
Amino Acid Derivatives
Amino acid derivatives are compounds that are structurally related to amino acids but have been chemically modified to introduce new functional groups or alter their properties. These derivatives are widely used in peptide synthesis, drug development, and biochemical research. At CymitQuimica, we offer a broad range of high-quality amino acid derivatives to support your research and industrial applications, ensuring precise and effective results in your experiments and synthesis projects.
Found 3955 products of "Amino Acid Derivatives"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
D-Proline Methyl Ester Hydrochloride
CAS:Formula:C6H11NO2·HClPurity:>96.0%(T)(N)Color and Shape:White to Almost white powder to crystalMolecular weight:165.623-Amino-3-phenylpropionic Acid
CAS:Formula:C9H11NO2Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:165.19D-2-Aminoadipic Acid
CAS:Formula:C6H11NO4Purity:>95.0%(GC)(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:161.16N-Carbobenzoxy-L-methionine
CAS:Formula:C13H17NO4SPurity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:283.341-Methyl L-Glutamate
CAS:Formula:C6H11NO4Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:161.16N-(tert-Butoxycarbonyl)-S-benzyl-L-cysteine
CAS:Formula:C15H21NO4SPurity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalineMolecular weight:311.40N-Chloroacetyl-DL-norleucine
CAS:Formula:C8H14ClNO3Purity:>99.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:207.655-Aminoisophthalic Acid
CAS:Formula:C8H7NO4Purity:>98.0%(T)Color and Shape:White to Orange to Green powder to crystalMolecular weight:181.15N-Acetyl-3,5-diiodo-L-tyrosine
CAS:Formula:C11H11I2NO4Purity:>95.0%(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:475.02DL-2,3-Diaminopropionic Acid Hydrobromide
CAS:Formula:C3H8N2O2·HBrPurity:>98.0%(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:185.02N-(2-Pyridylmethyl)glycine Ethyl Ester
CAS:Formula:C10H14N2O2Purity:>95.0%(GC)Color and Shape:Colorless to Yellow to Green clear liquidMolecular weight:194.23L-Proline tert-Butyl Ester Hydrochloride
CAS:Formula:C9H17NO2·HClPurity:>98.0%(T)(N)Color and Shape:White to Almost white powder to crystalMolecular weight:207.70N-(tert-Butoxycarbonyl)iminodiacetic Acid
CAS:Formula:C9H15NO6Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:233.22N-Benzyloxycarbonyl-L-serine Benzyl Ester
CAS:Formula:C18H19NO5Purity:>97.0%(HPLC)(N)Color and Shape:White to Almost white powder to crystalMolecular weight:329.35DL-Homocystine
CAS:Formula:C8H16N2O4S2Purity:>98.0%(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:268.35N6-[(Allyloxy)carbonyl]-N2-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-lysine
CAS:Formula:C25H28N2O6Purity:>96.0%(T)(HPLC)Color and Shape:White to Light yellow powder to crystalMolecular weight:452.51N-(tert-Butoxycarbonyl)-4-fluoro-D-phenylalanine
CAS:Formula:C14H18FNO4Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:283.30N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-D-valine
CAS:Formula:C20H21NO4Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:339.395-Benzyl L-Glutamate
CAS:Formula:C12H15NO4Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:237.264-Borono-L-phenylalanine (contains varying amounts of Anhydride)
CAS:Formula:C9H12BNO4Purity:>98.0%(T)(HPLC)Color and Shape:White to Light yellow powder to crystalMolecular weight:209.013-(4-Pyridyl)-L-alanine Dihydrochloride
CAS:Formula:C8H10N2O2·2HClPurity:>96.0%(HPLC)(N)Color and Shape:White to Orange to Green powder to crystalMolecular weight:239.10N-(tert-Butoxycarbonyl)-3-(1-naphthyl)-D-alanine
CAS:Formula:C18H21NO4Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:315.37N-Benzyloxycarbonyl-L-threonine
CAS:Formula:C12H15NO5Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:253.25N-Acetyl-DL-alanine
CAS:Formula:C5H9NO3Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:131.13DL-Aspartic Acid
CAS:Formula:C4H7NO4Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:133.10N-Carbobenzoxy-D-methionine
CAS:Formula:C13H17NO4SPurity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:283.34Glycine Methyl Ester Hydrochloride
CAS:Formula:C3H7NO2·HClPurity:>97.0%(HPLC)(N)Color and Shape:White to Almost white powder to crystalMolecular weight:125.55(R)-(-)-2,3-Diaminopropionic Acid Hydrochloride
CAS:Formula:C3H8N2O2·HClPurity:>98.0%(N)Color and Shape:White to Almost white powder to crystalMolecular weight:140.57Pentafluoro-L-phenylalanine
CAS:Formula:C9H6F5NO2Purity:>95.0%(T)(HPLC)Color and Shape:White to Light yellow powder to crystalMolecular weight:255.142-Ethylbutyl L-Alaninate Hydrochloride
CAS:Formula:C9H19NO2·HClPurity:>98.0%(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:209.71Glycine
CAS:Formula:C2H5NO2Purity:>99.0%(T)Color and Shape:White powder to crystalMolecular weight:75.07N-(tert-Butoxycarbonyl)glycylglycine
CAS:Formula:C9H16N2O5Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:232.24N-tert-Butoxycarbonyl-1-aminocyclobutanecarboxylic Acid
CAS:Formula:C10H17NO4Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:215.25DL-Homoserine
CAS:Formula:C4H9NO3Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:119.12N-Benzyloxycarbonyl-L-serine Methyl Ester
CAS:Formula:C12H15NO5Purity:>98.0%(N)Color and Shape:White to Almost white powder to crystalMolecular weight:253.25L-Proline Benzyl Ester Hydrochloride
CAS:Formula:C12H15NO2·HClPurity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:241.72H-Arg-OMe·2HCl [for Protein Research]
CAS:Formula:C7H16N4O2·2HClPurity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:261.15Nα,Nε-Bis[(9H-fluoren-9-ylmethoxy)carbonyl]-L-lysine
CAS:Formula:C36H34N2O6Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:590.68N-Formyl-L-methionine
CAS:Formula:C6H11NO3SPurity:>95.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:177.22DL-Serine Methyl Ester Hydrochloride
