
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,465 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38248 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
TIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H189N33O35S3Purity:Min. 95%Molecular weight:2,882.3 g/mol(Trp7,β-Ala8)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Trp7,beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H57N9O10SPurity:Min. 95%Molecular weight:868.01 g/molHCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H99N15O14SPurity:Min. 95%Molecular weight:1,214.52 g/molFmoc-Lys(N3)-OH
CAS:<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>Formula:C21H22N4O4Purity:Min. 95%Molecular weight:394.42 g/molZ-Trp-Leu-OH
CAS:<p>Please enquire for more information about Z-Trp-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29N3O5Purity:Min. 95%Molecular weight:451.51 g/molAcetyl-Hirudin (55-65) (desulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH
CAS:<p>Please enquire for more information about Acetyl-Hirudin (55-65) (desulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H92N12O25Purity:Min. 95%Molecular weight:1,453.5 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/molH-β-Ala-Gly-OH
CAS:<p>H-beta-Ala-Gly-OH is a monoclinic crystalline compound. It is soluble in water and slightly soluble in ethanol, acetone, and benzene. The solubility of this compound depends on the pH of the solution as well as the presence of glycine. H-beta-Ala-Gly-OH has an upfield shift when protonated, making it useful for analytical purposes. This compound can be used to prepare glycine methyl ester by reacting with methanol or hydrochloric acid.</p>Formula:C5H10N2O3Purity:Min. 95%Molecular weight:146.14 g/molH-Pro-Pro-Pro-Pro-OH
CAS:<p>H-Pro-Pro-Pro-Pro-OH is a proteolytic enzyme that has been shown to have potential applications in drug design. The enzyme is able to cleave proteins, such as albumin, at different sites. It can be used to optimize the design of therapeutic drugs by highlighting the parameters that are important for successful protein cleavage. The enzyme has also been shown to have toxicological properties and interacts with serum albumin. H-Pro-Pro-Pro-Pro-OH is a protease that can be found in human serum.</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molH-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2
CAS:<p>Please enquire for more information about H-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H119N19O21SPurity:Min. 95%Molecular weight:1,582.86 g/molNeuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H170N30O40SPurity:Min. 95%Molecular weight:2,656.84 g/molN-Boc-2-aminoacetaldehyde
CAS:<p>N-Boc-2-aminoacetaldehyde is an aliphatic aldehyde that has been used in the synthesis of a number of bioactive molecules. It is synthesized by reacting an N-Boc amino acid with chloroform and hydrochloric acid. The reaction time is typically 2 hours at room temperature, although it can be decreased to 20 minutes if the temperature is increased to 60°C. The product can be purified using extraction or recrystallization methods. N-Boc-2-aminoacetaldehyde reacts with chloride ions to form phosphoranes, which are useful in clinical development as antimicrobial peptides. This compound also reacts with fluorine to form hydrogenated derivatives that have been shown to have neurokinin activity in animal models.</p>Formula:C7H13NO3Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:159.18 g/mol(Pyr 16)-VIP (16-28) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H114N18O18SPurity:Min. 95%Molecular weight:1,503.81 g/molBz-Tyr-4-Abz-OH·sodium salt
CAS:<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H19N2NaO5Purity:Min. 95%Molecular weight:426.4 g/molpTH (44-68) (human)
CAS:<p>Please enquire for more information about pTH (44-68) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H199N41O41Purity:Min. 95%Molecular weight:2,836.08 g/molUrotensin I
CAS:<p>Please enquire for more information about Urotensin I including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C210H340N62O67S2Purity:Min. 95%Molecular weight:4,869.46 g/molAc-Leu-pNA
CAS:<p>Ac-Leu-pNA is a peptide that is isolated from pyrococcus furiosus. It has the ability to inhibit serine proteases, including trypsin and chymotrypsin, by forming hydrogen bonds with their active site. Ac-Leu-pNA also inhibits the activity of the enzyme proteasome, which breaks down proteins in cells. This inhibition is due to its ability to bind to the ubiquitin-proteasome system (UPS) and block the enzymatic reaction. Ac-Leu-pNA has been shown to have a blood pressure lowering effect in humans.</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/molH-Val-Ala-pNA acetate salt
CAS:<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/molH-Ala-Ala-Ala-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N5O5·HClPurity:Min. 95%Molecular weight:387.82 g/molH-Thr-Tyr-Ser-OH
CAS:<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/molMastoparan 17 (free acid)
CAS:<p>Please enquire for more information about Mastoparan 17 (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H131N19O16Purity:Min. 95%Molecular weight:1,494.91 g/molCyclo(-Pro-Thr)
CAS:<p>Cyclo(-Pro-Thr) is a cyclic peptide that is derived from the amino acid sequence of serotonin. Cyclo(-Pro-Thr) has been detected in human urine, and it is possible that this compound may be formed by the hydrolysis of serotonin by enzymes such as pipecolate oxidase. The presence of cyclo(-Pro-Thr) in human urine has been correlated with the occurrence of stomach ulcers, which are caused by substances such as famotidine and other proton pump inhibitors. Cyclo(-Pro-Thr) has also been found to inhibit the production of gamma-aminobutyric acid (GABA), which is an important neurotransmitter for controlling muscle tone, blood pressure, and anxiety.</p>Formula:C9H14N2O3Purity:Min. 95%Molecular weight:198.22 g/molH-Arg-Arg-Lys-Asp-Leu-His-Asp-Asp-Glu-Glu-Asp-Glu-Ala-Met-Ser-Ile-Thr-Ala-OH
CAS:<p>Please enquire for more information about H-Arg-Arg-Lys-Asp-Leu-His-Asp-Asp-Glu-Glu-Asp-Glu-Ala-Met-Ser-Ile-Thr-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H139N27O35SPurity:Min. 95%Molecular weight:2,131.24 g/molN-α-Trityl-Nε-Fmoc-L-lysine
CAS:<p>N-alpha-Trityl-Nepsilon-Fmoc-L-lysine is a pentapeptide that is used in peptides. It has been shown to have cytotoxicity and permeability, as well as being biologically active. N-alpha-Trityl-Nepsilon-Fmoc-L-lysine has also been used in solid phase synthesis of peptides. This pentapeptide can be synthesized using the Miyaura cross coupling reaction with an ether or Suzuki cross coupling reaction. N-alpha-Trityl-Nepsilon-Fmoc-L-lysine is a bicyclic molecule that can be synthesized on a solid phase.</p>Formula:C40H38N2O4Purity:Min. 95%Molecular weight:610.74 g/molH-Lys-Tyr-OH acetate salt
CAS:<p>H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molSuc-Ala-Leu-Pro-Phe-OH
CAS:<p>Please enquire for more information about Suc-Ala-Leu-Pro-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H38N4O8Purity:Min. 95%Molecular weight:546.61 g/molFmoc-L-aspartic acid β-allyl ester
