
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,464 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38247 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Somatostatin-14 (reduced)
CAS:<p>Somatostatin-14 (reduced) H-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys is a synthetic peptide that is an adjuvant for vaccines. It induces a biphasic response by increasing the humoral immune response and decreasing the cellular immune response. Somatostatin has been shown to decrease the severity of symptoms in patients with psychiatric disorders and can be used as a long term treatment for these conditions. Somatostatin also has effects on the pancreas, such as inhibiting insulin release, leading to decreased blood glucose levels. Its disulfide bond in its structure may be important for its activity and stability.</p>Formula:C76H106N18O19S2Purity:Min. 95%Molecular weight:1,639.9 g/molH-Tyr-D-Ala-Gly-OH
CAS:<p>H-Tyr-D-Ala-Gly-OH is a chemical compound that is used in the field of molecular biology. It is an amino acid which has been modified to contain a terminal amine group, so it can be coupled to other molecules through a covalent bond. H-Tyr-D-Ala-Gly-OH can be used as a diagnostic marker for mouse monoclonal antibodies. The antibody reacts with the H-Tyr-D-Ala-Gly-OH by binding to its peptide receptors, which are located on the cell surface and inside the cells. This receptor activity can be detected using immunohistochemistry or flow cytometry. Immunohistochemical detection of H-Tyr-D-Ala-Gly--OH is useful for diagnosing cancer, such as breast cancer, where it can be found in high levels in metastatic lesions.</p>Formula:C14H19N3O5Purity:Min. 95%Molecular weight:309.32 g/molH-Arg-Ile-OH acetate salt
CAS:<p>H-Arg-Ile-OH acetate salt is a regulatory protein that is found in plant cells. It has been shown to be involved in the regulation of cancer, as well as having some anti-inflammatory activities. H-Arg-Ile-OH acetate salt also has been shown to inhibit the production of fatty acids and coagulation factors by inhibiting serine proteases and thromboplastin activity, respectively. H-Arg-Ile-OH acetate salt may have an important role in regulating blood clotting by preventing fibrinogen from converting to fibrin, which leads to clot formation.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/mol(D-Leu6,Pro-NHEt 9)-LHRH (4-9)
CAS:<p>Please enquire for more information about (D-Leu6,Pro-NHEt 9)-LHRH (4-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H62N10O8Purity:Min. 95%Molecular weight:774.95 g/molH-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-OH acetate salt is a protease inhibitor. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, in vitro. H-Arg-Arg-OH acetate salt binds to the active site of the enzyme and prevents substrate binding. The acidity of the environment where this inhibitor is active can be used to control its activity. At acidic pH, H-Arg-Arg-OH acetate salt is more potent than at neutral pH. When it comes into contact with a protein substrate, H-Arg-Arg-OH acetate salt will bind to a hydroxyl group on the protein molecule and prevent it from hydrolyzing its substrate. This process can be reversed by adding an alkaline buffer to increase the pH of the system or by adding an acid buffer to decrease it.br>br> H-Arg-Arg-OH acetate salt is found in cyanob</p>Formula:C12H26N8O3Purity:Min. 95%Molecular weight:330.39 g/molFor-Met-Phe-OH
CAS:<p>For-Met-Phe-OH is a synthetic peptide that mimics the amino acid sequence of the human body's natural collagen. It is used as a building block for developing collagen gels, which are used in clinical pathology to identify and quantify cells. For-Met-Phe-OH has been shown to stimulate colony-stimulating factor, which regulates cell proliferation and differentiation. This peptide also plays a role in cell signaling pathways that regulate cell growth and differentiation. For-Met-Phe-OH has been shown to have anti-inflammatory effects by inhibiting the production of inflammatory cytokines.</p>Formula:C15H20N2O4SPurity:Min. 95%Molecular weight:324.4 g/molGastric Inhibitory Polypeptide (1-30) amide (porcine)
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (1-30) amide (porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H245N41O47SPurity:Min. 95%Molecular weight:3,550.99 g/molFmoc-His(Boc)-OPfp
CAS:<p>The Fmoc-His(Boc)-OPfp is a synthetic peptide that has been shown to bind to angiotensin. It is chemically reactive and can be used in diagnostic assays for the detection of angiotensin. The Fmoc-His(Boc)-OPfp can also be used as a feedback control for sequence analysis, where it monitors the reaction sequence by binding to the last amino acid in the peptide. This binding prevents the formation of an enzyme with the enzyme reaction necessary for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>Formula:C32H26F5N3O6Purity:Min. 95%Molecular weight:643.56 g/molAmylin (20-29) (human)
CAS:<p>Amylin is a peptide hormone that belongs to the group of hormones that include insulin and glucagon. Amylin has been shown to have an anti-diabetic effect in diabetic patients by stimulating insulin secretion and improving insulin sensitivity. Amylin inhibits protein aggregation, which may be due to its ability to form hydrogen bonds with other amyloid protein molecules. The structural biology of amylin has been studied using NMR spectroscopy and silver ions. This molecule has a sequence of H-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser, with a molecular weight of 3,726 Da.</p>Formula:C43H68N12O16Purity:Min. 95%Molecular weight:1,009.07 g/molAc-Ile-Glu-Thr-Asp-pNA
CAS:<p>Ac-Ile-Glu-Thr-Asp-PNA is a synthetic peptide that mimics the amino acid sequence of a region in the protein p67phox, which is a component of the mitochondrial membrane. Ac-Ile-Glu-Thr-Asp-PNA induces apoptosis by activating caspases and inhibiting ATP production. In vitro studies have shown this peptide to be active against hl60 cells, an inflammatory bowel disease cell line, as well as carcinoma cell lines derived from squamous cell carcinoma and carcinoma of the cervix. Ac-Ile-Glu-Thr-Asp-PNA also inhibits inflammatory cytokines such as IL1β, TNFα and IL6, which are associated with chronic inflammation.</p>Formula:C27H38N6O12Purity:Min. 95%Molecular weight:638.62 g/mol(D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H210N40O31SPurity:Min. 95%Molecular weight:2,933.44 g/molMca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H82N16O18Purity:Min. 95%Molecular weight:1,327.4 g/molFmoc-Ala-Cys(Psi(Me ,Me)pro)-OH
<p>Please enquire for more information about Fmoc-Ala-Cys(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H26N2O5SPurity:Min. 95%Molecular weight:454.54 g/molSodium L-glutamate
CAS:<p>Glutamate is the most abundant amino acid in the body and plays an important role in metabolism, brain function, and immune function. It is involved in many biochemical reactions and has been found to be associated with liver lesions, thermal expansion, and brain functions. Glutamate also has a role in diseases such as Huntington's disease, amyotrophic lateral sclerosis (ALS), and Parkinson's disease. Furthermore, glutamate is used as a neurotransmitter that regulates the central nervous system. The treatment of diseases can be done through glutamate replacement therapy or by inhibiting glutamate receptors. Glutamate levels in human serum have been shown to increase when blood sampling is taken from individuals with metabolic disorders. Results show high values for glutamate levels in human serum samples collected from patients with metabolic disorders.</p>Formula:C5H9NO4•NaPurity:Min. 95%Color and Shape:PowderMolecular weight:170.12 g/molAc-Lys-Ala-bNA
CAS:<p>Please enquire for more information about Ac-Lys-Ala-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H28N4O3Purity:Min. 95%Molecular weight:384.47 g/molFmoc-Pro-DHPP resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pro-DHPP resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-N-Me-Asp(OBzl)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-Asp(OBzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H25NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:459.49 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/molH-Gly-Gly-OBzl·p-tosylate
CAS:<p>The product is a neutral amino acid with an aliphatic side-chain. The product has been shown to be stable when diluted, and is not subject to hydrolysis. It can be used as a reagent for peptide synthesis because it does not interfere with the reaction or alter the yield of desired products. The product has been shown to be reliable and produce polypeptides that are chemically identical to those obtained by other methods. It has been found that the product is additive in peptide synthesis reactions, so that it can be substituted for any one of the components without altering the yield of desired products.</p>Formula:C11H14N2O3·C7H8O3SPurity:Min. 95%Molecular weight:394.44 g/molTrt-D-Phe-OH·DEA