CAS:Formula:C4H9NO3·HClPurity:>98.0%(T)(N)Color and Shape:White to Almost white powder to crystalMolecular weight:155.58Nε-(tert-Butoxycarbonyl)-Nα-carbobenzoxy-L-lysine
CAS:Formula:C19H28N2O6Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:380.44N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-S-(tert-butyl)-L-cysteine
CAS:Formula:C22H25NO4SPurity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:399.515-Allyl N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-glutamate
CAS:Formula:C23H23NO6Purity:>96.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalineMolecular weight:409.44L-Cysteine
CAS:Formula:C3H7NO2SPurity:>98.0%(T)Color and Shape:White powder to crystalineMolecular weight:121.152,6-Diaminopimelic Acid
CAS:Formula:C7H14N2O4Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:190.204-Amino-3-hydroxybutyric Acid
CAS:Formula:C4H9NO3Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:119.12D-Valine Methyl Ester Hydrochloride
CAS:Formula:C6H13NO2·HClPurity:>98.0%(N)Color and Shape:White powder to crystalMolecular weight:167.63Methyl Pipecolinate Hydrochloride
CAS:Formula:C7H13NO2·HClPurity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:179.645-Benzyl N-(tert-Butoxycarbonyl)-L-glutamate
CAS:Formula:C17H23NO6Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:337.37N-Chloroacetyl-DL-valine
CAS:Formula:C7H12ClNO3Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:193.63N-Benzyloxycarbonyl-DL-alanine
CAS:Formula:C11H13NO4Purity:>99.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:223.23Nα-(tert-Butoxycarbonyl)-L-arginine 4-Nitroanilide Hydrochloride
CAS:Formula:C17H26N6O5·HClPurity:>98.0%(T)(HPLC)Color and Shape:White - Yellow Solid FormMolecular weight:430.89N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-D-phenylalanine
CAS:Formula:C24H21NO4Purity:>98.0%(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:387.44N-Carbobenzoxy-4-trans-hydroxy-L-proline Methyl Ester
CAS:Formula:C14H17NO5Purity:>98.0%(HPLC)(N)Color and Shape:Colorless to Light yellow clear liquidMolecular weight:279.29L-Isoleucine tert-Butyl Ester Hydrochloride
CAS:Formula:C10H21NO2·HClPurity:>98.0%(T)(N)Color and Shape:White to Almost white powder to crystalMolecular weight:223.74N-Chloroacetyl-D-phenylalanine
Formula:C11H12ClNO3Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:241.67N-Chloroacetyl-L-leucine
CAS:Formula:C8H14ClNO3Purity:>99.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:207.65L-2-(4-Chlorophenyl)glycine
CAS:Formula:C8H8ClNO2Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:185.61N-(tert-Butoxycarbonyl)-D-phenylalanine
CAS:Formula:C14H19NO4Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:265.31D-Histidine methyl ester dihydrochloride, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C7H13Cl2N3O2Purity:95%Molecular weight:242.10gamma-L-Glutamyl hydrazide
CAS:<p>gamma-L-Glutamyl hydrazide</p>Formula:C5H11N3O3Molecular weight:161.16Leu-Enkephalin
CAS:<p>Endogenous opioid neurotransmitter that is an agonist at mu- and delta-opioid receptors</p>Formula:C28H37N5O7Color and Shape:Lyophilized powder, WhiteMolecular weight:555.7L-Histidine methyl ester dihydrochloride, 98+%
CAS:<p>L-Histidine methyl ester dihydrochloride is used to prepare optically pure L-(+)-ergothioneine. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar prod</p>Formula:C7H11ClN3O2Purity:98+%Color and Shape:Crystals or powder or crystalline powder, WhiteMolecular weight:204.63Suc-Ala-Ala-Ala-pNA
CAS:Suc-AAA-pNA, a readily soluble and sensitive substrate for human and rat neutrophil and porcine pancreatic elastases. The trialanine substrate is also hydrolyzed by proteinase K, subtilisins and thermitase as well as by astacin, a crayfish zinc-endopeptidase.Formula:C19H25N5O8Purity:> 99%Color and Shape:Light YellowMolecular weight:451.44Bz-Ala-Arg-OH
CAS:A good substrate for carboxypeptidases B and N.Formula:C16H23N5O4Purity:> 99%Color and Shape:White PowderMolecular weight:349.39H-β-Chloro-D-Ala-OH · HCl
CAS:Competitive inhibitor of alanine racemase, Ki 0.005 mM.Formula:C3H6ClNO2·HClPurity:> 99%Color and Shape:White PowderMolecular weight:160.0H-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH
CAS:Arginine oligomers as heptaarginine, either alone or when conjugated to therapeutic agents or large biopolymers, have been shown to cross readily a variety of biological membranes (e.g. lipid bilayers and epithelial tissue). The importance of the guanidinium group in transport was supported by the observation that short oligomers of arginine entered cells far more rapidly than the corresponding oligomers of either lysine, histidine, ornithine, or citrulline.Formula:C42H86N28O8Purity:97.1%Color and Shape:White PowderMolecular weight:1111.33Suc-Ala-Ala-Pro-Phe-AMC
CAS:The peptidylprolyl isomerase substrate Suc-AAPF-AMC is also hydrolyzed by carboxypeptidase Y, cathepsin G, and chymotrypsin. Suc-AAPF-AMC has also been used to analyze the chymotrypsin-like activity of trypsins.Formula:C34H39N5O9Purity:99.5%Color and Shape:WhiteMolecular weight:661.71H-Leu-OEt · HCl
CAS:<p>Bachem ID: 4001907.</p>Formula:C8H17NO2·HClPurity:> 99%Color and Shape:WhiteMolecular weight:195.69Dynorphin B
CAS:<p>Bachem ID: 4007171.</p>Formula:C74H115N21O17Purity:98.7%Color and Shape:White PowderMolecular weight:1570.86α-MSH
CAS:α-Melanotropin, also known as α-melanocyte-stimulating hormone (α-MSH), is a 13-amino acid peptide originally characterized as a neuropeptide derived from the pituitary gland. α-MSH is synthesized from pro-opiomelanocortin (POMC) by the action of specific prohormone convertases and is involved in the regulation of important physiological functions including food intake, energy homeostasis, modulation of immune responses and photoprotection.Formula:C77H109N21O19SPurity:98.2%Color and Shape:White LyophilisateMolecular weight:1664.91Ac-Tyr-Val-Ala-Asp-AFC