CAS:<p>Fmoc-L-aspartic acid beta-allyl ester is a specific interaction between an amide and an enzyme target. It has been shown to have anti-inflammatory properties by inhibiting the activity of COX-2, which inhibits the production of prostaglandins. Fmoc-L-aspartic acid beta-allyl ester is a cyclic peptide with a lactam ring system that has been synthesized in a stepwise manner on a solid phase. This molecule interacts with cell line A549 and blocks the proliferation of cancer cells. Fmoc-L-aspartic acid beta-allyl ester also contains a disulfide bond that stabilizes its structure.</p>Formula:C22H21NO6Purity:Min. 95%Molecular weight:395.41 g/molO-a-Hippuryl-L-argininic acid hydrochloride salt
CAS:<p>Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H20N4O5Purity:Min. 95%Molecular weight:336.34 g/molH-Tyr-His-OH
CAS:<p>H-Tyr-His-OH is a trifluoroacetic acid derivative that is a histidine odorant. It can be used as a substitute for histidine in the detection of blood pressure, due to its ability to bind to nitric oxide and histidine receptors. H-Tyr-His-OH has been shown to have immunological properties, and it has been used as an immunogen in the production of monoclonal antibodies against human erythrocytes. H-Tyr-His-OH is also considered to be a potential biomarker because it can be detected by LC-MS/MS methods.</p>Formula:C15H18N4O4Purity:Min. 95%Molecular weight:318.33 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS:<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>Formula:C61H87N17O14Purity:Min. 95%Molecular weight:1,282.45 g/molZ-Homoarg (Pbf)-OH
CAS:<p>Please enquire for more information about Z-Homoarg (Pbf)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H38N4O7SPurity:Min. 95%Molecular weight:574.69 g/molFA-Phe-Ala-OH
CAS:<p>F-Phe-Ala-OH is a peptidyl amide that is ionizable at physiological pH. It has a constant and kinetic residue, as well as a hydrophobic, uncharged, and carboxypeptidase activity. F-Phe-Ala-OH catalyzes transpeptidation reactions between the amino acid residues of proteins. This reaction involves the elimination of one water molecule from the peptide bond to form an amine and an imine, which are then hydrolyzed to form the new peptide bond. The optimum pH for this catalysis is acidic.</p>Formula:C19H20N2O5Purity:Min. 95%Molecular weight:356.37 g/molFmoc-D-Arg(Pbf)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Cys(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Arg(Pmc)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pmc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Methylsalicylic acid
CAS:<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>Formula:C8H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:152.15 g/molH-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>Formula:C40H58N10O7SPurity:Min. 95%Molecular weight:823.02 g/mol(Tyr0)-Apelin-13 (human, bovine, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr0)-Apelin-13 (human, bovine, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H120N24O18SPurity:Min. 95%Molecular weight:1,714 g/molFmoc-Asp-OAll
CAS:<p>Fmoc-Asp-OAll is a cyclic peptide that has been shown to be active against human cancer cell lines in vitro. Fmoc-Asp-OAll binds to integrin receptors, inhibiting the prostaglandin synthesis pathway and thus reducing inflammation. It also inhibits the activity of enzymes that are involved in inflammatory responses. Fmoc-Asp-OAll is synthesized on solid phase by chemical ligation.</p>Formula:C22H21NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:395.41 g/molOM99-2trifluoroacetate salt
CAS:<p>Please enquire for more information about OM99-2trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H64N8O14Purity:Min. 95%Molecular weight:892.99 g/molLysozyme C (46-61) (chicken) trifluoroacetate salt
CAS:<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>Formula:C72H116N22O29Purity:Min. 95%Molecular weight:1,753.82 g/molH-Arg(NO2)-pNA·HBr
CAS:<p>Please enquire for more information about H-Arg(NO2)-pNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H17N7O5·HBrPurity:Min. 95%Molecular weight:420.22 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/mol3-(Chloromethyl)-5-methylpyridine hydrochloride
CAS:<p>3-(Chloromethyl)-5-methylpyridine hydrochloride (3CMPH) is a chemical compound that is synthesized from chlorine and methylpyridine. 3CMPH can be produced by the reaction of chlorination with toluene or hydrogen chloride. The synthesis of 3CMPH is done in two steps: first, reacting toluene with chlorine gas at high temperature and pressure in the presence of sulfuric acid, followed by the addition of sulfuric acid to the resulting product. In the second step, hydrogen chloride reacts with methylpyridine in an alkaline solution, yielding 3-(chloromethyl)-5-methylpyridine hydrochloride as a white solid. 3CMPH has been shown to have antihistamine effects and can be used for treating allergies. It can also be used as a skin protectant against uv light and rupatadine.</p>Formula:C7H8ClN·HClPurity:Min. 95%Molecular weight:178.06 g/molH-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl
CAS:<p>H-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl is a monoclinic crystalline compound. It has a molecular weight of 607.14 and contains the dipeptide Tyr-Lys in its structure. H-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl crystallizes in the P21/c space group and has an asymmetric unit cell with dimensions a=8.851 Å, b=7.965 Å and c=5.98 Å. This compound has been shown to have antibacterial properties against methicillin resistant Staphylococcus aureus (MRSA) isolates and Clostridium perfringens strains by inhibiting bacterial protein synthesis through inhibition of peptidyl transferase activity.</p>Formula:C19H21N3O3·HClPurity:Min. 95%Molecular weight:375.85 g/molFmoc-2-fluoro-L-phenylalanine
CAS:<p>Please enquire for more information about Fmoc-2-fluoro-L-phenylalanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H20FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:405.42 g/molFmoc-Trp(Boc)-Thr(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Trp(Boc)-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H41N3O8Purity:Min. 95%Molecular weight:667.75 g/molAngiotensin I/II (4-8)
CAS:<p>Angiotensin I/II (4-8) H-Tyr-Ile-His-Pro-Phe-OH is a peptide that contains the sequence of angiotensin I and II. It has been shown to have proton transport properties, which may be related to its sequence. The amino acid sequence of this peptide is similar to other pentapeptides such as insulin and vasopressin. This peptide has been linked to a vector that can cross the blood brain barrier, allowing it to act on the central nervous system.</p>Formula:C35H45N7O7Purity:Min. 95%Molecular weight:675.77 g/molH-Ile-Ser-OH trifluoroacetic acid
CAS:<p>H-Ile-Ser-OH trifluoroacetic acid is a bioactive compound that has been cocrystallized with N,N′-dimethylformamide and analyzed using liquid chromatography/mass spectrometry. It has been shown to be hydrophilic and soluble in water. H-Ile-Ser-OH trifluoroacetic acid has also been detected by mass spectrometric methods as well as electrospray mass spectrometry.</p>Formula:C9H18N2O4•TFAPurity:Min. 95%Molecular weight:218.25 g/molZ-Tyr-Tyr-OH
CAS:<p>Please enquire for more information about Z-Tyr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H26N2O7Purity:Min. 95%Molecular weight:478.49 g/molH-D-Leu-D-Leu-OH