CAS:<p>Please enquire for more information about Trt-D-Phe-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H25NO2·C4H11NPurity:Min. 95%Molecular weight:480.64 g/molBoc-Thionoleu-1-(6-nitro)benzotriazolide
CAS:<p>Please enquire for more information about Boc-Thionoleu-1-(6-nitro)benzotriazolide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O4SPurity:Min. 95%Molecular weight:393.46 g/molH-2,5-Diiodo-His-OH·HCl
CAS:<p>Please enquire for more information about H-2,5-Diiodo-His-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7I2N3O2·HClPurity:Min. 95%Molecular weight:443.41 g/molN-Boc-4-piperidineacetaldehyde
CAS:<p>N-Boc-4-piperidineacetaldehyde is a chiral, stable, and readily available aldehyde. It has been used in the synthesis of various biologically active molecules including imidazolidinones, which are important for their use as catalysts in organic chemistry. The synthesis of this molecule by the condensation of 4-piperidineacetic acid with acetaldehyde followed by reduction with sodium borohydride is an example of this type of reaction. N-Boc-4-piperidineacetaldehyde can be used to synthesize imines and linkers that are covalently bonded to the protein backbone. This molecule also has conformational stability and is not susceptible to oxidation or radiation damage.</p>Formula:C12H21NO3Purity:Min. 95%Molecular weight:227.3 g/molGAP 27 acetate salt
CAS:<p>GAP 27 is a connexin that is expressed in the cardiac and skin cells. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile-OH acetate salt is made up of a number of amino acids, including serine, arginine, proline, glutamic acid, lysine, threonine and isoleucine. It has been shown to have biological function in vivo models and in vitro assays. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr--Ile--Phe--Ile--Ile--OH acetate salt has been shown to be non toxic to the heart and skin cells. This protein also shows growth factor activity when it interacts with toll like receptor 4 (TLR4) on human skin cells.</p>Formula:C60H101N15O17Purity:Min. 95%Molecular weight:1,304.53 g/molAc-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn-OH
CAS:<p>Please enquire for more information about Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H124N24O20Purity:Min. 95%Molecular weight:1,802.04 g/molFmoc-N-(4-boc-aminobutyl)glycine
CAS:<p>Please enquire for more information about Fmoc-N-(4-boc-aminobutyl)glycine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H32N2O6Purity:Min. 95%Molecular weight:468.54 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Cortistatin-29 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-29 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H223N47O42S3Purity:Min. 95%Molecular weight:3,440.85 g/molSuc-Ala-Ala-Pro-Ile-pNA
CAS:<p>Suc-Ala-Ala-Pro-Ile-pNA is an enzyme that belongs to the family of zymogens. It is a tetrapeptide that is synthesized in the cytosol and transported into the lumen of the intestine, where it is cleaved by trypsin to form pepsin A. In humans, this enzyme has been localized to the duodenum and jejunum. Suc-Ala-Ala-Pro-Ile-pNA is activated by trypsin and cleaves proteins at their carboxyl side chains. It also binds to specific residues in proteins, including those with unpaired cysteine residues.</p>Formula:C27H38N6O9Purity:Min. 95%Molecular weight:590.63 g/molAc-Tyr-OEt
CAS:<p>Ac-Tyr-OEt is a synthetic peptide with the amino acid sequence Ac-Tyr-OEt. It is a signal peptide that enhances the efficiency of protein secretion in soybean cells. It binds to hydroxyl groups on sephadex g-100, which may be due to hydrogen bonding between the two. The rate constant for this reaction has been measured at 2.5 x 10^6 M^(-1)s^(-1) and the caproic acid concentration for half-maximal binding has been determined to be 3 mM. Ac-Tyr-OEt also has protease activity, as demonstrated by its ability to hydrolyze carboxypeptidase A at a rate of 1.7 x 10^4 min^(-1).</p>Formula:C13H17NO4Purity:Min. 95%Molecular weight:251.28 g/molpTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C108H173N27O35Purity:Min. 95%Molecular weight:2,409.69 g/molN-2-Chloroethyl-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-2-Chloroethyl-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30ClN3O2Purity:Min. 95%Molecular weight:367.91 g/molOrexin A (17-33) trifluoroacetate salt
CAS:<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>Formula:C79H125N23O22Purity:Min. 95%Molecular weight:1,748.98 g/molAbz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H114N26O18Purity:Min. 95%Molecular weight:1,595.81 g/molVIP (4-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP (4-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H221N39O36SPurity:Min. 95%Molecular weight:2,986.5 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H41N9O8Purity:Min. 95%Molecular weight:619.67 g/molZ-Gly-Gly-NH2
CAS:<p>Z-Gly-Gly-NH2 is a synthetic peptide that has been shown to inhibit the activity of phosphatases, which are enzymes that hydrolyze phosphate groups from phosphorylated substrates. It is a hydrophobic and metal chelator, which makes it suitable for use in chromaffin cells and dorsal root ganglia. Z-Gly-Gly-NH2 has been shown to be specific for inhibition of synaptic phosphatase (PP1). This compound also inhibits the enzyme inhibitor subtilisin, which is found in bacteria such as Streptomyces or Bacillus subtilis. Z-Gly-Gly-NH2 has been shown to have a high affinity for receptors.</p>Formula:C12H15N3O4Purity:Min. 95%Molecular weight:265.27 g/molProcathepsin B (26-50) (rat)
CAS:<p>Please enquire for more information about Procathepsin B (26-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H198N34O33SPurity:Min. 95%Molecular weight:2,713.16 g/molH-Cys(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Arg-Val-Arg-Arg-AMC acetate salt
CAS:Controlled Product<p>Boc-Arg-Val-Arg-Arg-AMC acetate salt is a protease inhibitor that belongs to the group of basic proteins. It inhibits the action of serine proteases, which are enzymes that break down proteins in cells. Boc-Arg-Val-Arg-Arg-AMC acetate salt has been shown to inhibit leishmania and tumor cell growth. It also inhibits cancer cell proliferation and metastasis. The inhibition of these cancer cell lines by Boc-Arg-Val-Arg-Arg-AMC acetate salt may be due to its ability to inhibit protein synthesis, which is vital for tumor cell growth. Boc Arg Val Arg Arg AMC acetate salt also induces apoptosis (cell death) in some cancer cells through the activation of caspase 3, a cysteine protease that plays an important role in apoptosis signaling pathways.</p>Formula:C38H62N14O8Purity:Min. 95%Molecular weight:842.99 g/molH-Ala-Gly-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Ala-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19N5O6Purity:Min. 95%Molecular weight:317.3 g/molZ-Leu-Arg-AMC HCl
CAS:<p>Please enquire for more information about Z-Leu-Arg-AMC HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H38N6O6Purity:Min. 95%Molecular weight:578.66 g/mol1-Methyl-1H-imidazole-5-carboxylic acid
CAS:<p>1-Methyl-1H-imidazole-5-carboxylic acid is an amide that is used as a hardener in medicines. It can be synthesized by the reaction of ethyl formate with thionyl chloride and imidazoles. The yield of this product is high, and it can be produced in different stereoisomeric forms. 1-Methyl-1H-imidazole-5-carboxylic acid is used to produce other medicines, such as painkillers, tranquilizers, diuretics, and antibiotics. This product has been shown to have a number of health benefits, including reducing cholesterol levels and blood pressure.</p>Formula:C5H6N2O2Purity:Min. 95%Molecular weight:126.11 g/molNesfatin-1 (30-59) (human) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H263N41O54Purity:Min. 95%Molecular weight:3,709.12 g/molZ-His-Phe-Phe-OEt
CAS:<p>Z-His-Phe-Phe-OEt is a synthetic, polyacrylamide gel-based experiment that determines the amino acid composition of imidazolium zymogens. This experiment utilizes an ion-exchange chromatography technique to separate and identify peptides. The solvents used in this experiment are acetone and ion-exchange chromatography. In order to carry out this experiment, one must first dissolve the polyacrylamide gel in a system of solvents with a pH of 7.5 or lower in order to create an electrofocusing environment. This solution is then applied to the polyacrylamide gel, which will form a solid film when dried. The imidazolium zymogen can then be cleaved by pepsin, yielding peptides that can be analysed using mass spectrometry.</p>Formula:C34H37N5O6Purity:Min. 95%Molecular weight:611.69 g/molN-Boc-glycine
CAS:<p>N-Boc-glycine is a chemical compound used in the synthesis of cyclic peptides. N-Boc-glycine is synthesized by the reaction of glycine with methanol and hydrochloric acid in the presence of an activated form of carbon monoxide. The pharmacokinetic properties of N-Boc-glycine are similar to those for human immunoglobulin, and it can be used as a reference compound for preparative high performance liquid chromatography (HPLC). It has been shown that the nitrogen atoms in N-Boc-glycine are chemically stable, which makes it suitable for asymmetric synthesis. N-Boc-glycine also has potent antagonist effects on biochemical properties such as calcium channel blockade, inhibition of platelet aggregation, and inhibition of neutrophil chemotaxis.</p>Formula:C7H13NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:175.18 g/molFA-Glu-Glu-OH