CAS:The presence of halogen substituents at the fluorescent group improves membrane permeability of the YVAD-derived caspase-1 substrate.Formula:C33H36F3N5O10Purity:98.5%Molecular weight:719.67((R)-4-Hydroxy-4-methyl-Orn(FITC)⁷)-Phalloidin
CAS:Fluorophore-labeled phalloidin used for visualizing the actin cytoskeleton.Formula:C56H60N10O15S2Purity:95.3%Color and Shape:Yellow LyophilisateMolecular weight:1177.27(D-Phe¹²,Nle²¹·³⁸,α-Me-Leu³⁷)-CRF (12-41) (human, rat)
CAS:Potent and long-acting CRF antagonist.Formula:C159H267N49O43Purity:> 96%Color and Shape:White LyophilisateMolecular weight:3553.17KALA Amphipathic Peptide
CAS:KALA amphipathic peptide, a low-molecular weight cationic amphipathic peptide was able to bind to DNA, to destabilize membranes and to mediate transfection of plasmid DNA in various cell lines. Thus, KALA provides a starting point for a family of peptides that incorporate other functions to improve DNA delivery systems.Formula:C144H248N40O35SPurity:> 94%Color and Shape:WhiteMolecular weight:3131.87Iberiotoxin
CAS:Iberiotoxin (IbTx), from the venom of the scorpion Buthus tamulus, shows 68% sequence homology with charybdotoxin, another scorpion-derived peptidyl toxin. Although these two toxins both inhibit the high conductance Ca²⁺ activated K⁺ channel, they appear to bind at different sites on the channel and modulate channel activity by different mechanisms. Thus, iberiotoxin can be used to selectively study the function of the high conductance Ca²⁺ activated K⁺ channel.Formula:C179H274N50O55S7Purity:> 95%Color and Shape:Whitish PowderMolecular weight:4230.91H-His-βNA
CAS:In vitro, this compound competitively inhibited sweetalmond β-glucosidase (Ki = 17 µM).Formula:C16H16N4OPurity:> 98%Color and Shape:White PowderMolecular weight:280.33Thymopentin
CAS:Thymopentin (TP5), an active fragment of thymopoietin (TP), reduces endocrine and behavioral responses to experimental stress, possibly by lowering plasma TP (pTP) levels. The immunomodulatory peptide suppresses proliferation and induces differentiation in HL-60 cells.Formula:C30H49N9O9Purity: 1.6%Color and Shape:WhiteMolecular weight:679.77GLP-2 (1-34) (human)
CAS:<p>Bachem ID: 4029353.</p>Formula:C171H266N48O56SPurity:95.5%Color and Shape:White LyophilisateMolecular weight:3922.35Bz-Arg-AMC · HCl
CAS:Sensitive fluorogenic substrate for trypsin, soybean trypsin-like enzyme, and papain.Formula:C23H25N5O4·HClPurity:99.6%Color and Shape:WhiteMolecular weight:471.94H-Leu-βNA
CAS:Substrate for assays of aminopeptidase M and leucine aminopeptidase. Its use for histochemical purposes has been described.Formula:C16H20N2OPurity:> 99%Color and Shape:White PowderMolecular weight:256.35(Arg⁸)-Vasotocin (Salt form trifluoroacetate)
CAS:Vasotocin (AVT, argiprestocin) is the vasopressin/oxytocin analog produced in birds, amphibians and fish. AVT shows antidiuretic as well as reproductive activities.Formula:C43H67N15O12S2Purity:98.0%Color and Shape:WhiteMolecular weight:1050.23H-Gly-Arg-AMC
CAS:Sensitive fluorogenic substrate for dipeptidyl aminopeptidase I (DPP I, cathepsin C).Formula:C18H24N6O4Purity:> 99%Color and Shape:WhiteMolecular weight:388.43Suc-Ala-Ala-Ala-AMC
CAS:Suc-AAA-AMC, sensitive fluorogenic substrate for pancreatic elastase.Formula:C23H28N4O8Purity:99.4%Color and Shape:White PowderMolecular weight:488.5Z-Val-Ala-DL-Asp(OMe)-fluoromethylketone
CAS:Z-VAD(OMe)-FMK, a pan-caspase inhibitor, is a competitive irreversible peptide inhibitor and blocks caspase-1 family and caspase-3 family enzymes. The methyl ester of Z-VAD-FMK has been used in studies to support the hypothesis that inhibitors of caspases can limit brain infarction resulting from the permanent obstruction of a brain artery.Formula:C22H30FN3O7Purity:96.3%Color and Shape:White PowderMolecular weight:467.5C-Peptide (human)
CAS:<p>Bachem ID: 4068086.</p>Formula:C129H211N35O48Purity:96.0%Color and Shape:White LyophilisateMolecular weight:3020.3Orexin A (human, mouse, rat)
CAS:Orexin A (OXA, hypocretin-1) is a hypothalamic neuropeptide regulating the feeding behavior. Central administration of orexin A to rats stimulated food consumption in a dose-dependent manner. The effect persisted at 4 h after injection, as orexin A seems to be resistant to peptidases. Orexin A specifically binds a G protein-coupled receptor, OX₁R (IC₅₀ = 20 nM to displace 50 % of radiolabeled orexin A bound to this receptor). Orexin A produced in the amygdala induces wakefulness and plays a role in the induction of human emotions. Narcolepsy has been associated with orexin deficiency. The peptide also corresponds to bovine, canine, ovine, and porcine orexin A.Formula:C152H243N47O44S4Purity:95.9%Color and Shape:White LyophilisateMolecular weight:3561.16pTH (1-34) (rat)
CAS:Rat pTH (1-34) suppressed appositional bone formation by cultured rat cranial osteoblasts.Formula:C180H291N55O48S2Purity:≥ 98%Color and Shape:Whitish LyophilisateMolecular weight:4057.765-FAM-HIV-1 tat Protein (47-57)
CAS:FAM-HIV-1 Tat 47-57 was used as a fluorescent probe for studying the interaction between the p53 tetramerization domain and HIV-1 Tat protein.Formula:C85H128N32O20Purity:>96%Color and Shape:YellowMolecular weight:1918.16Osteocalcin (1-49) (human)
CAS:<p>Bachem ID: 4034491.</p>Formula:C269H381N67O82S2Purity:93.2%Color and Shape:WhiteMolecular weight:5929.52Neuropeptide Y (human, rat)
CAS:<p>Bachem ID: 4012616.</p>Formula:C189H285N55O57SPurity:95.2%Color and Shape:WhiteMolecular weight:4271.74ACTH (1-39) (human)
CAS:The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.Formula:C207H308N56O58SPurity:99.2%Color and Shape:WhiteMolecular weight:4541.13Dynorphin A (1-13)
CAS:Endogenous kappa-opioid receptor agonist. It is suggested that it attenuates galanin-induced impairment of memory processes through the mediation of kappa-opioid receptors.Formula:C75H126N24O15Purity:91.6%Color and Shape:White PowderMolecular weight:1603.98Characteristic MSH-Tetrapeptide