CAS:<p>H-D-Leu-D-Leu-OH is a type of molecule that can be found in the human body. It is an amino acid with specificities and transport mechanisms that are not yet well understood. This compound is resistant to aminopeptidase activity and has been shown to have a ph optimum in the intestinal tract. Acetylation of this molecule may also have an effect on its transport rate, as it has been shown to affect the transport rate of D-tryptophan and D-alanine. H-D-Leu-D-Leu-OH is a type of molecule that can be found in the human body. It is an amino acid with specificities and transport mechanisms that are not yet well understood. This compound is resistant to aminopeptidase activity and has been shown to have a ph optimum in the intestinal tract. Acetylation of this molecule may also have an effect on its transport rate, as</p>Formula:C12H24N2O3Purity:Min. 95%Molecular weight:244.33 g/molZ-Gly-Gly-Ala-OH
CAS:<p>Please enquire for more information about Z-Gly-Gly-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O6Purity:Min. 95%Molecular weight:337.33 g/molSuc-Ala-Lys-Pro-Phe-pNA
CAS:<p>Suc-Ala-Lys-Pro-Phe-pNA is a casein that has been modified to contain additional lysine residues. This modification increases the protein’s stability, making it more resistant to hydrolysis by phosphatases. Suc-Ala-Lys-Pro-Phe-pNA also contains a peptide sequence that is homologous to a part of the endoplasmic reticulum chaperone FK506 binding protein (FKBP). The peptide sequence in this casein acts as an artificial chaperone and can be used in cell culture experiments to stabilize newly synthesized proteins.</p>Formula:C33H43N7O9Purity:Min. 95%Molecular weight:681.74 g/mol(Des-Gly10,His(Bzl)6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,His(Bzl)6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/molFmoc-Ala-(Dmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Ala-(Dmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N2O7Purity:Min. 95%Molecular weight:518.56 g/molFmoc-Sar-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Sar-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Neuropeptide FF (5-8) acetate salt
CAS:<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H39N9O5Purity:Min. 95%Molecular weight:545.63 g/molDnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt
CAS:<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>Formula:C52H77N17O14Purity:Min. 95%Molecular weight:1,164.27 g/molAcetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH
CAS:<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N17O15Purity:Min. 95%Molecular weight:1,338.51 g/molNeuropeptide F trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide F trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C210H328N58O58Purity:Min. 95%Molecular weight:4,593.21 g/molLQEQ-19 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about LQEQ-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C106H165N29O34Purity:Min. 95%Molecular weight:2,389.62 g/molBoc-(Dmmb(Trt))Gly-OH
CAS:<p>Please enquire for more information about Boc-(Dmmb(Trt))Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H37NO6SPurity:Min. 95%Molecular weight:599.74 g/molBoc-Ala-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-DL-Lys(Ac)-OH
CAS:<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N2O4Purity:Min. 95%Molecular weight:230.26 g/molZ-Arg-Arg-Pro-Phe-His-Sta-Ile-His-Lys(Boc)-OMe
CAS:<p>Z-Arg-Arg-Pro-Phe-His-Sta-Ile-His-Lys(Boc)-OMe is an angiotensin II analogue that is used for the treatment of blood disorders. It inhibits angiotensin converting enzyme (ACE) and prevents the formation of angiotensin II from angiotensin I. ACE inhibitors are also used to treat diseases such as glomerular dysfunction, congestive heart failure, high blood pressure, and cirrhosis. In addition, it has been shown to be effective in treating cardiovascular diseases such as hypertension and heart disease. ZARAPROHES is a synthetic substrate for nitrosation reactions and can be used to produce monoclonal antibodies against ACE.</p>Formula:C72H110N20O15Purity:Min. 95%Molecular weight:1,495.77 g/molH-Gly-Lys-His-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Lys-His-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H24N6O4Purity:Min. 95%Molecular weight:340.38 g/molNectofibrin Hexapeptide (rat)
CAS:<p>Nectofibrin Hexapeptide is a peptide that interacts with the antigen-binding site of an antibody. It has been shown to be able to bind to the ovary cells of rats and may have diagnostic value in autoimmune diseases such as idiopathic thrombocytopenic purpura. The sequence of this molecule is Arg-Gly-Asp, which shows complementarity with the receptor binding site on the ovary cells. This peptide could be used for immunotherapy or diagnostics in autoimmune diseases.</p>Formula:C32H47N7O9Purity:Min. 95%Molecular weight:673.76 g/molFmoc-α-Me-Lys(Boc)-OH
CAS:<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>Formula:C27H34N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:482.57 g/molFmoc-Gly-Pro-Hyp-OH
CAS:<p>Fmoc-Gly-Pro-Hyp-OH is a synthetic single-stranded amide with a stepwise hydrogen bond. The synthesis of this compound starts with the creation of an ester by reacting an acid and alcohol in the presence of catalysts. The ester is then reacted with a primary amine to form an amide, which can be hydrolyzed to release the desired product. This synthetic process has been used for the production of collagen and cyclic peptides. Fmoc-Gly-Pro-Hyp-OH has been modified to include modifications such as alkene and modifications such as strategies, synthons, and isosteres.</p>Formula:C27H29N3O7Purity:Min. 95%Molecular weight:507.54 g/molCART (55-76) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (55-76) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H166N26O33S3Purity:Min. 95%Molecular weight:2,440.82 g/mol(1,10-Phenanthroline)tris[4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedionato]europium(III)
CAS:<p>(1,10-Phenanthroline)tris[4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedionato]europium(III) is a luminescent europium complex that is used in the development of microcapsules for fluorescence microscopy. The (1,10-phenanthroline) ligand is a chelate molecule that can be exchanged with other ligands to change the optical properties of the complex. The fluorescence microscope detects the emitted light at 488 nm and 514 nm wavelengths. The luminescent europium complex emits light when it binds to an organic molecule such as vinyl alcohol or water vapor. Ternary complexes are formed between the europium ion and two different ligands. Optical properties depend on the type of ligands present in these ternary complexes. This product has been shown to have chemical structures that are similar to those</p>Purity:Min. 95%Pyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/molL-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide
CAS:<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>Formula:C19H31N3O6Purity:Min. 95%Molecular weight:397.47 g/molFmoc-α-amino-D-Gly(Boc)-OH
CAS:<p>Please enquire for more information about Fmoc-α-amino-D-Gly(Boc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H24N2O6Purity:Min. 95%Molecular weight:412.44 g/molCholecystokinin Octapeptide (1-3) (desulfated)