CAS:<p>Please enquire for more information about FA-Glu-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20N2O9Purity:Min. 95%Molecular weight:396.35 g/molFmoc-2-fluoro-L-phenylalanine
CAS:<p>Please enquire for more information about Fmoc-2-fluoro-L-phenylalanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H20FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:405.42 g/molH-Ile-Ser-OH trifluoroacetic acid
CAS:<p>H-Ile-Ser-OH trifluoroacetic acid is a bioactive compound that has been cocrystallized with N,N′-dimethylformamide and analyzed using liquid chromatography/mass spectrometry. It has been shown to be hydrophilic and soluble in water. H-Ile-Ser-OH trifluoroacetic acid has also been detected by mass spectrometric methods as well as electrospray mass spectrometry.</p>Formula:C9H18N2O4•TFAPurity:Min. 95%Molecular weight:218.25 g/molZ-Gly-Gly-Ala-OH
CAS:<p>Please enquire for more information about Z-Gly-Gly-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O6Purity:Min. 95%Molecular weight:337.33 g/molFmoc-Sar-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Sar-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt
CAS:<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>Formula:C52H77N17O14Purity:Min. 95%Molecular weight:1,164.27 g/molGRF (1-29) amide (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molH-His-Lys-OH·HBr
CAS:<p>Please enquire for more information about H-His-Lys-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21N5O3·HBrPurity:Min. 95%Molecular weight:364.24 g/molFmoc-octyl-D-Gly-OH
CAS:<p>Fmoc-octyl-D-Gly-OH is a supramolecular polymer with a wide range of applications, including oil recovery and as a nanomaterial. Fmoc-octyl-D-Gly-OH is synthesized by the ring opening polymerization of octylglycol with D,L lactic acid. It has been shown to be an effective emulsifier in water, which may be due to its synergistic effect with other molecules. Fmoc-octyl-D-Gly-OH also has the ability to self assemble into a variety of morphologies such as nanoribbons, nanowires, and gel networks. This polymer can also be used as a hydrogenation catalyst for organic synthesis reactions that require high pressures and temperatures. Fmoc-octyl-D-Gly-OH has also been used in the production of ultrasonication devices for use in medicine.</p>Formula:C25H31NO4Purity:Min. 95%Molecular weight:409.52 g/molFmoc-Arg(Pbf)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(H-Gly-Cys-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Gly-Cys-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N4O6S2Purity:Min. 95%Color and Shape:PowderMolecular weight:354.41 g/molKR-12 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H127N25O15Purity:Min. 95%Molecular weight:1,570.93 g/molH-Glu-Phe-Tyr-OH
CAS:<p>H-Glu-Phe-Tyr-OH is a peptide transporter that is located on the apical surface of intestinal cells. It is a monovalent cation/H+ symporter that transports H+ and peptides in an electroneutral manner. The uptake rate of this peptide transporter is influenced by the concentration gradient of the substrate, with higher concentrations increasing the uptake rate. It has been shown to transport lidocaine, which suggests it may be used to treat patients who are resistant to other drugs. H-Glu-Phe-Tyr-OH also has a high affinity for peptides, making it possible to use this drug as a means of delivering therapeutic proteins orally.</p>Formula:C23H27N3O7Purity:Min. 95%Molecular weight:457.48 g/molFmoc-D-Pen (Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Pen (Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%HCV Core Protein (19-25)
CAS:<p>Please enquire for more information about HCV Core Protein (19-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H59N9O11Purity:Min. 95%Molecular weight:829.94 g/molH-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Biotinyl-Somatostatin-14
CAS:<p>Please enquire for more information about Biotinyl-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H118N20O21S3Purity:Min. 95%Molecular weight:1,864.18 g/molH-Ala-Ala-Tyr-OH
CAS:<p>Please enquire for more information about H-Ala-Ala-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N3O5Purity:Min. 95%Molecular weight:323.34 g/molH-Glu-Gly-Phe-OH
CAS:<p>H-Glu-Gly-Phe-OH is a labile tripeptide molecule that has been synthesized. The tripeptide is synthesized by coupling the amino acid H-Glu to Gly-Phe and then adding an amide bond to form the peptide. This study of the structure of H-Glu-Gly-Phe-OH was done using techniques such as electrospray ionization, chromatographic methods, and proton nuclear magnetic resonance spectroscopy. The compound was found to be neutral in charge and stable at room temperature, but unstable under acidic conditions. It is also soluble in any buffer with a pH range from 2.0 to 12.0 and can be purified by column chromatography or preparative HPLC.</p>Formula:C16H21N3O6Purity:Min. 95%Molecular weight:351.35 g/molFmoc-Thr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-His-Gly-OH
CAS:<p>Please enquire for more information about Z-His-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molBoc-L-methionine - Solid
CAS:<p>Boc-L-methionine is a chemical compound that contains the amino acid methionine. It is used in solid-phase synthesis to produce cyclic peptides and proteins. Boc-L-methionine is activated by treatment with trifluoroacetic acid and then reacts with a protected amino acid to form the corresponding amide or ester, respectively. The activated carboxylic acid group of Boc-L-methionine reacts with an unprotected amino group of the amino acid to form an amide or ester linkage, respectively. The reaction products are cleaved from the resin support by hydrogen fluoride for purification.</p>Formula:C10H19NO4SPurity:Min. 95%Molecular weight:249.33 g/molH-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Gly-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O2·HClPurity:Min. 95%Molecular weight:257.72 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H228N38O51Purity:Min. 95%Molecular weight:3,259.53 g/molZ-Val-Gly-Gly-OBzl
CAS:<p>Please enquire for more information about Z-Val-Gly-Gly-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29N3O6Purity:Min. 95%Molecular weight:455.5 g/molFmoc-Asn(Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%HIV (gp41) Fragment
CAS:<p>HIV (gp41) Fragment H-Ala-Val-Gly-Ile-Gly-Ala-OH is a hydrophobic peptide fragment that is used as an antigen to induce immunity against HIV infection. The sequence of the peptide was obtained by sequencing the human immunodeficiency virus type 1 (HIV). The peptide contains glutamic acid and ornithine, which are necessary for the attachment of gp41 to the target cell surface and for the penetration of the virus into cells. The cyclic peptide induces mononuclear phagocytes to produce antibodies against gp41, which can inhibit infection by HIV.</p>Formula:C21H38N6O7Purity:Min. 95%Molecular weight:486.56 g/molExperimental Allergic Encephalitogenic Peptide (human)
CAS:<p>Experimental Allergic Encephalitogenic Peptide (human) H-Phe-Ser-Trp-Gly-Ala-Glu-Gly-Gln-Arg-OH is a protein that is used as an adjuvant to increase the immune response. It is composed of a string of amino acids that are recognized by the immune system, but do not elicit an immune response on their own. The peptide can be administered intracutaneously or in the form of a vaccine. This peptide has been shown to have a basic nature and has been found to have lethal effects when administered at high doses.</p>Formula:C46H64N14O14Purity:Min. 95%Molecular weight:1,037.09 g/molα-Phellandrene
CAS:<p>Alpha-Phellandrene is a type of monoterpene that has been shown to have antioxidant properties. Alpha-Phellandrene is also known to inhibit the herpes simplex virus. In addition, alpha-Phellandrene has been shown to be a lipid and fatty acid oxidation inhibitor. Alpha-Phellandrene has been studied as an analgesic and anticonvulsant drug in animal models for pain relief and epilepsy treatment. Alpha-Phellandrene has also been studied for its ability to inhibit the production of prostaglandins by human liver cells. This terpene can be found in many plants, including thyme, lemon balm, peppermint, lavender and basil. The main chemical structure of alpha-Phellandrene is a bicyclic monoterpene with two isoprenyl units linked to a cyclohexane ring. It belongs to the group of monoterpenes which are derived from geranylgeranyl py</p>Formula:C10H16Purity:Min. 75%Color and Shape:Clear LiquidMolecular weight:136.23 g/molAbz-Ser-Pro-3-nitro-Tyr-OH