CAS:<p>Bachem ID: 4004112.</p>Formula:C32H40N10O5Color and Shape:BeigeMolecular weight:644.73Calcium-Like Peptide 3
CAS:CALP-3, VKFGVGFK, acts as a calmodulin agonist. The octapeptide interacts with the calmodulin EF-hand motif, the Ca²⁺-binding site. CALP-3 activates phosphodiesterase in the absence of calcium and inhibits Ca²⁺-mediated cytotoxicity and apoptosis. CALP-3 is more active than CALP-1. By preventing trypsin activation within pancreatiic acinar cells CALP-3 shows potential therapeutic potential in the treatment of pancreatitis.Formula:C44H68N10O9Purity:> 96%Color and Shape:White PowderMolecular weight:881.09pTH (1-31) amide (human)
CAS:pTH (1-31) amide appears so far to be the smallest of the potently osteogenic pTH fragments. The osteogenic activity of this pTH fragment seems to be related to its ability to activate adenylyl cyclase. Unlike pTH, this fragment does not activate phospholipase C and should therefore have fewer side-effects and find application in the osteoporosis treatment.Formula:C162H270N50O46S2Purity:96.7%Molecular weight:3718.37Histone H3 (21-44)
CAS:The histone fragment was used as substrate for the protein arginine methyltransferase PRMT4.Formula:C109H185N39O29Purity:99.1%Color and Shape:White PowderMolecular weight:2505.91(Arg⁸)-Vasotocin (Salt form acetate)
CAS:Non-mammalian Arg-vasopressin/oxytocin analog.Formula:C43H67N15O12S2Purity:98.7%Color and Shape:White Whitish PowderMolecular weight:1050.23Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat)
CAS:This pTHrP fragment stimulated membrane-associated protein kinase C in freshly isolated rat spleen lymphocytes and thus raises the possibility of being a physiological regulator of the proliferation and other activities of lymphocytes.Formula:C27H42N10O7Purity:97.4%Color and Shape:White LyophilisateMolecular weight:618.69Gluten Exorphin C
CAS:Gluten Exorphin C, isolated from the pepsin-trypsin-chymotrypsin digest of wheat gluten, was considered as a δ-opioid receptor-selective ligand. The hydrophobicity of Ile³ seems to be important for the expression of the opioid activity of gluten exorphin C. Moreover, this peptide appears to be quite different from any of the endogenous and exogenous opioid peptides ever reported as the N-terminal Tyr is the only aromatic amino acid in the structure.Formula:C29H45N5O8Purity:> 97%Color and Shape:Whitish PowderMolecular weight:591.71pTH-Related Protein (1-34) (human, mouse, rat)
CAS:V.Paspaliaris et al. showed that daily administration of pTHrP (1-34) to rats was anabolic on bone by increasing bone formation. This treatment could inhibit the rapid decline in bone formation due to denervation.Formula:C180H287N57O48Purity:98.4%Color and Shape:White PowderMolecular weight:4017.61pTH (1-84) (rat)
CAS:<p>Bachem ID: 4051303.</p>Formula:C406H670N122O126S3Purity:> 95%Color and Shape:White PowderMolecular weight:9372.73(β-D-Asp²⁸)-Exenatide
CAS:Potential degradation product of exenatide resulting from aspartimide formation and cleavage.Formula:C184H281N49O61SPurity:96.3%Color and Shape:White PowderMolecular weight:4187.62Gastric Juice Peptide Fragment
CAS:The pentadecapeptide BPC-157 (GEPPPGKPADDAGLV) shows a protective effect on stomach and duodenum when administered to stress ulcers, cysteamine-duodenal ulcers and ethanol lesions. Application of BPC 157 improved tendon healing.Formula:C62H98N16O22Purity:96.1%Color and Shape:White - WhitishMolecular weight:1419.56Azido-PEG3-DYKDDDDK
CAS:This product is used for the attachment of the FLAG-tag by copper(I)-catalyzed azide-alkyne cycloaddition (CuAAC), the prototypical reaction of click chemistry, as described for example by Wang and coworkers. In addition, Azido-PEG3-FLAG contains a PEG-linker. The resulting FLAG-tagged molecules can be detected or purified immunologically, using dye labeled, enzyme coupled or, for purification, immobilized anti-FLAG antibodies.Formula:C50H75N13O24Purity:97.4%Color and Shape:White PowderMolecular weight:1242.22Abaloparatide
CAS:The pTHrP-analog abaloparatide (BIM-44058) promoting bone growth has been developed for the treatment of osteoporosis.Formula:C174H300N56O49Purity:96.2%Color and Shape:White Whitish PowderMolecular weight:3960.64Pancreatic Polypeptide (human)
CAS:As antagonist of CCK, PP inhibits pancreatic sedretion. PP also acts on the gastrointestinal motility, food intake, and metabolism.Formula:C185H287N53O54S2Purity:97.1%Color and Shape:White LyophilisateMolecular weight:4181.77(Des-Gly¹⁰,D-Ala⁶,Pro-NHEt⁹)-LHRH (salmon)
CAS:GnRH analog used in aquaculture.Formula:C61H76N14O12Purity:97.7%Color and Shape:WhiteMolecular weight:1197.36Exendin-4 (1-8)
CAS:<p>Bachem ID: 4051740.</p>Formula:C35H51N11O13Purity:> 97%Molecular weight:833.86Amylin (8-37) (human)
CAS:Human IAPP (8-37), ATQRLANFLVHSSNNFGAILSSTNVGSNTY-amide, readily forms fibrils in vitro.Formula:C138H216N42O45Purity:> 94%Color and Shape:WhiteMolecular weight:3183.49GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)
CAS:<p>Bachem ID: 4034865.</p>Formula:C151H228N40O47Purity:> 97%Color and Shape:WhiteMolecular weight:3355.71(Nle⁸·¹⁸,Tyr³⁴)-pTH (1-34) (human)
CAS:<p>Bachem ID: 4015469.</p>Formula:C183H295N55O52Purity:> 98%Color and Shape:WhiteMolecular weight:4097.69(Trp⁶³,Trp⁶⁴)-C3a (63-77)
CAS:(Trp⁶³,Trp⁶⁴)-C3a (63-77), synthetic superagonist analog of complement 3a, exhibited the greatest biological potency of all peptides tested. The peptide was 12-15 times more active than natural C3a. Such an optimal potency was obtained by introducing a bulky hydrophobic group such as Trp-Trp which binds more strongly to the hydrophobic site on the receptor than does the corresponding site on the natural ligand.Formula:C86H134N26O18Purity:99.0%Color and Shape:WhiteMolecular weight:1820.17GRP (18-27) (human, porcine, canine)