CAS:<p>Cholecystokinin Octapeptide (1-3) (desulfated) is a research chemical that has various applications in the field of chemistry and biology. This compound contains a hydrogen atom that plays a crucial role in solvation processes. It can be used in supercritical reactions due to its ability to interact with hydroxyl groups on metallic surfaces like silicon substrates. Additionally, Cholecystokinin Octapeptide (1-3) (desulfated) is utilized in thiol-ene reactions and chromatographic separations.</p>Formula:C18H25N3O7SPurity:Min. 95%Molecular weight:427.47 g/molH-Leu-Arg-Arg-Arg-Arg-Phe-D-Ala-Phe-Cys(NPys)-NH2
CAS:<p>Please enquire for more information about H-Leu-Arg-Arg-Arg-Arg-Phe-D-Ala-Phe-Cys(NPys)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H92N24O11S2Purity:Min. 95%Molecular weight:1,377.65 g/molZ-Lys-Pro-4MbNA formiate salt
CAS:<p>Please enquire for more information about Z-Lys-Pro-4MbNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H36N4O5Purity:Min. 95%Molecular weight:532.63 g/mol(R)-Omeprazole
CAS:<p>Omeprazole is a proton pump inhibitor that inhibits gastric acid secretion by binding to the H+/K+ ATPase enzyme in the secretory canaliculi of the parietal cells. Omeprazole has been shown to have a protective effect in animal models against infection with Salmonella enterica serovar Typhimurium, and also protects against ulcers caused by Helicobacter pylori infection. Omeprazole is used as an adjunct treatment for patients with non-infectious gastroesophageal reflux disease (GERD) or active duodenal ulcers. It has also been used for the prevention of stress-related mucosal damage in critically ill patients, although it is not approved for this use. Omeprazole can be administered orally or by injection. When administered orally, omeprazole may cause gastrointestinal side effects such as nausea, abdominal pain, and diarrhea. Omeprazole can interact with other drugs such</p>Formula:C17H19N3O3SPurity:Min. 95%Color and Shape:Off-White PowderMolecular weight:345.42 g/molH-Met-Met-OH
CAS:<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>Formula:C10H20N2O3S2Purity:Min. 95%Color and Shape:White PowderMolecular weight:280.41 g/molAc-tBu-Gly-tBu-Gly-Asn(Me)2-Ala-AMC
CAS:<p>Please enquire for more information about Ac-tBu-Gly-tBu-Gly-Asn(Me)2-Ala-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H50N6O8Purity:Min. 95%Molecular weight:658.79 g/molDynorphin A (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H127N25O14Purity:Min. 95%Molecular weight:1,602.97 g/molZ-Phe-Leu-OH
CAS:<p>Z-Phe-Leu-OH is a protease inhibitor that belongs to the group of peptidyl-protease inhibitors. It inhibits the activity of a wide range of proteases and is specifically active against carboxypeptidases A and B. Z-Phe-Leu-OH has been shown to be specific for these enzymes, with no inhibitory activity against other proteases such as aminopeptidases, serine proteases, or metalloproteases. The amino acid composition of this protease inhibitor is different from other inhibitors that have been studied in detail. This agent was found to be more effective than phenylmethylsulfonyl fluoride (PMSF) at inhibiting carboxypeptidase A and B.<br>Z-Phe-Leu-OH has been shown to be an acidic compound with a pKa of 5.5; however, it does not react with chloromethyl ketone</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/mol(Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H68N10O12S2Purity:Min. 95%Molecular weight:1,089.29 g/mol(Thr6)-Bradykinin
CAS:<p>Bradykinin is a peptide hormone that functions as a neurotransmitter, neuromodulator, and vasodilator. Bradykinin is released from the cell in response to tissue injury or inflammation. Bradykinin binds to the bradykinin receptors B2 and B1 on the surface of cells and stimulates them, which causes pain relief and vasodilation. Bradykinin is synthesized as an inactive pro-peptide (Tyr6) that undergoes proteolytic cleavage by proteases such as thrombin, trypsin, chymotrypsin, and elastase. The amino acid sequence of the active form of bradykinin is Thr6-Bradykinin H-Arg-Pro-Pro-Gly-Phe-Thr-Pro-Phe-Arg-OH.</p>Formula:C51H75N15O11Purity:Min. 95%Molecular weight:1,074.24 g/molPerfluoro-N-(4-methylcyclohexyl)piperidine
CAS:Controlled Product<p>Perfluoro-N-(4-methylcyclohexyl)piperidine (4-FPP) is a fluorine compound that has been shown to inhibit the enzymatic activity of tyrosine kinases. It is a potent inhibitor of both human and murine tyrosine kinases, but it does not bind to bacterial tyrosine kinase domains. 4-FPP has been used in clinical studies as an anti-cancer drug, although it's clinical relevance remains unclear. It has also been shown to be effective against the influenza virus by inhibiting the synthesis of viral proteins that are involved in replication. The chemical structure of 4-FPP contains a carbonyl group that can react with other compounds through a photochemical process. This reaction is thought to result in the development of new drugs with similar biochemical properties to 4-FPP.</p>Formula:C12F23NPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:595.1 g/mol(Nle 8·18,Tyr34)-pTH (7-34) amide (bovine)
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (7-34) amide (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C158H248N48O49Purity:Min. 95%Molecular weight:3,603.95 g/molH-Val-Phe-OH
CAS:<p>H-Val-Phe-OH is a peptide consisting of three amino acids, Valine, Phenylalanine and Hydroxyproline. It is a small molecule that has been shown to have an antihypertensive effect in rats. H-Val-Phe-OH binds to the dihydropyridine receptor on the cell membrane surface, which causes blood vessels to relax and contract. This action leads to decreased blood pressure. The high reactivity of H-Val-Phe-OH with other molecules makes it biodegradable, which means it can be broken down by water or enzymes into smaller molecules that are less harmful to the environment.</p>Formula:C14H20N2O3Purity:Min. 95%Molecular weight:264.32 g/molZ-D-Ala-Phe-OH
CAS:<p>Please enquire for more information about Z-D-Ala-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H22N2O5Purity:Min. 95%Molecular weight:370.4 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N4O5Purity:Min. 95%Molecular weight:302.33 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molSyndyphalin SD-33
CAS:<p>Please enquire for more information about Syndyphalin SD-33 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H34N4O5SPurity:Min. 95%Molecular weight:502.63 g/mol(Des-Tyr1)-Leu-Enkephalin
CAS:<p>Des-Tyr1-Leu-Enkephalin H-Gly-Gly-Phe-Leu-OH is a synthetic opioid peptide that acts as a neuroprotective agent and has been shown to enhance the expression of nerve growth factor. It also has immunomodulatory effects by interacting with opioid receptors and regulating the production of inflammatory cytokines. Des-Tyr1-Leu-Enkephalin H-Gly-Gly-Phe-Leu-OH binds to opioid receptors in the central nervous system, thereby triggering a response that leads to pain relief and suppression of cough reflexes. This peptide has been shown to be effective in clinical trials for patients with neuropathic pain or postoperative ileus. It also shows promise as an analgesic for cancer patients with chronic pain, although this use is still experimental.</p>Formula:C19H28N4O5Purity:Min. 95%Molecular weight:392.45 g/molH-Gly-His-OH