CAS:<p>Abz-Ser-Pro-3-nitro-Tyr-OH is a chromophobe peptide that is expressed in renal cell carcinomas. It is a potent inhibitor of all three major classes of proteases: serine, cysteine and aspartyl proteases. Abz-Ser-Pro-3-nitro-Tyr-OH inhibits the activity of peptidases, which are enzymes involved in protein degradation and turnover. Abz has been shown to inhibit the activity of intrarenal proteolytic enzymes, including endopeptidase, metallopeptidase and aminopeptidase activities. Abz also has been shown to inhibit the expression of markers on the surface of kidney cells and to reduce renal cell proliferation.</p>Formula:C24H27N5O9Purity:Min. 95%Molecular weight:529.5 g/mol1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine
CAS:<p>1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine (DLPE) is a lipid molecule that can induce phase transition in aqueous solutions. DLPE is an active ingredient in nonsteroidal anti-inflammatory drugs and has been shown to inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase. DLPE also inhibits the growth of infectious organisms such as Escherichia coli and HIV by inhibiting receptor activity. DLPE binds to receptors on the surface of cells, which prevents these cells from releasing inflammatory cytokines.</p>Formula:C29H58NO8PPurity:Min. 95%Color and Shape:PowderMolecular weight:579.75 g/molAc-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2
CAS:<p>Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 is a synthetic peptide that was designed to mimic the sequence of muramyl dipeptide (MDP), which is found in bacterial cell walls. Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 binds to the protein albumin, which is an important component of human blood plasma and has been shown to be elevated in patients with autoimmune diseases. This peptide also inhibits the activity of metal hydroxides, such as aluminum hydroxide and calcium hydroxide, by binding to their surface, reducing their antimicrobial activity. The effect on locomotor activity has not been studied. Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 may have effects on various cells types including macrophages and T</p>Formula:C43H78N6O13Purity:Min. 95%Color and Shape:SolidMolecular weight:887.11 g/mol(Lys9,Trp11,Glu12)-Neurotensin (8-13) (Cyclic Analog)
CAS:<p>Please enquire for more information about (Lys9,Trp11,Glu12)-Neurotensin (8-13) (Cyclic Analog) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H59N11O8Purity:Min. 95%Molecular weight:809.96 g/molBoc-Tyr(tBu)-OH
CAS:<p>Boc-Tyr(tBu)-OH is a chemical compound that is part of the class of lactams. It has been shown to have antitumor activity in vitro and in vivo, but it has not yet been tested for its cytotoxicity. This compound is synthesized by solid-phase synthesis and contains a disulfide bond, which may contribute to its cytotoxicity. Boc-Tyr(tBu)-OH has also been shown to have high affinity for the alpha 2A adrenergic receptor subtype and other receptors with an isosteric carbonyl group.</p>Formula:C18H27NO5Purity:Min. 95%Color and Shape:PowderMolecular weight:337.41 g/mol(Lys8-psi(CH2NH)Lys9)-Neurotensin (8-13)
CAS:<p>Neurotensin (NT) is a neuropeptide that is derived from the prepro-NT gene. It binds to the neurotensin receptor 1 (NTSR1) and has been shown to regulate intestinal motility, as well as function as an adjuvant therapy for enteric diseases. Neurotensin has been shown to be neuroprotective against dopamine toxicity in cell cultures, and could be used in cancer therapy. The profile of neurotensin has been studied in clinical trials for metastatic breast cancer and other cancers. Neurotensin does not have any significant safety issues, although it can cause neuronal death when administered intracerebroventricularly.</p>Formula:C38H66N8O7Purity:Min. 95%Molecular weight:746.98 g/molH-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Leu-Arg-4MbNA
CAS:<p>Please enquire for more information about Z-Leu-Arg-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H40N6O5Purity:Min. 95%Molecular weight:576.69 g/molOsteoblast Activating Peptide (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37Purity:Min. 95%Molecular weight:2,763.07 g/mol(D-Trp6)-LHRH (1-6) amide
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (1-6) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H49N11O9Purity:Min. 95%Molecular weight:887.94 g/molZ-Val-Val-Nle-diazomethylketone
CAS:<p>Please enquire for more information about Z-Val-Val-Nle-diazomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H37N5O5Purity:Min. 95%Molecular weight:487.59 g/molL-threo-(+)-2-Amino-1-(4-nitrophenyl)-1,3-propanediol
CAS:<p>L-threo-(+)-2-amino-1-(4-nitrophenyl)-1,3-propanediol is a functional group that is composed of a fatty acid and an amino acid. It has been shown to inhibit the growth of corynebacterium glutamicum bacteria by hydrolyzing their cell wall. This compound also inhibits the activity of bacterial enzymes that are involved in the synthesis of proteins. This functional group may be useful for the treatment of chronic lymphocytic leukemia and HIV infection.</p>Formula:C9H12N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:212.2 g/molTau-fluvalinate
CAS:<p>Tau-fluvalinate is a pesticide that is used to control ectoparasites. It has been shown to be effective against fleas, ticks, and mites. Tau-fluvalinate binds to the active site of the enzyme protein kinase C (PKC). This binding prevents the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3), which is required for cell signaling pathways and protein synthesis. Tau-fluvalinate also inhibits detoxification enzymes such as glutathione S-transferase (GST) and cytochrome P450 reductase. Tau-fluvalinate has been shown to have no sublethal effects on insects in vitro or in vivo at doses below its LD50. Tau-fluvalinate can also be used as an analytical standard for detecting polycyclic aromatic hydrocarbons in water samples with chemical ionization gas chromatography.</p>Formula:C26H22ClF3N2O3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:502.91 g/molPrepro-Atrial Natriuretic Factor (104-123) (human)
CAS:<p>Prepro-Atrial Natriuretic Factor (104-123) (human) H-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu -Thr-Ala Pro Arg -OH is a natriuretic peptide hormone that belongs to the family of hormones called atrial natriuretic peptides. It is produced in the heart and has been shown to lower blood pressure by dilating blood vessels. Prepronatrial atrial natriuretic factor can also be used as a marker for colorectal adenocarcinoma, with high levels found in the serum of patients suffering from this disease.</p>Formula:C94H171N31O28Purity:Min. 95%Molecular weight:2,183.56 g/mol(2S)-β-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate
CAS:Controlled Product<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>Formula:C21H33N5O5Purity:Min. 95%Molecular weight:435.52 g/molH-Ala-Ala-Ala-Tyr-Ala-Ala-OH
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-Tyr-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H36N6O8Purity:Min. 95%Molecular weight:536.58 g/molZ-Tyr-Val-Ala-DL-Asp-fluoromethylketone
CAS:<p>Please enquire for more information about Z-Tyr-Val-Ala-DL-Asp-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37FN4O9Purity:Min. 95%Molecular weight:616.63 g/molFmoc-His-OMe
CAS:<p>Please enquire for more information about Fmoc-His-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H21N3O4Purity:Min. 95%Molecular weight:391.42 g/molH-D-Arg(Me)-OH acetate salt
CAS:Controlled Product<p>H-D-Arg(Me)-OH is a peptide that has been shown to inhibit the proliferation of cancer cells in culture. It inhibits the growth of tumor cells by blocking the activity of the oxytocin receptor, which regulates cell adhesion and migration. The H-D-Arg(Me)-OH acetate salt has also been shown to promote the differentiation of basophilic leukemia cells into normal myeloid cells. This peptide is used as a control for incubated cell cultures, such as liver cells, and can be used to study protein synthesis.</p>Formula:C7H16N4O2Purity:Min. 95%Molecular weight:188.23 g/molH-Gly-Leu-Tyr-OH
CAS:<p>H-Gly-Leu-Tyr-OH is a tripeptide that is found in some human and animal proteins. The peptide contains glycine, leucine, tyrosine, and hydroxyproline. It binds to copper ions with an inhibition constant of 1.5 x 10^5 M and has a pH optimum of 7.0. In the active form, it inhibits α subunit of bacterial aminopeptidase which is required for protein synthesis in bacteria. The peptide also has been shown to be a model system for the study of enzyme mechanisms and as a chromatographic method for analyzing proteins in food chemistry.</p>Formula:C17H25N3O5Purity:Min. 95%Molecular weight:351.4 g/molSuc-Phe-Ala-Ala-Phe-pNA
CAS:<p>Suc-Phe-Ala-Ala-Phe-pNA is a serine protease with natriuretic properties. It has been shown to have high salt and pH optima and to be reactive at physiological pH. Suc-Phe-Ala-Ala-Phe-pNA has been sequenced and found to have a carboxy terminal reactive site. There are eight cysteine residues in the amino acid sequence of this protease, four of which are in the reactive site. This protease also has vasoactive intestinal peptide (VIP) activity, which is involved in inflammatory diseases.</p>Formula:C34H38N6O9Purity:Min. 95%Molecular weight:674.7 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47Purity:Min. 95%Molecular weight:3,355.67 g/molAngiotensin I/II (3-7)