CAS:Bombesin-like peptide from porcine spinal cord; exhibits a potent stimulant effect on smooth muscle of rat uterus. Neuromedin C microinjected into the amygdala inhibited feeding in rats.Formula:C50H73N17O11SPurity:97.8%Color and Shape:White PowderMolecular weight:1120.3Acetyl-(D-Arg²)-GRF (1-29) amide (human)
CAS:GRF antagonist.Formula:C154H255N47O43SPurity:> 95%Color and Shape:WhiteMolecular weight:3485.08Secretin (rat)
CAS:<p>Bachem ID: 4037181.</p>Formula:C129H216N42O42Purity:> 98%Molecular weight:3027.39ω-Conotoxin MVIIA
CAS:ω-Conotoxin MVIIA, originally isolated from the venom of the fish-hunting cone snail Conus magus, is a blocker of voltage-sensitive Ca²⁺ channels in neurons. The peptide has been used to identify different Ca²⁺ channel subtypes in amphibian brain.Formula:C102H172N36O32S7Purity:≥ 97%Color and Shape:White PowderMolecular weight:2639.17Suc-Ala-Ala-Pro-Arg-pNA
CAS:Suc-AAPR-pNA, a substrate for wild-type and K188D/D189K trypsins (Km = 32.8 mM respectively 50.8 mM).Formula:C27H39N9O9Purity:98.9%Color and Shape:Light Yellow PowderMolecular weight:633.66(Pyr¹)-Apelin-13 (human, bovine, mouse, rat)
CAS:<p>Bachem ID: 4104812.</p>Formula:C69H108N22O16SPurity:98.2301%Color and Shape:White PowderMolecular weight:1533.82H-Tyr-Arg-Gly-Asp-Ser-OH
CAS:PEG acrylate-based hydrogels have been modified with the RGD peptide YRGDS to improve their biocompatibility. YRGDS can be radioiodinated.Formula:C24H36N8O10Purity:> 98%Color and Shape:White LyophilisateMolecular weight:596.6Apelin-17 (human, bovine, mouse, rat)
CAS:Apelin-17 is an endogenous ligand of the human orphan G protein-coupled receptor APJ, reported to act as a coreceptor of CD4 for human and simian immunodeficiency viruses. Apelin-17 and apelin-13 represent the predominant molecular forms of apelin present in the whole brain, hypothalamus, and plasma. Like apelin-13, apelin-17 exhibited a high activity on extracellular acidification rate and strongly inhibited forskolin-stimulated cAMP production in CHO cells expressing the human or the rat apelin receptor. The peptide might play a crucial role in the maintenance of body fluid homeostasis by counteracting AVP (arginine vasopressin) actions through inhibition of AVP neuron activity and AVP release.Formula:C96H156N34O20SPurity:> 98%Color and Shape:White PowderMolecular weight:2138.58Ac-muramyl-Ala-D-Glu-NH₂
CAS:Muramyl dipeptide (MDP) inhibits HIV replication in CD4⁺ H9 lymphocytes..Formula:C19H32N4O11Purity:99.2%Color and Shape:White PowderMolecular weight:492.48µ-Conotoxin GIIIB
CAS:This strongly basic µ-conotoxin from the venom of Conus geographus is highly effective in blocking sodium channels in vertebrate skeletal muscle, thereby preventing the propagation of muscle action potentials.Formula:C101H175N39O30S7Purity:97.2%Color and Shape:Whitish PowderMolecular weight:2640.21Caloxin 2A1
CAS:Caloxin 2A1 is a selective extracellular inhibitor of the plasma membrane Ca²⁺-pump.Formula:C64H91N19O22Purity:99.3%Color and Shape:White LyophilisateMolecular weight:1478.54H-Ala-Phe-Pro-pNA
CAS:AFP-pNA, substrate for prolyl tripeptidyl aminopeptidases from the periodontal pathogens Porphyromonas gingivalis and Prevotella nigrescens.Formula:C23H27N5O5Purity:97.8%Color and Shape:Light YellowMolecular weight:453.5CRF (human, rat)
CAS:CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.Formula:C208H344N60O63S2Purity:≥ 99%Color and Shape:WhiteMolecular weight:4757.52FA-Ala-Arg-OH
CAS:Substrate for human plasma carboxypeptidase N and membrane-bound carboxypeptidase D.Formula:C16H23N5O5Purity:> 97%Color and Shape:Light YellowMolecular weight:365.39H-Pro-Pro-Pro-Pro-OH
CAS:Tetraproline. PPPP was used as an internal standard in the quantitative determination of the antihypertensive (ACE-inhibiting) peptides IPP and VPP in cheese by HPLC-MS³.Formula:C20H30N4O5Purity:99.8%Color and Shape:WhiteMolecular weight:406.48Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat)
CAS:The pentapeptide TRSAW, a highly conserved sequence within the pTH-related protein, is a potent inhibitor of osteoclastic bone resorption in vitro (EC₅₀ = 10⁻¹⁵ M).Formula:C27H41N9O8Purity:98.6%Color and Shape:White LyophilisateMolecular weight:619.68H-3,4-Dehydro-Pro-OH
CAS:<p>Bachem ID: 4003545.</p>Formula:C5H7NO2Purity:> 99%Color and Shape:White PowderMolecular weight:113.12Fmoc-Ala-Pro-OH
CAS:<p>Bachem ID: 4014443.</p>Formula:C23H24N2O5Purity:99.8%Color and Shape:WhiteMolecular weight:408.45Z-Ala-Pro-pNA
CAS:The prolyl oligopeptidase (POP) substrate Z-AP-pNA was used in combination with Z-GP-pNA and Z-AA-pNA for characterizing the prolyl oligopeptide of of the hyperthermophile Pyrococcus furiosus.Formula:C22H24N4O6Purity:> 99%Color and Shape:Whitish PowderMolecular weight:440.46Ac-Tyr-OEt
CAS:Substrate for chymotrypsin and carboxypeptidase Y.Formula:C13H17NO4Purity:> 99%Color and Shape:White PowderMolecular weight:251.28Z-Phe-Leu-OH
CAS:A good substrate for carboxypeptidase Y, the Streptomyces griseus carboxypeptidase, and the membrane-associated carboxypeptidase ysc-lambda.Formula:C23H28N2O5Purity:99.9%Color and Shape:White PowderMolecular weight:412.49Dynorphin A
CAS:Endogenous kappa-receptor antagonist.Formula:C99H155N31O23Purity:97.4%Color and Shape:White LyophilisateMolecular weight:2147.52LHRH
CAS:A hypothalamic neuropeptide which stimulates the release of LH and FSH. CAS Number (gonadorelin acetate): 34973-08-5.Formula:C55H75N17O13Purity:99.7%Color and Shape:White PowderMolecular weight:1182.31(Thr⁴,Gly⁷)-Oxytocin
CAS:TGOT exhibits a 640-fold increase in oxytocic/ antidiuretic selectivity relative to oxytocin.Formula:C39H61N11O12S2Purity:99.6%Color and Shape:White LyophilisateMolecular weight:940.11N-Me-D-Asp-OH
CAS:Excitatory amino acid neurotransmitter. NMDA is a selective agonist of the glutamate receptor that regulates Ca²⁺ channels.Formula:C5H9NO4Purity:> 99%Molecular weight:147.13Ac-Lys(Ac)-D-Ala-D-Ala-OH