CAS:<p>H-Gly-His-OH is a cationic surfactant that can be used as an emulsifying agent, dispersing agent, or wetting agent. It has been shown to form model complexes with hydrogen bond strength and the ability to bind to nitrogen atoms. H-Gly-His-OH has been detected in a detectable concentration of 0.01% in neutral pH and at least 0.1% in acidic pH. The chemical shift of the proton NMR spectra for H-Gly-His-OH are found at 8.5 ppm (δ) and 8.2 ppm (δ). Magnetic resonance spectroscopy performed on ternary mixtures containing H-Gly-His-OH show peaks at δ 2.6 ppm and δ 1.9 ppm from the amide protons of the His residue, which are characteristic for this molecule's chemical structure.</p>Formula:C8H12N4O3Purity:Min. 95%Molecular weight:212.21 g/molH-His-Leu-Pro-Pro-Pro-Val-His-Leu-Pro-Pro-Pro-Val-OH
CAS:<p>Please enquire for more information about H-His-Leu-Pro-Pro-Pro-Val-His-Leu-Pro-Pro-Pro-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H98N16O13Purity:Min. 95%Molecular weight:1,299.56 g/molAngiotensin I/II (1-5)
CAS:<p>Please enquire for more information about Angiotensin I/II (1-5) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H48N8O9Purity:Min. 95%Molecular weight:664.75 g/molPeptide 6A
CAS:<p>Peptide 6A is a cyclic peptide that has been shown to have analgesic and anti-inflammatory effects. It is synthesized by conjugating the amino acid alanine to the N-terminal of arginine, which leads to a polymer conjugate. The cyclic peptide has been shown to inhibit pain responses in anesthetized animals as well as inhibit blood pressure in rats with hypertension. In addition, it showed significant vasodilatory effects and inhibited sodium citrate induced platelet aggregation. Treatment with peptide 6A also decreases fibrinogen levels in humans and showed radical scavenging activities in human serum.</p>Formula:C23H43N9O6Purity:Min. 95%Molecular weight:541.64 g/molH-Gly-Phe-Arg-Gly-Asp-Gly-Gln-OH
CAS:<p>Arg-gly-asp is a synthetic peptide that has been shown to have biological activity in vitro. This peptide is an agonist of the receptor for extracellular matrix proteins, such as fibronectin and vitronectin. It has been shown to reversibly inhibit the binding of fibronectin and vitronectin to immobilized antibody in vitro and also to inhibit endometrial cell proliferation in vivo. Arg-gly-asp was found to be dose-dependent with a maximal effect at 1 microgram/mL.</p>Formula:C30H45N11O11Purity:Min. 95%Molecular weight:735.75 g/molH-D-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-D-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molpTH-Related Protein (1-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>Formula:C180H288N58O47Purity:Min. 95%Molecular weight:4,016.58 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/molN-((RS)-2-Hydroxy-propyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-((RS)-2-Hydroxy-propyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H33N3O3Purity:Min. 95%Molecular weight:363.49 g/molHistatin-8
CAS:<p>Please enquire for more information about Histatin-8 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H99N25O17Purity:Min. 95%Molecular weight:1,562.69 g/molPreptin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H268N48O51Purity:Min. 95%Molecular weight:3,932.36 g/mol2-Bromo-1-methyl-4-(methylsulfonyl)benzene
CAS:<p>Please enquire for more information about 2-Bromo-1-methyl-4-(methylsulfonyl)benzene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H9BrO2SPurity:Min. 95%Molecular weight:249.13 g/molPyr-Phe-Leu-pNA
CAS:<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>Formula:C26H31N5O6Purity:Min. 95%Molecular weight:509.55 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H70N12O20Purity:Min. 95%Molecular weight:1,195.19 g/molAc-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H82N16O11S3Purity:Min. 95%Molecular weight:1,167.47 g/mol(D-Arg1,D-Phe5,D-Trp7·9,Leu11)-Substance P
CAS:<p>Substance P is a neuropeptide that binds to the tachykinin receptor NK1. It has potent anti-inflammatory and mitogenic activities, which are mediated through its binding to the NK1 receptor. Substance P can stimulate lung cancer cells to proliferate and inhibit their apoptosis, which may be due to an autocrine mechanism. In addition, it has been shown that substance P can potentiate the growth of some cancers such as colon cancer in vitro and in vivo by increasing DNA synthesis and cell proliferation. This peptide also has a dose-dependent effect on cell growth, with high doses inhibiting cell proliferation at higher levels than low doses.</p>Formula:C79H109N19O12Purity:Min. 95%Molecular weight:1,516.83 g/molPmc-S-methylisothiourea
CAS:<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Formula:C16H24N2O3S2Purity:Min. 95%Color and Shape:PowderMolecular weight:356.51 g/molH-Arg-Phe-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N6O4Purity:Min. 95%Molecular weight:392.45 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H285N55O57SPurity:Min. 95%Molecular weight:4,271.69 g/molAngiogenin (108-122)
CAS:<p>Please enquire for more information about Angiogenin (108-122) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H125N25O23Purity:Min. 95%Molecular weight:1,780.98 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H47FN4O15Purity:Min. 95%Molecular weight:878.85 g/mol(S,S)-(-)-Bis(a-methylbenzyl)amine Hcl
CAS:<p>Please enquire for more information about (S,S)-(-)-Bis(a-methylbenzyl)amine Hcl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H19N·HClPurity:Min. 95%Molecular weight:261.79 g/molHypertrehalosaemic Neuropeptide (Heliothis zea)
CAS:<p>Heliothis zea Pyr-Leu-Thr-Phe-Ser-Ser-Gly-Trp-Gly-Asn -NH2 is a residue found in the hemolymph of Heliothis zea. It has been shown to have ligand uptake properties and can be used to measure lipid levels in the hemolymph. The chromatographic analysis of this protein has been performed with the use of assays that are specific for the receptor subtype. The ligand concentration was measured by the synthetic methods, which were developed from tobacco extracts. This protein is active at extracellular concentrations and has high affinity for trehalose, a carbohydrate.</p>Formula:C49H67N13O15Purity:Min. 95%Molecular weight:1,078.13 g/molAtriopeptin I (rat)
CAS:<p>Atriopeptin I is a peptide hormone that is produced in the rat mesenteric gland. It has been shown to have β-amino acid, diagnostic agents, ph optimum, and receptor activity. Atriopeptin I has been found to have atrial natriuretic effects and may be useful for the treatment of infectious diseases. Atriopeptin I has also been shown to bind with a monoclonal antibody and enzyme inhibitors as well as having a disulfide bond. The biological function of this peptide hormone is not yet known, but it is thought to be involved in fatty acid metabolism.</p>Formula:C83H135N29O30S2Purity:Min. 95%Molecular weight:2,083.27 g/molZ-Gly-Gly-Gly-OSu
CAS:<p>Please enquire for more information about Z-Gly-Gly-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H20N4O8Purity:Min. 95%Molecular weight:420.37 g/mol4-Amino-3-methoxypyridine
CAS:<p>4-Amino-3-methoxypyridine (4AMMP) is a naturally occurring amino acid that can be found in the nuclei of innervated tissues. It is an inhibitor of the enzyme tyrosine hydroxylase and inhibits the synthesis of catecholamines. The concentration of 4AMMP in blood was measured by radioactivity. This agent has been used for studies on the thalamic nucleus and cortex, as well as for measuring catecholamine levels in tissue homogenates.</p>Formula:C6H8N2OPurity:Min. 95%Molecular weight:124.14 g/molAc-Ala-Gln-Ala-pNA