CAS:<p>Angiotensin I/II (3-7) H-Val-Tyr-Ile-His-Pro-OH is an antagonist of the angiotensin II receptor. It has been shown to be a cognitive enhancer by statistically improving treatments for behavioural problems in rats and mice. Angiotensin I/II (3-7) H-Val-Tyr-Ile-His-Pro-OH has also been shown to inhibit nicotinic acetylcholine receptors, which are involved in mediating the effects of neurotransmitters on muscle cells. This agent also inhibits angiotensin II receptors, leading to vasodilation and reduced blood pressure. The mechanism of action is not yet clear but may involve inhibition of protein kinase C. In preclinical studies, it has been shown that this drug facilitates behavioural effects such as memory retention and motor performance in rats when given before treatment with peptides such as substance P or calcitonin gene related pept</p>Formula:C31H45N7O7Purity:Min. 95%Molecular weight:627.73 g/molBoc-D-Tyr(tBu)-OH
CAS:<p>Boc-D-Tyr(tBu)-OH is a natural product that is an amphipathic molecule with a cyclic structure. It has been shown to be able to inhibit the growth of bacteria, such as Staphylococcus aureus and Escherichia coli, by acting as an antibiotic. Boc-D-Tyr(tBu)-OH inhibits the synthesis of peptides by binding to the ribosome and blocking peptide elongation. This molecule also inhibits peptide synthesis by interacting with the aminoacyl site on the ribosome and preventing it from binding with amino acids. Boc-D-Tyr(tBu)-OH is synthesized in two stages: solid phase peptide synthesis and nucleophilic activation. The decapeptides are then purified and characterized based on their function.</p>Formula:C18H27NO5Purity:Min. 95%Color and Shape:PowderMolecular weight:337.41 g/molMet-Enkephalin-Arg-Phe amide
CAS:<p>Met-Enkephalin-Arg-Phe amide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe is a subunit of the endogenous opioid peptide Met-enkephalin. It is a proteolytic cleavage product of proenkephalin A and is also known as Tyr2, Phe2, or Arg6. Met-enkephalin has been shown to participate in signal transduction pathways that regulate blood pressure and exocrine secretion. Metenkephalin is an amide containing two cysteine residues with a hydrophobic side chain, which can bind metal ions such as calcium ions. Metenkephalin binds to the membrane of cells, altering membrane potential and naloxone binding sites.<br>Met enkephalin has been shown to be involved in serotonin release from platelets and inhibition of serotonin uptake by platelets.</p>Formula:C42H57N11O8SPurity:Min. 95%Molecular weight:876.04 g/molEthyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate
CAS:<p>Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate is an anticancer agent that belongs to the class of formamidines. It is synthesized by refluxing ethyl 4-hydroxyphenylacetic acid with hexamethylenetetramine and acetic acid in ethanol. After purification, it is converted to its active form by reacting with hydrochloric acid. Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate prevents the growth of cancer cells in culture by preventing DNA synthesis, which prevents RNA and protein synthesis. This agent has also been found to suppress paclitaxel production in cultured human breast cancer cells.</p>Formula:C13H13NO3SPurity:Min. 95%Molecular weight:263.31 g/moltrans-4-Hydroxy-L-proline methyl ester hydrochloride
CAS:<p>Trans-4-hydroxy-L-proline methyl ester hydrochloride is a matrix metalloproteinase inhibitor. It inhibits the activity of matrix metalloproteinases, which are enzymes that break down collagen and other proteins in the extracellular matrix. The inhibition of these enzymes leads to a decrease in restenosis, which is the recurrence of artery narrowing after angioplasty or stent placement. Trans-4-hydroxy-L-proline methyl ester hydrochloride has been shown to be effective against chemokine receptors, including CCR5 receptor and chemokines such as TNFα. It also inhibits cytokine production by inhibiting signaling pathways that lead to inflammation and cell proliferation.</p>Formula:C6H11NO3·HClColor and Shape:White/Off-White SolidMolecular weight:181.62 g/molHel 13-5 trifluoroacetate salt
CAS:Controlled Product<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>Formula:C113H204N24O19Purity:Min. 95%Molecular weight:2,202.98 g/molH-Pro-Phe-OH
CAS:<p>H-Pro-Phe-OH is a synthetic peptide that is used in the treatment of high blood pressure. It has been shown to decrease blood pressure by increasing the production of nitric oxide and by decreasing activity of angiotensin converting enzyme, which are factors that have an influence on blood pressure. H-Pro-Phe-OH has been shown to be effective for treating HIV infection and amyloidosis. H-Pro-Phe-OH binds to collagen and increases its production in tissues, which may be responsible for its antihypertensive effects. It also inhibits the growth of bacteria by binding to their cell walls and inhibiting their protein synthesis. The metabolic products of H-Pro-Phe-OH are not yet known, but it is thought that they may contain hydroxyproline or hydroxylysine residues.</p>Formula:C14H18N2O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:262.3 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/mol(Gln53)-Connexin 37 (51-58) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Gln53)-Connexin 37 (51-58) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H59N11O15Purity:Min. 95%Molecular weight:933.96 g/molH-Leu-Arg-Arg-Arg-Arg-Phe-D-Ala-Phe-Cys(NPys)-NH2
CAS:<p>Please enquire for more information about H-Leu-Arg-Arg-Arg-Arg-Phe-D-Ala-Phe-Cys(NPys)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H92N24O11S2Purity:Min. 95%Molecular weight:1,377.65 g/molNeurotensin (8-13)
CAS:<p>Neurotensin is a peptide that regulates the activity of the hypothalamus and pituitary gland. Neurotensin is synthesized from prepro-neurotensin, which is cleaved to produce neurotensin (8-13) H-Arg-Arg-Pro-Tyr-Ile-Leu-OH. It is a member of the tachykinins family of neuropeptides, which are characterized by a conserved disulfide bond. Neurotensin has been shown to increase locomotor activity in mice and rats and may be involved in pain perception. Neurotensin also binds to receptors on nerve cells, including the enkephalin receptor, with high affinity. This binding leads to an inhibition of release of neurotransmitters such as dopamine, serotonin, and acetylcholine by neurons.</p>Formula:C38H64N12O8Purity:Min. 95%Molecular weight:816.99 g/molMastoparan 17 (free acid)
CAS:<p>Please enquire for more information about Mastoparan 17 (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H131N19O16Purity:Min. 95%Molecular weight:1,494.91 g/molNeuropeptide Y (free acid) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H284N54O58SPurity:Min. 95%Molecular weight:4,272.67 g/molSuc-Val-Pro-Phe-4MbNA
CAS:<p>Please enquire for more information about Suc-Val-Pro-Phe-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H40N4O7Purity:Min. 95%Molecular weight:616.7 g/molH-DL-Val-Leu-Arg-pNA acetate salt
CAS:<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>Formula:C23H38N8O5Purity:Min. 95%Molecular weight:506.6 g/molCyclo(-Pro-Thr)
CAS:<p>Cyclo(-Pro-Thr) is a cyclic peptide that is derived from the amino acid sequence of serotonin. Cyclo(-Pro-Thr) has been detected in human urine, and it is possible that this compound may be formed by the hydrolysis of serotonin by enzymes such as pipecolate oxidase. The presence of cyclo(-Pro-Thr) in human urine has been correlated with the occurrence of stomach ulcers, which are caused by substances such as famotidine and other proton pump inhibitors. Cyclo(-Pro-Thr) has also been found to inhibit the production of gamma-aminobutyric acid (GABA), which is an important neurotransmitter for controlling muscle tone, blood pressure, and anxiety.</p>Formula:C9H14N2O3Purity:Min. 95%Molecular weight:198.22 g/molNeuronostatin-19 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H153N29O26Purity:Min. 95%Molecular weight:2,069.37 g/molpTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H247N49O37Purity:Min. 95%Molecular weight:3,364.91 g/molMethyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate
CAS:<p>Methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate is a natural compound, which belongs to the group of ferulate esters. It has been shown that methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate inhibits the activity of esterases, which are enzymes that hydrolyze esters. This inhibition leads to an accumulation of ferulic acid in the blood, which is associated with bowel disease. Methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate has been shown to be effective against murine hepatoma cells and polymorphonuclear leucocytes, which are white blood cells that can be found in the blood and other tissues. The inhibitory effect on these cells may be due to its ability to bind to ferulic acid and caffeic acids.</p>Formula:C11H12O4Purity:Min. 95%Color and Shape:White PowderMolecular weight:208.21 g/molH-Pro-Asn-OH