CAS:Diacetyl-Lys-D-Ala-D-Ala (DALAA) is a substrate for penicillin-sensitive D-alanine carboxypeptidases (DD-carboxypeptidases).Formula:C16H28N4O6Purity:98.7%Color and Shape:White PowderMolecular weight:372.42H-Arg-pNA · 2 HCl
CAS:Specific chromogenic substrate for cathepsin H.Formula:C12H18N6O3·2HClPurity: 99%Color and Shape:Light BeigeMolecular weight:367.24(Cys⁴⁷)-HIV-1 tat Protein (47-57)
CAS:CPP for gene delivery.Formula:C58H114N32O13SPurity:97.0%Molecular weight:1499.82γ₁-MSH
CAS:γ₁-MSH has been located in the cryptic region of the ACTH/β-lipotropin precursor protein from the intermediate lobe of bovine pituitary.Formula:C72H97N21O14SPurity:≥ 90%Color and Shape:WhiteMolecular weight:1512.76GLP-2 (1-33) (human)
CAS:<p>Bachem ID: 4095874.</p>Formula:C165H254N44O55SPurity:97.6%Color and Shape:WhiteMolecular weight:3766.16Neuropeptide Y (porcine)
CAS:<p>Bachem ID: 4011654.</p>Formula:C190H287N55O57Purity:97.3%Color and Shape:White LyophilisateMolecular weight:4253.71Cholecystokinin Octapeptide (sulfated)
CAS:CCK-8 exhibits various gastrointestinal effects as contraction of the gallbladder and stimulation of pancreatic secretion and gastrointestinal transit. In rats, CCK-8 facilitated the uptake of leptin from peripheral circulation to cerebrospinal fluid and its access to the hypothalamus.Formula:C49H62N10O16S3Purity:98.42%Color and Shape:White PowderMolecular weight:1143.29(Glu¹⁷·²¹·²⁴)-Osteocalcin (1-49) (human)
CAS:The peptide hormone osteocalcin is involved not only in bone formation, it also plays an important role in glucose metabolism and could regulate testosteron. In mice, only the completely decarboxylated form of the peptide shows the latter hormonal activities, whereas in humans, osteocalcin, partially decarboxylated osteocalcins, and the uncarboxylated peptide seem to be involved. Generally, obese individuals have been shown to have lower osteocalcin(s) levels than non-obese controls, and type 2 diabetic individuals have lower plasma osteocalcin than non-diabetic individuals.Formula:C266H381N67O76S2Purity:95.4%Color and Shape:WhiteMolecular weight:5797.49(Glu²⁴)-Glucagon (1-29) (human, rat, porcine)
CAS:Deamidation product of glucagon.Formula:C153H224N42O50SPurity:91.8%Color and Shape:WhiteMolecular weight:3483.78Neuropeptide FF
CAS:Neuropeptide FF (FLFQPQRF-amide) is an octapeptide implicated in a variety of physiological functions, including nociception, cardiovascular responses, and neuroendocrine regulation.Formula:C54H76N14O10Purity:98.4%Color and Shape:White LyophilisateMolecular weight:1081.29GRP (human)
CAS:GRP, a bombesin-like peptide, is involved in stress-induced anorexia.Formula:C130H204N38O31S2Purity:97.8%Color and Shape:Grey LyophilisateMolecular weight:2859.42Z-Gly-Pro-AMC
CAS:Z-GP-AMC, fluorogenic substrate for the determination of post-proline cleaving enzyme (prolyl endopeptidase).Formula:C25H25N3O6Purity:> 99%Color and Shape:White PowderMolecular weight:463.49(Leu³¹,Pro³⁴)-Neuropeptide Y (human, rat)
CAS:Specific Y₁ receptor agonist.Formula:C189H284N54O56SColor and Shape:WhiteMolecular weight:4240.73Galanin-Like Peptide (rat)
CAS:Galanin-like peptide (GALP), first isolated from the porcine hypothalamus and subsequently also identified in rats and humans, is a 60 amino acid neuropeptide that unlike galanin, has a non-amidated C-terminus. Its amino acid residues (9-21) are identical to the biologically active N-terminal (1-13) fragment of galanin. In contrast to galanin which is relatively non-selective, receptor binding studies revealed that GALP had a high affinity for the galanin receptor 2 (GALR2) and a lower affinity for the GALR1 receptor. Furthermore, it could be demonstrated that GALP stimulates food intake with a ten fold higher orexigenic activity than galanin and may also affect emotional state in the CNS.Formula:C288H461N87O83SPurity:> 95%Color and Shape:White PowderMolecular weight:6502.43GRF (human)
CAS:GRF is the hypothalamic peptide hormone that specifically stimulates synthesis and release of the growth hormone by somatotropic cells of the anterior pituitary gland.Formula:C215H358N72O66SPurity:98.1%Color and Shape:White LyophilisateMolecular weight:5039.72pTH-Related Protein (1-34) amide (human, mouse, rat)
CAS:<p>Bachem ID: 4031196.</p>Formula:C180H288N58O47Purity:91.3%Color and Shape:White LyophilisateMolecular weight:4016.63Neuromedin S (human)
CAS:The 33-amino acid neuropeptide neuromedin S (NMS) was originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. hNMS-33 is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that NMS is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.Formula:C173H265N53O44Purity:> 97%Color and Shape:WhiteMolecular weight:3791.34α-Conotoxin MI
CAS:α-Conotoxin MI has been isolated from the venom of the sea snail Conus imperialis. The conotoxin is a ligand for nicotinic acetylcholine receptors. It is highly active against the neuromuscular receptor in frogs but not in mice.Formula:C58H88N22O17S4Color and Shape:Whitish PowderMolecular weight:1493.74(D-Ser¹)-ACTH (1-24) (human, bovine, rat)
CAS:Former CAS-number 26469-81-8.Formula:C136H210N40O31SPurity:95.5%Color and Shape:WhiteMolecular weight:2933.48RVG-9R
CAS:Chimeric rabies virus glycoprotein fragment peptide (RVG-9R peptide) was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. Repeated administration of RVG-9R-bound siRNA did not induce inflammatory cytokines nor anti-peptide antibodies.Formula:C201H334N82O55S2Purity:>95%Color and Shape:White PowderMolecular weight:4843.51(D-Ser⁴)-LHRH
CAS:<p>Bachem ID: 4029233.</p>Formula:C55H75N17O13Purity:97.8%Color and Shape:WhiteMolecular weight:1182.31(Des-octanoyl)-Ghrelin (human)