CAS:<p>Please enquire for more information about Ac-Ala-Gln-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N6O7Purity:Min. 95%Molecular weight:450.45 g/mol(S)-1-Phenyl-2-propanol
CAS:<p>(S)-1-Phenyl-2-propanol is a chiral, enantiopure alcohol that is used as a substrate for the preparation of various drugs. It can be prepared by the reduction of (R)-1-phenyl-2-propanol with sodium borohydride. To obtain the desired product, high substrate concentrations are required. Molecular modeling and bioreactor studies have shown that this process can also be carried out in cells. Subtilis sps. were found to be suitable for this process due to their ability to synthesize (S)-1-phenyl-2-propanol from 6-phosphate and l-tert-leucine in a stepwise manner. The use of subtilis sps. may reduce the cost and time needed for production of (S)-1-phenyl-2-propanol because it does not require expensive starting materials or purification steps.END>></p>Formula:C9H12OPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:136.19 g/mol2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride
CAS:<p>Please enquire for more information about 2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H27ClN2O2Purity:Min. 95%Molecular weight:290.83 g/mol(Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct
CAS:<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/mol(Pro30,Tyr32,Leu34)-Neuropeptide Y (28-36)
CAS:<p>Please enquire for more information about (Pro30,Tyr32,Leu34)-Neuropeptide Y (28-36) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H91N17O12Purity:Min. 95%Molecular weight:1,206.44 g/molDABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt
CAS:<p>Please enquire for more information about DABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H91N15O21SPurity:Min. 95%Molecular weight:1,522.64 g/molMca-Leu-Glu-Val-Asp-Gly-Trp-Lys(Dnp)-NH2
CAS:<p>Please enquire for more information about Mca-Leu-Glu-Val-Asp-Gly-Trp-Lys(Dnp)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H70N12O19Purity:Min. 95%Molecular weight:1,227.24 g/molp-Hydroxyhippuryl-His-Leu-OH
CAS:<p>P-hydroxyhippuryl-His-Leu-OH is a natriuretic that has been shown to have beneficial effects on diabetic patients. It can be used to prevent and treat proliferative diabetic retinopathy, which is a complication of diabetes. P-hydroxyhippuryl-His-Leu-OH increases the glomerular filtration rate and decreases the ventricular mass index, which may be due to its ability to inhibit angiotensin II receptors in the brain. P-hydroxyhippuryl-His-Leu-OH also inhibits angiotensin converting enzyme, an enzyme that converts angiotensin I into angiotensin II. This inhibition leads to an increase in levels of atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and the downstream effectors of these peptides, namely nitric oxide synthase and cyclooxygenase</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/molAc-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2
CAS:<p>Please enquire for more information about Ac-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H116N24O17Purity:Min. 95%Molecular weight:1,721.96 g/molFarnesyl-Met-OMe
CAS:<p>Please enquire for more information about Farnesyl-Met-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H37NO2SPurity:Min. 95%Molecular weight:367.59 g/molTos-Gly-Pro-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N7O7S·HClPurity:Min. 95%Molecular weight:676.18 g/molZ-Gly-Val-OH
CAS:<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formula:C15H20N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:308.33 g/molDiethyl (5-phenylisoxazol-3-yl) phosphate
CAS:<p>Diethyl (5-phenylisoxazol-3-yl) phosphate is a chlorpyrifos analog that is detectable in the blood and urine. The compound has been detected in red blood cells, plasma, serum, and urine samples at levels of 10 to 50 μg/L. Diethyl (5-phenylisoxazol-3-yl) phosphate can be used as an analytical method for detecting chlorpyrifos residue on food products or in environmental samples. Diethyl (5-phenylisoxazol-3-yl) phosphate is transfected into human hepatoma cells and activated by carbamate or propanil. It inhibits cellular protein synthesis by binding to the 30S ribosomal subunit, preventing the formation of the initiation complex between aminoacyl tRNA and mRNA. This binding also prevents peptide bond formation between amino acids, leading to cell death.</p>Formula:C13H16NO5PPurity:Min. 95%Molecular weight:297.24 g/molSuc-Ala-Ala-Pro-Lys-pNA
CAS:<p>Suc-Ala-Ala-Pro-Lys-pNA is a hybrid peptide that was expressed and purified from the gene product of the human serine protease, pancreatic elastase. It has been shown to have high salt and pH stability and predominately exists as a single polypeptide chain. Suc-Ala-Ala-Pro-Lys-pNA has been shown to enhance the immunofluorescence of inflammatory cells in vitro, suggesting it may be used as a therapeutic agent for inflammatory diseases. In addition, this hybrid peptide has also demonstrated protease activity.</p>Formula:C27H39N7O9Purity:Min. 95%Molecular weight:605.64 g/molFor-Met-Val-OH
CAS:<p>For-Met-Val-OH is a synthetic molecule that has been shown to inhibit the growth of bacteria by binding to the ribosomal subunit, thereby inhibiting protein synthesis. This compound was synthesized in vitro and has been shown to be effective against single-stranded DNA. For-Met-Val-OH can also bind to the template strand of DNA and inhibit the synthesis of RNA. It binds to functional genes and inhibits their function in a similar manner as natural substrates. This inhibition may be due to inhibition of protein synthesis or other unknown mechanisms. The structure of For-Met-Val-OH is similar to hydroxamic acids, which are known for their antibacterial properties.</p>Formula:C11H20N2O4SPurity:Min. 95%Molecular weight:276.35 g/molH-Lys-Pro-4MbNA·2 HCl
CAS:<p>Please enquire for more information about H-Lys-Pro-4MbNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H30N4O3·2HClPurity:Min. 95%Molecular weight:471.42 g/molHirudin (55-65) (sulfated)
CAS:<p>Please enquire for more information about Hirudin (55-65) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H90N12O27SPurity:Min. 95%Molecular weight:1,491.53 g/molFmoc-Tyr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Pz-Pro-Leu-OH
CAS:<p>Pz-Pro-Leu-OH is a proteolytic enzyme that cleaves proteins by hydrolysis at the peptide bond. It has been shown to be active against Clostridium and has been used in colorimetric methods for the measurement of this bacterium. Pz-Pro-Leu-OH is produced by subtilisin, which is expressed in Escherichia coli. The amount of this enzyme can be monitored and optimized by cloning. Thermolysin, another protease, also cleaves proteins at the peptide bond and has been used to measure the activity of Pz-Pro-Leu-OH.</p>Formula:C25H30N4O5Purity:Min. 95%Molecular weight:466.53 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/mol4-Bromophenylalanine