CAS:<p>H-Pro-Asn-OH is a reactive functional group that is activated by the presence of acidic conditions. It can react with epoxides to form cyclic ethers. H-Pro-Asn-OH can be used in vitro studies to assess the activation of caspases, which are proteolytic enzymes that play a role in cell apoptosis. It has also been used for molecular imaging and as an antigen for immunotherapy in cancer treatment. This molecule has a reactive functional group on its side chain and reacts with epoxides to form cyclic ethers.</p>Formula:C9H15N3O4Purity:Min. 95%Molecular weight:229.23 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Formula:C148H239ClN44O42Purity:Min. 95%Molecular weight:3,342.21 g/molH-Phe-Ser-OH
CAS:<p>H-Phe-Ser-OH is a molecule that is present in the bacterial strain. It can be used in diagnosis, where it can be detected by messenger RNA profiling and kinetic analysis of uptake. In vitro synthesis of H-Phe-Ser-OH was performed using caco-2 cells and metabolic profiles were obtained from this experiment. Hydroxyl groups are found on the molecule, which are important for diagnostic purposes. This molecule has been shown to form hydrogen bonds with other molecules, which may also be useful for diagnostic tests.</p>Formula:C12H16N2O4Purity:Min. 95%Molecular weight:252.27 g/molDynorphin B (1-9)
CAS:<p>Please enquire for more information about Dynorphin B (1-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H78N16O12Purity:Min. 95%Molecular weight:1,143.3 g/molH-Lys-Tyr-OH acetate salt
CAS:<p>H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/mol(H-Cys-Ala-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-Ala-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N4O6S2Purity:Min. 95%Molecular weight:382.46 g/molFmoc-Thr(tBu)-Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Thr(tBu)-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H30N2O6Purity:Min. 95%Molecular weight:454.52 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H73N13O26Purity:Min. 95%Molecular weight:1,344.25 g/molZ-Gly-Val-OH
CAS:<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formula:C15H20N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:308.33 g/molType A Allatostatin II
CAS:<p>Allatostatin II is a fatty acid that has been shown to have receptor activity. It is an analog of the glycopeptide antibiotic gramicidin S and has been shown to inhibit the growth of bacteria and fungi. Allatostatin II also has diagnostic properties, which are used in biochemical tests for inflammatory diseases. The molecule is conjugated with various agents to form diagnostic agents or antibiotics, such as stenotrophomonas maltophilia and erythromycin. Allatostatin II is found in the human plasma, but its function is unknown.</p>Formula:C49H74N14O13Purity:Min. 95%Molecular weight:1,067.2 g/molH-Pro-His-Pro-Phe-His-Phe-Phe-Val-Tyr-Lys-OH
CAS:<p>H-Pro-His-Pro-Phe-His-Phe-Phe-Val-Tyr-Lys-OH is a monoclonal antibody that has been shown to inhibit the activity of enalaprilat, which is an enzyme inhibitor. H-Pro-His-Pro-Phe-His-Phe-Phe-Val--Tyr--Lys--OH binds to the active site of the enzyme and inhibits its activity. This drug has been shown to be effective against a number of infectious diseases, including HIV. It has also been shown to have diagnostic utility for renal function and congestive heart failure. H--Pro--His--Pro--Phe--His--Phe--Phe--Val----Tyr----Lys----OH has also been shown to inhibit protease activity in vitro. The biocompatible polymer coating used in this drug prevents degradation by enzymes in the body and enhances its stability in vivo.</p>Formula:C69H87N15O12Purity:Min. 95%Molecular weight:1,318.52 g/molFarnesyl-Met-OMe
CAS:<p>Please enquire for more information about Farnesyl-Met-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H37NO2SPurity:Min. 95%Molecular weight:367.59 g/molH-Tyr-Gln-OH
CAS:<p>H-Tyr-Gln-OH is a model system for the study of polymerase chain reactions. It is a basic protein that has been shown to have antimicrobial peptide activity, and it can be used as a light signal in colony-stimulating factor experiments. H-Tyr-Gln-OH also has been shown to affect fertility in mice and to alter the frequency shift of light. The plant physiology studies on H-Tyr-Gln-OH have revealed that this molecule can stimulate epidermal growth factor production in plants, which may be due to its ability to bind lipid kinases. H-Tyr-Gln-OH can also be used as an antigen for antibody production or as a hybridization probe for DNA detection.</p>Formula:C14H19N3O5Purity:Min. 95%Molecular weight:309.32 g/molBexagliflozin
CAS:<p>Bexagliflozin is a drug that is used to treat type II diabetes in adults. It helps to control blood sugar levels by inhibiting the enzyme DPP-IV and increasing insulin release from the pancreas. Bexagliflozin has been shown to be effective in lowering blood sugar levels in patients with chronic kidney disease and cancer, as well as those with a body mass index (BMI) of 30 or higher. This drug is an oral hypoglycaemic agent that can be used for diagnostic purposes. It has also been shown to be clinically effective for the treatment of diabetic nephropathy and diabetic retinopathy. The enantiomers of bexagliflozin can be differentiated according to their pharmacological properties, which may allow for more targeted therapy.</p>Formula:C24H29ClO7Purity:Min. 95%Molecular weight:464.94 g/molAbz-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-3-nitro-Tyr-Thr-NH2
CAS:<p>Please enquire for more information about Abz-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-3-nitro-Tyr-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H84N14O22S2Purity:Min. 95%Molecular weight:1,393.5 g/molH-Thr(Ac)-OH·HCl
CAS:<p>Please enquire for more information about H-Thr(Ac)-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H11NO4·HClPurity:Min. 95%Molecular weight:197.62 g/molCyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Phe-Phe-Asn-Tyr-Tyr-Trp-OH
CAS:<p>Please enquire for more information about Cyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Phe-Phe-Asn-Tyr-Tyr-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H115N23O23Purity:Min. 95%Molecular weight:2,043.16 g/molDL-Alanine ethyl ester hydrochloride
CAS:<p>DL-Alanine ethyl ester hydrochloride is a byproduct of the reaction between ethylene and amines. It can be produced through the addition of l-phenylalanine to acetonitrile. This compound is an organic ester that has been shown to have a variety of reactions with metal ions, such as aluminium, l-glutamic acid, and primary amines. The product can be used in thermodynamic data for reaction systems involving DL-alanine ethyl ester hydrochloride.</p>Formula:C5H11NO2·HClPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:153.61 g/molSuc-Leu-Leu-Val-Tyr-AMC
CAS:<p>Suc-Leu-Leu-Val-Tyr-AMC is a cyclin D2 inhibitor that binds to the proteasome and inhibits its function. It has been shown to be useful for the treatment of cancerous tissues as it inhibits the production of prostaglandin J2, which is involved in the progression of cancer cells. Suc-Leu-Leu-Val-Tyr-AMC has also been shown to have antioxidant properties and can inhibit oxidative injury. This drug may be used to prevent or treat various diseases such as Parkinson's disease, Alzheimer's disease, Huntington's disease, diabetes mellitus type II, amyotrophic lateral sclerosis (ALS), multiple sclerosis (MS), and septic shock.</p>Formula:C40H53N5O10Purity:Min. 95%Color and Shape:PowderMolecular weight:763.88 g/molH-Tyr-Ala-OH
CAS:<p>Tyr-Ala-OH is a peptide hormone that inhibits the enzyme tyrosinase, which is needed for melanin synthesis. Tyr-Ala-OH has been shown to be effective in the treatment of autoimmune diseases and inflammatory diseases. This drug also has strong antioxidant properties and can inhibit proton release from cells. The mechanism of action appears to be through competitive inhibition of the enzyme dipeptidyl peptidase 4 (DPP4), which breaks down glucagon-like peptide (GLP) 1 and GLP 2, both of which have anti-inflammatory effects.</p>Formula:C12H16N2O4Purity:Min. 95%Molecular weight:252.27 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS:<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>Formula:C61H87N17O14Purity:Min. 95%Molecular weight:1,282.45 g/molFA-Phe-Ala-OH
CAS:<p>F-Phe-Ala-OH is a peptidyl amide that is ionizable at physiological pH. It has a constant and kinetic residue, as well as a hydrophobic, uncharged, and carboxypeptidase activity. F-Phe-Ala-OH catalyzes transpeptidation reactions between the amino acid residues of proteins. This reaction involves the elimination of one water molecule from the peptide bond to form an amine and an imine, which are then hydrolyzed to form the new peptide bond. The optimum pH for this catalysis is acidic.</p>Formula:C19H20N2O5Purity:Min. 95%Molecular weight:356.37 g/molD-(-)-2-Chlorophenylglycine methyl ester hydrochloride
