptides and has been shown to play a vital role in cancer progression. MetAP has been shown to be inhibited by Met-Thr-OH, which binds to the enzyme's active site and blocks its activity. The inhibition of MetAP limits the production of proteins involved in cell growth and proliferation, leading to reductions in tumor size. This inhibition may also be due to the inhibition of other functional groups such as phosphorylation, dephosphorylation, or nitrosylation.</p>Formula:C9H18N2O4SPurity:Min. 95%Molecular weight:250.32 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molFmoc-Tyr-Ala-OH
CAS:<p>Fmoc-Tyr-Ala-OH is a biochemical that is expressed in mammalian cells. It has been shown to activate enzymes and the production of proteins, which are essential for cell growth. Fmoc-Tyr-Ala-OH is also proteolytic and hydrolyzing, meaning it can be used to cleave proteins into smaller pieces. It has been shown to have acidic and neutral properties at different pH levels. This enzyme also has an inhibitory effect on the production of monoclonal antibodies in mcf-7 cells, which are derived from mouse mammary epithelial cells.</p>Formula:C27H26N2O6Purity:Min. 95%Molecular weight:474.51 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molFmoc-Cit-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cit-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Glu-Tyr-OH
CAS:<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>Formula:C14H18N2O6Purity:Min. 95%Molecular weight:310.3 g/molFor-Met-Val-OH
CAS:<p>For-Met-Val-OH is a synthetic molecule that has been shown to inhibit the growth of bacteria by binding to the ribosomal subunit, thereby inhibiting protein synthesis. This compound was synthesized in vitro and has been shown to be effective against single-stranded DNA. For-Met-Val-OH can also bind to the template strand of DNA and inhibit the synthesis of RNA. It binds to functional genes and inhibits their function in a similar manner as natural substrates. This inhibition may be due to inhibition of protein synthesis or other unknown mechanisms. The structure of For-Met-Val-OH is similar to hydroxamic acids, which are known for their antibacterial properties.</p>Formula:C11H20N2O4SPurity:Min. 95%Molecular weight:276.35 g/molH-Thr-Asp-OH TFA salt
CAS:<p>Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O6C2F3HO2Purity:Min. 95%Molecular weight:348.23 g/molFmoc-N-methyl-L-leucine
CAS:<p>Please enquire for more information about Fmoc-N-methyl-L-leucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H25NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:367.44 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molBoc-Cys(SEt)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-Cys(SEt)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO4S2·C12H23NPurity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:462.71Fmoc-Phe-Arg-OH
CAS:<p>Fmoc-Phe-Arg-OH is a peptide ligand that is able to bind to the receptor on osteoblasts, which are cells in bones. This binding triggers a cascade of events leading to the production of an extracellular matrix that provides structural support for the bone. The hydrogel used in this study consists of Fmoc-Phe-Arg-OH and a collagen backbone. It has been shown that Fmoc-Phe-Arg-OH can increase the proliferation rate of osteoblast cells in vitro when used with a collagen matrix. This may be due to its ability to induce cell differentiation and stimulate protein synthesis by binding to the receptor on osteoblasts.</p>Formula:C30H33N5O5Purity:Min. 95%Molecular weight:543.61 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molFmoc-b-(2-thienyl)-L-alanine
CAS:<p>Please enquire for more information about Fmoc-b-(2-thienyl)-L-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H19NO4SPurity:Min. 95%Molecular weight:393.46 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/mol