CAS:<p>4-Bromophenylalanine is a chemical compound that can be used as a spectroscopic probe to study the dynamics of protein synthesis. It is derived from 4-bromobenzaldehyde, which is oxidized by hydrogen peroxide in the presence of cytochrome P450 reductase and NADPH, yielding 4-bromophenylalanine. This compound has been shown to inhibit protein synthesis by binding reversibly to the synthetase during its synthetic cycle. The binding of 4-bromophenylalanine inhibits the synthesis of peptides with a C-terminal amide group. This inhibition leads to a decrease in the amount of functional groups present in proteins and an increase in the amount of buffers. These effects have been demonstrated through modelling studies using both model organisms and buffer solutions.</p>Formula:C9H10BrNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:244.09 g/molH-Gly-Gly-Pro-Ala-OH
CAS:<p>Glycosaminoglycans are polysaccharides that are made of repeating disaccharide units composed of a sugar and a uronic acid. Glycosaminoglycans serve as structural components in the extracellular matrix, where they provide tensile strength and elasticity to tissues. They also function as enzymes, providing energy for cellular processes. This glycosaminoglycan is found in human tissue, specifically the cervix and blood group antigens. It has been shown to have an effect on creatine kinase activity, which can be used as a screening tool for women who have had hysterectomies or biopsies done.</p>Formula:C12H20N4O5Purity:Min. 95%Molecular weight:300.31 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/mol(Tyr1)-TRAP-7 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-TRAP-7 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H67N11O10Purity:Min. 95%Molecular weight:922.08 g/molZ-Gly-Pro-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H34N8O7·C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:642.66 g/molH-D-Lys-NH2·2 HCl
CAS:<p>Please enquire for more information about H-D-Lys-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H15N3O·2HClPurity:Min. 95%Molecular weight:218.12 g/molBiphalin trifluoroacetate salt (
CAS:<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>Formula:C46H56N10O10Purity:Min. 95%Molecular weight:909 g/molH-Ala-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Ala-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H17N3O2·HClPurity:Min. 95%Molecular weight:271.74 g/molH-Gly-Gly-pNA·HCl
CAS:<p>Please enquire for more information about H-Gly-Gly-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12N4O4·HClPurity:Min. 95%Molecular weight:288.69 g/molFmoc-D-Thr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Thr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>Formula:C33H41N7O11Purity:Min. 95%Molecular weight:711.72 g/molFmoc-His-OMe
CAS:<p>Please enquire for more information about Fmoc-His-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H21N3O4Purity:Min. 95%Molecular weight:391.42 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H175N31O35S2Purity:Min. 95%Molecular weight:2,627.95 g/mol2-O-Benzyl-3-O-allyl-sn-glycerol
CAS:<p>Please enquire for more information about 2-O-Benzyl-3-O-allyl-sn-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H18O3Purity:Min. 95%Molecular weight:222.28 g/molBoc-Thr(Ala-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Ala-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O8Purity:Min. 95%Color and Shape:PowderMolecular weight:512.55 g/molH-Ser(tBu)-AMC·HCl
CAS:<p>Please enquire for more information about H-Ser(tBu)-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H22N2O4·HClPurity:Min. 95%Molecular weight:354.83 g/molTau-fluvalinate
CAS:<p>Tau-fluvalinate is a pesticide that is used to control ectoparasites. It has been shown to be effective against fleas, ticks, and mites. Tau-fluvalinate binds to the active site of the enzyme protein kinase C (PKC). This binding prevents the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3), which is required for cell signaling pathways and protein synthesis. Tau-fluvalinate also inhibits detoxification enzymes such as glutathione S-transferase (GST) and cytochrome P450 reductase. Tau-fluvalinate has been shown to have no sublethal effects on insects in vitro or in vivo at doses below its LD50. Tau-fluvalinate can also be used as an analytical standard for detecting polycyclic aromatic hydrocarbons in water samples with chemical ionization gas chromatography.</p>Formula:C26H22ClF3N2O3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:502.91 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H65N7O15Purity:Min. 95%Molecular weight:908 g/molH-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(S)-(-)-3-Chloro-1-phenyl-1-propanol
CAS:<p>(S)-(-)-3-Chloro-1-phenyl-1-propanol is an efficient method for the synthesis of chiral propiophenone. It is synthesized by reacting a mixture of borane and tetrahydrofuran with (S)-(-)-3-chloro-1-phenylpropanol. This reaction produces the desired compound in good yield and high diastereoselectivity. The synthesis of this compound has been shown to be useful for the production of antidepressant drugs, such as κ-opioid receptor ligands, which are used to treat depression, anxiety, and chronic pain.</p>Formula:C9H11ClOPurity:Min. 95%Molecular weight:170.64 g/molH-Lys-Phe-OH·HCl
CAS:<p>Please enquire for more information about H-Lys-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N3O3·HClPurity:Min. 95%Molecular weight:329.82 g/molH-Gly-His-Arg-Pro-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N10O4Purity:Min. 95%Molecular weight:464.52 g/molProtein Kinase P34 (cd2) Substrate trifluoroacetate salt
CAS:<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>Formula:C106H172N32O32Purity:Min. 95%Molecular weight:2,406.7 g/mol((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt
CAS:<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H60N10O15S2Purity:Min. 95%Molecular weight:1,177.27 g/mol(D-Trp6)-LHRH pamoate salt
CAS:<p>The hormone LHRH is a decapeptide that stimulates the production of gonadotropins, which stimulate the synthesis and release of sex hormones. LHRH has been used for the treatment of prostate cancer. It can be administered in the form of a long-acting ester formulation, such as the pamoate salt (Pyr-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly), or as an analog, such as triptorelin acetate. The analogs are more potent than LHRH and have greater efficacy in preventing tumor growth and inducing regression. Analogs may be administered in microcapsules for extended release or orally to provide higher levels of drug at target sites. The ester linkages between amino acids allow for a sustained release of LHRH over time. These esters are hydrolyzed by enzymes present in plasma and tissues, releasing active LHRH into circulation that binds</p>Formula:C64H82N18O13·xC23H16O6Purity:Min. 95%Molecular weight:1,311.45 g/mol(Tyr38,Phe42·46)-Osteocalcin (38-49) (human)
CAS:<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H101N19O17Purity:Min. 95%Molecular weight:1,516.7 g/molAc-Ser-Gly-OH
CAS:<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molH-Tyr-Thr-NH2 hydrochloride salt
CAS:<p>Please enquire for more information about H-Tyr-Thr-NH2 hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19N3O4Purity:Min. 95%Molecular weight:281.31 g/molBoc-Arg-SBzl·HCl
CAS:<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N4O3S·HClPurity:Min. 95%Molecular weight:416.97 g/molAc-Leu-Glu-Thr-Asp-AFC
CAS:<p>Please enquire for more information about Ac-Leu-Glu-Thr-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H38F3N5O12Purity:Min. 95%Molecular weight:729.66 g/molH-Gly-D-Tyr-OH