CAS:<p>Please enquire for more information about D-(-)-2-Chlorophenylglycine methyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H10ClNO2•HClPurity:Min. 95%Molecular weight:236.1 g/molFmoc-Arg(Pmc)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pmc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Methylsalicylic acid
CAS:<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>Formula:C8H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:152.15 g/molZ-Leu-Gly-OH
CAS:<p>Z-Leu-Gly-OH is a peptide inhibitor of serine proteases. This peptide is a potential inhibitor of trypanosome proteinases, which are enzymes that cleave proteins into smaller pieces. Z-Leu-Gly-OH is a reversible inhibitor of mammalian proteinase and nitrile protease with a high affinity for the target enzyme.</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molH-Val-Pro-Pro-OH
CAS:<p>H-Val-Pro-Pro-OH is a peptide that has been shown to have inhibitory properties on bacterial strains such as E. coli and Staphylococcus aureus. H-Val-Pro-Pro-OH is an ester hydrochloride derivative of the amino acid Valine, which has been shown to have antihypertensive effects in mice. H-Val-Pro-Pro-OH can be used for the treatment of hypertension and other cardiovascular diseases by modifying the activity of ion channels. H-Val-Pro-Pro--OH is a peptide that inhibits the production of nitric oxide (NO) and reactive oxygen species (ROS) in endothelial cells, which are involved in physiological functions such as blood pressure control and vasodilation. The mechanism by which H--Val--Pro--Pro--OH produces these effects may involve inhibition of NO synthase (NOS) and inhibition of ROS production from NADPH oxidase 2 (N</p>Formula:C15H25N3O4Purity:Min. 95%Molecular weight:311.38 g/molAc-Phe-Gly-pNA
CAS:<p>Ac-Phe-Gly-pNA is a peptidyl prodrug that has been shown to have proteolytic activity against cells of the malignant phenotype. Ac-Phe-Gly-pNA is converted to an active form by serine proteases, which are found on the surface of trophozoites and in cancerous cells. The sequence of Ac-Phe-Gly-pNA is homologous with a protein found in Giardia lamblia, and it has been shown to be active against this parasite. Ac-Phe-Gly-pNA can also be detected with fluorogenic substrates and aminopeptidase activity.</p>Formula:C19H20N4O5Purity:Min. 95%Molecular weight:384.39 g/mol(Tyr0)-Apelin-13 (human, bovine, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr0)-Apelin-13 (human, bovine, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H120N24O18SPurity:Min. 95%Molecular weight:1,714 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Molecular weight:555.63Z-Phe-Ala-diazomethylketone
CAS:<p>Z-Phe-Ala-diazomethylketone is a molecule that belongs to the class of hydrolase inhibitors. It has been shown to have inhibitory properties against trichomonas vaginalis and proteolytic activity against liver cells. Z-Phe-Ala-diazomethylketone also has a kinetic energy of 11.2 kcal/mol, which is higher than most protease inhibitors. This molecule has been shown to be effective as a cell vaccine in wild-type mice and as a protease inhibitor in brain cells. The optimal ph for this molecule is 7.5, which corresponds to its pKa value of 5.1.</p>Formula:C21H22N4O4Purity:Min. 95%Molecular weight:394.42 g/molL-Glutamic acid 5-benzyl ester
CAS:<p>L-Glutamic acid 5-benzyl ester is an amino acid that has been synthesized to have a lysine residue. It is an ester hydrochloride and has been shown to have broad-spectrum antimicrobial properties. L-glutamic acid 5-benzyl ester's antimicrobial activity is thought to be due to its chemical structure which allows it to act as an antimicrobial peptide, binding to receptors on the surface of bacterial cells and inhibiting their growth. L-glutamic acid 5-benzyl ester also inhibits osteogenic genes in cervical cancer cells, but not in normal cells.</p>Formula:C12H15NO4Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:237.25 g/mol(Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat)
CAS:<p>Please enquire for more information about (Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H166N28O30S3Purity:Min. 95%Molecular weight:2,360.78 g/molPeptide WE-14
CAS:<p>Peptide WE-14 H-Trp-Ser-Lys-Met-Asp-Gln-Leu-Ala-Lys-Glu-Leu-Thr-Ala-Glu is a tetradecapeptide that is a candidate for the diagnosis of pancreatic cancer. It has been shown to localize to the pancreas and other tissues in immunohistochemical studies. This peptide was found to be present in chromaffin cells and ileal tissue, which are associated with pancreatic cancer. Peptide WE14 H Trp Ser Lys Met Asp Gln Leu Ala Lys Glu Leu Thr Ala Glu also binds to markers expressed at high levels in pancreatic cancers such as insulinoma, endocrine tumor, and neuroendocrine tumor.</p>Formula:C72H116N18O24SPurity:Min. 95%Molecular weight:1,649.86 g/molZ-Ala-Ala-NH2
CAS:<p>Z-Ala-Ala-NH2 is a peptide that has been modified. Z-Ala-Ala-NH2 is a hydrolase and has the ability to hydrolyze peptides. It can be used in organic solvents as an unmodified hydrolase, or it can be modified with a nucleophile (such as an amine) to produce an active hydrolase. The unmodified form of Z-Ala-Ala-NH2 has been shown to have high yields and specificity for peptidyl substrates. This modification is also useful for the synthesis of amide bonds in peptides, which are more stable than ester bonds.</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/molMethylenedi-p-phenyl diisocyanate
CAS:<p>Methylenedi-p-phenyl diisocyanate (MDI) is a glycol ether, which is a potent inducer of allergic reactions. It can be found in polyurethane foam insulation and in the production of diphenyl and diisocyanate. MDI has been shown to cause asthma, skin inflammation, and other respiratory problems. MDI is highly toxic to aquatic life and can cause long term effects on fish populations. The toxicity of MDI depends on the concentration and duration of exposure, as well as the species that it is administered to. High concentration exposure for a short period of time will result in death by respiratory failure or cardiac arrest. Longer exposure at lower concentrations may lead to liver, kidney, lung damage or cancerous tumor development.</p>Formula:C15H10N2O2Purity:Min. 95%Molecular weight:250.25 g/molBoc-Ala-Gly-Gly-OH
CAS:<p>Boc-Ala-Gly-Gly-OH is a reactive compound that can be used to synthesize antibiotics. It can be used for the production of diazide, which is an antibiotic that inhibits bacterial growth by binding to DNA and preventing its replication. Boc-Ala-Gly-Gly-OH also has been used for the preparation of urethanes, which are used as coatings for medical devices or catheters. This compound is chiral and has been shown to have stereogenic properties in catalytic asymmetric epoxidation reactions.</p>Formula:C12H21N3O6Purity:Min. 95%Molecular weight:303.31 g/molZ-Ala-Ala-Asn-AMC
CAS:<p>Z-Ala-Ala-Asn-AMC is a molecule that is an analog of the amino acid alanine. It has been shown to be effective in inhibiting cancer cell viability and inducing apoptosis in MDA-MB-231 breast cancer cells, which can inhibit tumor growth. This molecule also inhibits protease activity, protein synthesis, and tubule cell proliferation. Z-Ala-Ala-Asn-AMC has applicability in the treatment of cancers and inflammatory diseases.</p>Formula:C28H31N5O8Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:565.57 g/molTos-Gly-Pro-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N7O7S·HClPurity:Min. 95%Molecular weight:676.18 g/molCathelicidin LL 37
CAS:<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>Formula:C205H340N60O53Purity:Min. 95%Molecular weight:4,493.27 g/molH-Arg(NO2)-pNA·HBr
CAS:<p>Please enquire for more information about H-Arg(NO2)-pNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H17N7O5·HBrPurity:Min. 95%Molecular weight:420.22 g/molHirudin (55-65) (sulfated)
CAS:<p>Please enquire for more information about Hirudin (55-65) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H90N12O27SPurity:Min. 95%Molecular weight:1,491.53 g/molSuc-Ala-Trp-Pro-Phe-pNA
CAS:<p>Suc-Ala-Trp-Pro-Phe-pNA is a cyclosporine analog that inhibits the activity of protein isomerases. It has been shown to inhibit the phosphatase activity of casein and stabilize peptide bonds in bovine serum albumin. Suc-Ala-Trp-Pro-Phe-pNA can also be used as a substrate for tyrosine kinase and amide bond formation. Suc-Ala-Trp-Pro-Phe-pNA is an inhibitor of FK506 binding to its receptor, which may be due to its ability to compete with tyrosine residues for binding sites. This compound also exhibits stabilization effects on protein structures by inhibiting the degradation of proteins by proteolytic enzymes or other chemical agents.</p>Formula:C38H41N7O9Purity:Min. 95%Molecular weight:739.77 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/molH-D-Lys-NH2·2 HCl