CAS:Most circulating ghrelin is des-octanoyl ghrelin. The non-acylated ghrelin was considered inactive at first, though biological activities such as stimulation of adipogenesis and control of cell growth could be demonstrated more recently. Both ghrelin and the more abundant endogenous form des-octanoyl ghrelin could play a role in the paracrine regulation of vascular tone in humans.Formula:C141H235N47O41Purity:> 95%Color and Shape:White LyophilisateMolecular weight:3244.71Z-Leu-Leu-OH
CAS:Educt for the synthesis of proteasome inhibitors. Z-LL activates the ClpP protease from M. tuberculosis.Formula:C20H30N2O5Purity:> 99%Color and Shape:White PowderMolecular weight:378.47Z-Lys-ONp · HCl
CAS:A synthetic chromogenic substrate for the determination of serinic and thiol proteases, e.g. urokinase, trypsin, cathepsin B, cathepsin L, and papain.Formula:C20H23N3O6·HClColor and Shape:White PowderMolecular weight:437.88Z-Glu-Tyr-OH
CAS:Substrate for porcine cathepsin A and acid carboxypeptidases from A. niger.and A. kawachii.Formula:C22H24N2O8Purity:> 99%Color and Shape:White PowderMolecular weight:444.44H-Gly-Phe-pNA
CAS:Substrate for dipeptidyl aminopeptidase I (cathepsin C).Formula:C17H18N4O4Purity:> 99%Color and Shape:Light Yellow PowderMolecular weight:342.35Exendin (9-39)
CAS:Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide and of exendin-4 on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.Formula:C149H234N40O47SPurity:97.4%Color and Shape:White PowderMolecular weight:3369.8Ac-Asp-Glu-Val-Asp-AFC
CAS:Ac-DEVD-AFC is a sensitive fluorescent substrate for the assay of caspase-3 activity. The trifluoromethyl substituent of the fluorophore improves the membrane permeability of the substrate. CAS-Number (net) 141258-58-4 .Formula:C30H34F3N5O13Purity:≥ 98%Color and Shape:WhiteMolecular weight:729.62Cortistatin-29 (rat)
CAS:Antiinflammatory peptide with high homology to somatostatin.Formula:C161H240N46O41S2Purity:98.0%Color and Shape:White PowderMolecular weight:3540.09GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat)
CAS:<p>Bachem ID: 4030651.</p>Formula:C184H273N51O57Purity:> 98%Color and Shape:White PowderMolecular weight:4111.5Ghrelin (mouse, rat)
CAS:Ghrelin, a peptide hormone produced by the stomach oxyntic cells plays a crucial role in appetite regulation. It binds to the growth hormone secretagogue receptor (GHS-R), which stimulates the release of GH. Ghrelin, which promotes food uptake and body weight increase, acts as an antagonist of leptin. Thus, it has become an important tool in obesity research. Additionally, ghrelin is involved in the bone metabolism, in reproduction, and in the immune system.Formula:C147H245N45O42Purity:97.3%Color and Shape:White PowderMolecular weight:3314.84Fmoc-Leu-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Bachem ID: 4096175.</p>Formula:C33H36N2O7SPurity:> 99%Color and Shape:White PowderMolecular weight:604.72Ac-DL-Phe-β-naphthyl ester
CAS:DL-APNE (or NAPNE), a chromogenic substrate for chymotrypsin and microbial serine proteases, e.g. subtilisin. It is also hydrolyzed by cathepsin G. NAPNE was used by Yakoby and Raskin to determine the inhibitory activity of trypsin and chymotrypsin.Formula:C21H19NO3Purity:> 99%Color and Shape:White PowderMolecular weight:333.39Fmoc-Ala-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Bachem ID: 4096166.</p>Formula:C30H30N2O7SPurity:97.5%Color and Shape:WhiteMolecular weight:562.64(Deamino-Cys¹,D-Arg⁸)-Vasopressin
CAS:Desmopressin (DDAVP), as the first vasopressin analog with a very high and very specific antidiuretic effect, has been widely used for different therapeutic purposes. DDAVP also improves human learning and memory processes. CAS Number (desmopressin acetate): 62288-83-9.Formula:C46H64N14O12S2Purity:99.7%Color and Shape:White PowderMolecular weight:1069.23H-Lys-Ala-pNA · 2 HCl
CAS:Chromogenic substrate for dipeptidyl aminopeptidase II (DPPII), also cleaved by a dipeptidyl peptidase V (DPP V) from Aspergillus fumigatus.Formula:C15H23N5O4·2HClPurity:98.4%Color and Shape:Light YellowMolecular weight:410.3Gastric Inhibitory Polypeptide (1-30) amide (porcine)
CAS:This GIP fragment has potent insulinotropic activity in the isolated, perfused rat pancreas but greatly reduced somatostatinotropic activity in the isolated perfused rat stomach. The site responsible for insulinotropic activity apparently lies between residues 19 and 30 of GIP.Formula:C162H245N41O47SPurity:95.4%Color and Shape:White LyophilisateMolecular weight:3551.04Boc-Met-Leu-Phe-OH
CAS:Chemotactic peptide antagonist.Formula:C25H39N3O6SPurity:> 99%Color and Shape:White PowderMolecular weight:509.67(Des-Glu⁵)-ACTH (1-24) (human, bovine, rat)
CAS:Impurity of tetracosactide, which is a synthetic peptide analog of the human adrenocorticotropic hormone that stimulates the production of cortisol.Formula:C131H203N39O28SPurity:96.5%Color and Shape:WhiteMolecular weight:2804.37Ac-Trp-Glu-His-Asp-aldehyde (pseudo acid)
CAS:Ac-WEHD-CHO, a very potent reversible inhibitor of caspase-1 (ICE). It bears the optimal tetrapeptide recognition motif for this enzyme. With a Ki of 56 pM it belongs to the most potent reversible, peptide-based inhibitors described for any protease. For caspase-8 a Ki of 21.1 nM has been reported.Formula:C28H33N7O9Purity:95.0%Color and Shape:WhiteMolecular weight:611.61Cyclo(-His-Pro)
CAS:Cyclo(His-Pro), a diketopiperazine showing various biological effects in the CNS, as well as endocrine effects, has been isolated from several mammalian tissues. In some cases, it has been identified as a degradation product of thyrotropin-releasing hormone (TRH). In the presence of zinc ions, cyclo(His-Pro) showed hypoglycemic effects and induced body weight reduction in rats.Formula:C11H14N4O2Purity:> 99%Color and Shape:Whitish PowderMolecular weight:234.26Deltorphin II
CAS:Deltorphin B, a selective δ-opioid receptor agonist isolated from the skin of Phyllomedusa bicolor.Formula:C38H54N8O10Purity:97.7%Color and Shape:WhiteMolecular weight:782.9GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