CAS:<p>Please enquire for more information about H-Gly-D-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H14N2O4Purity:Min. 95%Molecular weight:238.24 g/molHIV (gp120) Antigenic Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H211N41O31SPurity:Min. 95%Molecular weight:2,720.25 g/molZ-D-Arg(Z)2-OH
CAS:<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H32N4O8Purity:Min. 95%Molecular weight:576.6 g/molSuc-Val-Pro-Phe-SBzl
CAS:<p>Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.</p>Formula:C30H37N3O6SPurity:Min. 95%Molecular weight:567.7 g/mol(Pyr 6,Pro9)-Substance P (6-11)
CAS:<p>(Pyr 6,Pro 9)-Substance P (6-11) Pyr-Phe-Phe-Pro-Leu-Met-NH2 is a peptide that has been shown to have locomotor activity in rats, receptor activity, and physiological effects. This peptide binds to the κ opioid receptor and the neurokinin 1 receptor. It was found to have antimicrobial properties against gram positive bacteria and gram negative bacteria. In addition, it has been shown to be an inhibitor of fatty acid synthesis. This molecule also has been studied for its ability to treat metabolic disorders by inhibiting malonic acid production in animals.</p>Formula:C39H53N7O7SPurity:Min. 95%Molecular weight:763.95 g/molPAR-4 (1-6) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H45N7O8Purity:Min. 95%Molecular weight:667.75 g/molZ-Asp(OtBu)-bromomethylketone
CAS:<p>Please enquire for more information about Z-Asp(OtBu)-bromomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H22BrNO5Purity:Min. 95%Molecular weight:400.26 g/molH-Phe-Pro-bNA·HCl
CAS:<p>Please enquire for more information about H-Phe-Pro-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H25N3O2·HClPurity:Min. 95%Molecular weight:423.93 g/molSar-Pro-OH
CAS:<p>Please enquire for more information about Sar-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O3Purity:Min. 95%Molecular weight:186.21 g/mol(Lys8-psi(CH2NH)Lys9)-Neurotensin (8-13)
CAS:<p>Neurotensin (NT) is a neuropeptide that is derived from the prepro-NT gene. It binds to the neurotensin receptor 1 (NTSR1) and has been shown to regulate intestinal motility, as well as function as an adjuvant therapy for enteric diseases. Neurotensin has been shown to be neuroprotective against dopamine toxicity in cell cultures, and could be used in cancer therapy. The profile of neurotensin has been studied in clinical trials for metastatic breast cancer and other cancers. Neurotensin does not have any significant safety issues, although it can cause neuronal death when administered intracerebroventricularly.</p>Formula:C38H66N8O7Purity:Min. 95%Molecular weight:746.98 g/molGalanin (1-16) (mouse, porcine, rat)
CAS:<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H116N20O21Purity:Min. 95%Molecular weight:1,669.88 g/molBoc-Thr(Ile-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Ile-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H38N2O8Purity:Min. 95%Molecular weight:554.63 g/mol(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H77N17O11Purity:Min. 95%Molecular weight:1,200.35 g/molZ-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>Formula:C18H23N3O6Purity:Min. 95%Molecular weight:377.39 g/molBoc-Thr(Bzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Thr(Bzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Conantokin G (free acid)
CAS:<p>Please enquire for more information about Conantokin G (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H137N25O45Purity:Min. 95%Molecular weight:2,265.17 g/molH-Ala-Pro-Ala-OH
CAS:<p>H-Ala-Pro-Ala-OH is a fluorescent amino acid residue that can be used to study the structures of proteins. This amino acid is derived from histidine, and its fluorescence intensity increases when it binds to tryptophan residues near the active site of an enzyme. H-Ala-Pro-Ala-OH has been used for the structural analysis of mutant enzymes that have been engineered to show differences in substrate binding sites. This molecule also has a fluorogenic substrate, which can be used as a replacement for traditional substrates in order to highlight specific regions of a protein or enzyme. The quantum theory was used to calculate the x-ray diffraction data, which were then analyzed using software programs such as MOLMOL and XPLOR. These datasets were then used to create molecular models of H-Ala-Pro-Ala-OH.</p>Formula:C11H19N3O4Purity:Min. 95%Molecular weight:257.29 g/molFmoc-Homoarg (Z)2-OH
CAS:<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H38N4O8Purity:Min. 95%Molecular weight:678.73 g/mol3-Bromo-6-methylpicolinic acid
CAS:<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H6BrNO2Purity:Min. 95%Molecular weight:252.49 g/mol(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.</p>Formula:C121H190N34O35Purity:Min. 95%Molecular weight:2,681.01 g/molBombesin (8-14) acetate salt
CAS:<p>Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt is a bifunctional peptide that has been shown to inhibit the growth of prostate cancer cells. Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt also has antiinflammatory properties and is used in treating inflammatory diseases. It inhibits collagen synthesis and fibrinogen activation, which may be important in the treatment of autoimmune diseases such as rheumatoid arthritis. Bombesin (8 14) acetate salt H Trp Ala Val Gly His Leu Met NH2 Acetate Salt has been shown to have no effect on healthy tissues when administered systemically.</p>Formula:C38H57N11O7SPurity:Min. 95%Molecular weight:812 g/molpTH (18-48) (human)
CAS:<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H251N47O43SPurity:Min. 95%Molecular weight:3,505.02 g/molHippuryl-Lys-OH
CAS:<p>Hippuryl-Lys-OH is a novel, potent and selective serine protease inhibitor that targets human cathepsin B. It has been shown to have inhibitory properties against other serine proteases such as chymotrypsin, trypsin, and elastase. Hippuryl-Lys-OH is used in the treatment of cancer patients with diabetes who require a creatine level less than 400 μM per liter of serum. It also has potential applications in the treatment of Alzheimer's disease and Parkinson's disease due to its ability to inhibit polymerase chain reactions (PCR).</p>Formula:C15H21N3O4Purity:Min. 95%Molecular weight:307.35 g/molFmoc-4,5-dehydro-L-leucine
CAS:<p>Please enquire for more information about Fmoc-4,5-dehydro-L-leucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:351.4 g/mol(Nle 8·18,Tyr34)-pTH (3-34) amide (bovine)
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (3-34) amide (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H279N53O48Purity:Min. 95%Molecular weight:3,917.44 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molSuc-Ala-Ala-Pro-Met-pNA
CAS:<p>Suc-Ala-Ala-Pro-Met-pNA is a proteolytic enzyme that is active at acidic pH and cleaves casein to produce smaller peptides. It has been shown to have anti-inflammatory effects in animal models of inflammatory diseases by inhibiting the production of vasoactive intestinal peptide and other inflammatory mediators. Suc-Ala-Ala-Pro-Met-pNA also has a high salt tolerance and can survive in the presence of chloromethyl ketone, which is used as a chemical tool for protein sequencing. The enzyme produces dodecyl as its cleavage product, which can be used to determine the optimal reaction conditions for this enzyme.</p>Formula:C26H36N6O9SPurity:Min. 95%Molecular weight:608.67 g/mol