CAS:<p>Please enquire for more information about H-D-Lys-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H15N3O·2HClPurity:Min. 95%Molecular weight:218.12 g/molH-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Urechistachykinin I
CAS:<p>Urechistachykinin I is a diagnostic agent that has been used to detect the presence of bacteria in human serum. It is a peptide analog that is derived from the amino acid sequence of urechistachykinin and has been shown to have receptor activity for inflammatory diseases. The urechistachykinin I molecule can be conjugated with an antibody or other reactive molecule, which allows for its detection in biological fluids. <br>Urechistachykinin I has been shown to inhibit the growth of stenotrophomonas maltophilia, and can be used as a diagnostic agent for this bacterial infection.</p>Formula:C50H85N19O14Purity:Min. 95%Molecular weight:1,176.33 g/molAc-Leu-Glu-His-Asp-AMC trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>Formula:C33H41N7O11Purity:Min. 95%Molecular weight:711.72 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H65N7O15Purity:Min. 95%Molecular weight:908 g/mol(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H295N55O51S2Purity:Min. 95%Molecular weight:4,217.84 g/molH-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl
CAS:<p>H-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl is a monoclinic crystalline compound. It has a molecular weight of 607.14 and contains the dipeptide Tyr-Lys in its structure. H-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl crystallizes in the P21/c space group and has an asymmetric unit cell with dimensions a=8.851 Å, b=7.965 Å and c=5.98 Å. This compound has been shown to have antibacterial properties against methicillin resistant Staphylococcus aureus (MRSA) isolates and Clostridium perfringens strains by inhibiting bacterial protein synthesis through inhibition of peptidyl transferase activity.</p>Formula:C19H21N3O3·HClPurity:Min. 95%Molecular weight:375.85 g/mol(Tyr38,Phe42·46)-Osteocalcin (38-49) (human)
CAS:<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H101N19O17Purity:Min. 95%Molecular weight:1,516.7 g/molZ-Gly-Ile-OH
CAS:<p>Please enquire for more information about Z-Gly-Ile-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molH-2,6-Difluoro-Phe-OH·HCl
CAS:<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H9F2NO2·HClPurity:Min. 95%Molecular weight:237.63 g/molAc-Thr-Leu-Asn-Phe-OH
CAS:<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>Formula:C25H37N5O8Purity:Min. 95%Molecular weight:535.59 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H229N45O37Purity:Min. 95%Molecular weight:3,050.52 g/molH-Lys-Thr-OH hydrochloride salt
CAS:<p>H-Lys-Thr-OH hydrochloride salt is a synthetic amino acid that has been used in the synthesis of a cyclic peptide. The synthesis was achieved by metathesis reactions, which involved the reaction of an acid chloride with a chiral amine to form an ester. H-Lys-Thr-OH hydrochloride salt has been shown to have high binding constants to its targets and can be used as a selective reagent for the synthesis of virus proteins. It is also able to bind to carboxylate groups, which are common in wild type viruses and gene products. This reagent also has cleavage products, which can be used for efficient method for synthesizing cyclic peptides.</p>Formula:C10H21N3O4Purity:Min. 95%Molecular weight:247.29 g/molGalanin (1-16) (mouse, porcine, rat)
CAS:<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H116N20O21Purity:Min. 95%Molecular weight:1,669.88 g/molConantokin G (free acid)
CAS:<p>Please enquire for more information about Conantokin G (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H137N25O45Purity:Min. 95%Molecular weight:2,265.17 g/mol(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt
CAS:<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>Formula:C109H163N25O32SPurity:Min. 95%Molecular weight:2,367.68 g/mol(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H69N9O11SPurity:Min. 95%Molecular weight:920.13 g/mol(Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H107N25O19S2Purity:Min. 95%Molecular weight:1,594.82 g/mol(Nle 8·18,Tyr34)-pTH (3-34) amide (bovine)
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (3-34) amide (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H279N53O48Purity:Min. 95%Molecular weight:3,917.44 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/molFmoc-N-methylglycine
CAS:<p>Fmoc-N-methylglycine is a modified form of the amino acid glycine, which has been modified to include a reactive group that can be used to link other molecules. This molecule has gram-negative bacterial activity and exhibits potent antibacterial activity against many gram-positive bacteria. Fmoc-N-methylglycine is also an antimicrobial peptide with binding constants in the nanomolar range. It is also an agent that binds to serotonin, which may explain its effects on mood and sleep. Fmoc-N-methylglycine can be synthesized using stepwise solid phase synthesis methods or by conjugation with other molecules.</p>Formula:C18H17NO4Purity:Min. 95%Molecular weight:311.33 g/molBoc-Asp(OBzl)-chloromethylketone
CAS:<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>Formula:C17H22ClNO5Purity:Min. 95%Molecular weight:355.81 g/molH-His-Ser-OH
CAS:<p>H-His-Ser-OH is a type of histidine with a hydroxyl group at the 3' position. It is an amino acid found in proteins and natural products. H-His-Ser-OH has been shown to be a synthetic substrate for the production of monoclonal antibodies, which are used as therapeutic agents in cancer treatment. The metabolic disorders that affect H-His-Ser-OH include human serum albumin and hemoglobinuria. This amino acid also plays a role in cervical cancer, neutral pH, and amide bonds. H-His-Ser-OH is also known to be a growth factor and has been linked to autoimmune diseases, site specific phosphorylation, and peptide hormones.br>br>br></p>Formula:C9H14N4O4Purity:Min. 95%Molecular weight:242.23 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molH-Asp-Phe-NH2
CAS:<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>Formula:C13H17N3O4Purity:Min. 95%Molecular weight:279.29 g/molH-Ile-Glu-OH
CAS:<p>Please enquire for more information about H-Ile-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:260.29 g/molN-Benzoyl-L-leucine-β-naphthylamide
CAS:<p>N-Benzoyl-L-leucine-beta-naphthylamide is a chromogenic substrate for transpeptidase. It is hydrolyzed to L-phenylalanine and 2-naphthylamine, which react with the chromogen to produce a color change. The reaction occurs in both spermatozoa and epithelial cells, but can be inhibited by aminopeptidase and peptidase. This substrate is used as a marker for spermatozoa in semen analysis.</p>Formula:C23H24N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:360.45 g/molAmyloid Bri Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H273N49O52S2Purity:Min. 95%Molecular weight:3,935.45 g/molBoc-Pro-Pro-Pro-Pro-OH
CAS:<p>Boc-Pro-Pro-Pro-Pro-OH is a synthetic peptide. It has been shown to have high specificity and is useful in the diagnosis of diseases that are caused by abnormal extracellular glutamic acid, hydroxyproline, or ion-exchange. Boc-Pro-Pro-Pro-Pro-OH has been used as a model for other peptides and has been shown to have acidic properties. The structure is dodecyl peptidic with a residue of -N(CH2)3-.</p>Formula:C25H38N4O7Purity:Min. 95%Molecular weight:506.59 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Formula:C23H38N6O5·2HClPurity:Min. 95%Molecular weight:551.51 g/molNα-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide
CAS:<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>Formula:C12H15FN4O5Purity:Min. 95%Color and Shape:Off-White To Yellow SolidMolecular weight:314.27 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molFmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Trp-Lys-OH formiate salt
CAS:<p>H-Trp-Lys-OH formiate salt is a tryptophan derivative that is stable in air and has been shown to have anti-inflammatory properties. It inhibits the synthesis of proinflammatory cytokines as well as cyclooxygenase, lipoxygenase, and nitric oxide synthase enzymes. This compound also inhibits the production of inflammatory mediators, such as leukotrienes, prostaglandins, and thromboxanes. H-Trp-Lys-OH formiate salt has been shown to be effective in lung diseases such as asthma and chronic obstructive pulmonary disease (COPD). It has also been shown to have an effect on autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus (SLE). H-Trp-Lys-OH formiate salt can be used for the treatment of infectious diseases such as HIV and malaria due to its ability to inhibit viral replication.</p>Formula:C17H24N4O3Purity:Min. 95%Molecular weight:332.4 g/molZ-Gly-His-OH
CAS:<p>Please enquire for more information about Z-Gly-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molGuanylin (human)
CAS:<p>Please enquire for more information about Guanylin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H87N15O21S4Purity:Min. 95%Molecular weight:1,458.66 g/mol