CAS:Glucagon-Like Peptide 1 (GLP-1) is synthesized by posttranslational processing of proglucagon in the intestine and pancreas and plays an important role in metabolic homeostasis. Among the different molecular forms, such as GLP-1 (7-36) amide and GLP-1 (7-37), the function of GLP-1 (1-37) has been unclear. GLP-1 (1-37) was shown to convert intestinal epithelial cells into insulin-producing cells. These observations turned GLP-1 (1-37) into a new promising therapeutic compound for the treatment of diabetes mellitus. In animal models of dilated cardiomyopathy, hypertensive heart failure, and myocardial infarction, GLP-1 has shown a remarkable cardioprotective activity.Formula:C186H275N51O59Purity:97.1%Color and Shape:White LyophilisateMolecular weight:4169.54ACTH (1-14)
CAS:ACTH (1–14) is a fragment of the ACTH hormone, which stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol. ACTH (1–14) is an agonist of the melanocortin-1 and 3 receptor (K1 = 0.836 ± 0.33 and 48,3 ± 9,0 nmol/L respectively).Formula:C77H109N21O20SPurity:97.7%Color and Shape:White PowderMolecular weight:1680.91H-Leu-NH₂
CAS:Substrate for leucine aminopeptidase.Formula:C6H14N2OPurity:> 99%Color and Shape:White PowderMolecular weight:130.19(Des-Gly¹⁰,D-Trp⁶,Pro-NHEt⁹)-LHRH High acetate salt
CAS:Short-term administration of deslorelin stimulates the formation of LH and FSH, which induce an increase in the production of testosterone and estradiol. Prolonged administration of the GnRH agonist causes a sustained down-regulation of circulating LH and FSH levels and hence suppression of steroidogenesis.Formula:C64H83N17O12Purity:99.1%Color and Shape:WhitishMolecular weight:1282.47GRF (rat)
CAS:<p>Bachem ID: 4030687.</p>Formula:C225H361N77O66SPurity:96.3%Color and Shape:White Whitish PowderMolecular weight:5232.89Suc-Ala-Ala-Val-Ala-pNA
CAS:Suc-AAVA-pNA has been used for assaying hamster chymase 2.Formula:C24H34N6O9Purity:> 99%Color and Shape:Light Beige PowderMolecular weight:550.57H-Ala-Ala-Phe-AMC (free base)
CAS:AAF-AMC, fluorogenic substrate for tripeptidyl peptidases I and II and for tripeptide aminopeptidase EC 3.4.11.4.Formula:C25H28N4O5Purity:> 99%Color and Shape:WhiteMolecular weight:464.52(Des-octanoyl)-Ghrelin (mouse, rat)
CAS:In contrast to the octanoylated peptide, the non-acylated ghrelin does not activate growth hormone secretagogue receptor-expressing cells. The peptide decreases food intake and gastroduodenal motility in conscious rats, probably by crossing the blood-brain barrier and activating the brain receptor directly.Formula:C139H231N45O41Purity:95.4%Color and Shape:White LyophilisateMolecular weight:3188.64H-Arg-Arg-AMC
CAS:RR-AMC, fluorogenic substrate for dipeptidyl peptidase III (DPP III).Formula:C22H33N9O4Purity:> 98%Color and Shape:WhiteMolecular weight:487.56Z-Pro-Ala-OH
CAS:<p>Bachem ID: 4002476.</p>Formula:C16H20N2O5Purity:> 99%Color and Shape:White PowderMolecular weight:320.35Peptide YY (human)
CAS:Peptide YY has been isolated from human colonic extracts. It is identical in sequence to porcine PYY except for two amino acid replacements.Formula:C194H295N55O57Purity:> 95%Color and Shape:White PowderMolecular weight:4309.81H-D-Phe-Cys-Tyr-D-Trp-Arg-Thr-Pen-Thr-NH₂
CAS:CTAP, an analog of CTOP, is a selective µ-opioid receptor antagonist.Formula:C51H69N13O11S2Purity:98.2%Color and Shape:Yellow PowderMolecular weight:1104.32(β-Asp²⁸)-Exenatide
CAS:Potential degradation product of exenatide resulting from aspartimide formation and cleavage.Formula:C184H281N49O61SPurity:92.6%Color and Shape:WhiteMolecular weight:4187.62Suc-Ala-Ala-Pro-Leu-pNA
CAS:Suc-AAPL-pNA, a sensitive substrate for human and especially porcine pancreatic elastases. Substrate for leucine endopeptidase from the psychrotropic bacillus B. cereus.Formula:C27H38N6O9Purity:99.2%Color and Shape:White PowderMolecular weight:590.63GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)
CAS:GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on the development of this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy.Formula:C149H226N40O45Purity:> 96%Color and Shape:WhiteMolecular weight:3297.68Ac-Asp-Glu-Val-Asp-chloromethylketone
CAS:Ac-DEVD-CMK irreversibly inhibits caspase-3. It is also active towards caspases-6, -7, -8, and -10.Formula:C21H31ClN4O11Purity:98.0%Color and Shape:White LyophilisateMolecular weight:550.95Amylin (20-29) (human)
CAS:Amylin (20-29) (or hIAPP 20-29) forms fibrils that are ultrastructurally identical to amyloid fibrils seen in pancreatic islets. The region SNNFGAILSS appears to be the most important amyloidogenic sequence of hIAPP (human islet amyloid polypeptide).Formula:C43H68N12O16Purity:> 96%Color and Shape:White PowderMolecular weight:1009.08H-Leu-OMe · HCl
CAS:Leu-OMe (LME) causes lysosomal disruption and death of human monocytes (M phi). In addition, LME removed natural killer cell (NK) activity from human peripheral mononuclear cells (PBM). During incubation of human lymphocytes with Leu-OMe, the dipeptide Leu-Leu-OMe which is responsible for the NK-toxicity, is formed.Formula:C7H15NO2·HClPurity:> 99%Color and Shape:WhiteMolecular weight:181.66GLP-2 (rat)
CAS:GLP-2 administration to mice or rats promotes stimulation of crypt cell proliferation and inhibition of enterocyte apoptosis resulting in hyperplasia of the small bowel villous epithelium. It also exerts trophic effects in animal models of both small and large bowel injury such as experimental small bowel resection or chemically induced colitis. In addition to stimulation of epithelial proliferation, GLP-2 also acutely regulates gastric emptying and exerts rapid metabolic effects promoting stimulation of intestinal hexose transport. The actions of GLP-2 are transduced via the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.Formula:C166H256N44O56SPurity: 95.5%Color and Shape:WhiteMolecular weight:3796.19



