GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(1,025 products)
- Adenosine Receptor(249 products)
- Adrenergic Receptor(3,002 products)
- Bombesin Receptor(35 products)
- Bradykinin Receptor(61 products)
- CXCR(154 products)
- CaSR(34 products)
- Cannabinoid Receptor(216 products)
- Cholecystokinin(1 products)
- Dopamine Receptor(445 products)
- Endothelin Receptor(86 products)
- GNRH Receptor(84 products)
- GPCR19(33 products)
- GRK(33 products)
- GTPase(23 products)
- Glucagon Receptor(192 products)
- Hedgehog/Smoothened(49 products)
- Histamine Receptor(385 products)
- LPA Receptor(21 products)
- Melatonin Receptor(26 products)
- OX Receptor(41 products)
- Opioid Receptor(325 products)
- PAFR(14 products)
- PKA(60 products)
- S1P Receptor(17 products)
- SGLT(31 products)
- Sigma receptor(46 products)
Show 19 more subcategories
Found 5966 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
NN1213
NN1213 (Peptide 21) is a long-acting human amylin peptide analogue that functions as a selective amylin receptor agonist. It has an EC50 of 0.177 nM for hAMY3R and 0.262 nM for rAMY3R. In both rat and dog models, NN1213 significantly reduces appetite and is utilized in anti-obesity research.Color and Shape:Odour SolidYM 218
CAS:YM 218 is a novel, potent, selective antagonist of nonpeptide vasopressin V1A receptor.Formula:C35H38F2N4O4Color and Shape:SolidMolecular weight:616.7Prolactin Releasing Peptide (1-31), human acetate
Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion.Formula:C162H26N56O44SColor and Shape:SolidMolecular weight:3724.17Methimepip dihydrobromide
CAS:Methimepip dihydrobromide is a selective H3R agonist.Formula:C10H19Br2N3Color and Shape:SolidMolecular weight:341.091Cannabinol methyl ether
CAS:Cannabinol methyl ether, a phytocannabinoid, serves as an analytical reference standard. This compound can be obtained through isolation from Cannabis plants, derived from cannabinol, or synthesized. The physiological and toxicological properties of cannabinol methyl ether remain unknown. It is designed exclusively for research and forensic applications.Formula:C22H28O2Color and Shape:SolidMolecular weight:324.5GLP-1R agonist 34
CAS:GLP-1R agonist 34 (Compound 1) is an orally active small molecule agonist of the glucagon-like peptide-1 receptor (GLP-1R). It enhances insulin secretion, suppresses glucagon release, and slows gastric emptying, thereby effectively reducing blood glucose levels. GLP-1R agonist 34 holds potential for research into metabolic disorders such as type 2 diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Formula:C50H50F2N10O5Color and Shape:SolidMolecular weight:908.99Cabergoline
CAS:Cabergoline (FCE-21336), an ergot-derived dopamine D2-like agonist, targets D2/D3/5-HT2B, normalizes prolactin, controls pituitary tumors.
Formula:C26H37N5O2Purity:97.69% - 99.86%Color and Shape:White Crystalline SolidMolecular weight:451.6Zenagamtide sodium
Zenagamtide is an agonist for both glucagon-like peptide-1 (GLP-1) and amylin receptors.Color and Shape:Odour SolidSC 45694
CAS:SC 45694 is a leukotriene B4 (LTB4) analog.Formula:C22H32LiO4Color and Shape:SolidMolecular weight:367.43LP-20
CAS:LP-20 is a bioactive chemical.Formula:C17H20N2OColor and Shape:SolidMolecular weight:268.35HGS101
HGS101 is a fully humanized CCR5 monoclonal antibody that exhibits high affinity for CCR5. It binds to the second extracellular loop (ECL-2) and functions as a signaling antagonist. HGS101 restores the inhibitory effect of Maraviroc in Maraviroc-resistant HIV-1 infected PBMCs. In an uninfected simian immunodeficiency virus model of rhesus monkeys, HGS101 shows anti-HIV activity by inhibiting CCR5 signaling.Color and Shape:Odour Liquidc(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm
CAS:c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm: potent, selective V2R agonist; EC50: 0.25 nM (hV2R), 0.05 nM (rV2R).Formula:C47H69ClN12O9S2Purity:98%Color and Shape:SolidMolecular weight:1045.71LY86057
CAS:LY86057 is a bioactive chemical.Formula:C20H26N2O3Color and Shape:SolidMolecular weight:342.439Δ9-THCH
CAS:Δ9-THCH, a phytocannabinoid analytical reference standard, is present in a Cannabis variety cultivated for medicinal use. In the United States, it is classified as a Schedule I compound. This product is designated for research and forensic applications.Formula:C22H32O2Color and Shape:SolidMolecular weight:328.49Canine KP-10
Canine KP-10 is a potent kisspeptin that induces a significant gonadotropin and estradiol response in female dogs during estrus.Color and Shape:Odour SolidL-692429 HCl
CAS:L-692,429 is a novel non-peptide growth hormone secretagin.Formula:C29H32ClN7O2Color and Shape:SolidMolecular weight:546.06GEP44
GEP44 is a peptide-biased triple agonist targeting the glucagon-like peptide-1 receptor (GLP-1R), neuropeptide Y1 receptor (Y1-R), and neuropeptide Y2 receptor (Y2-R). It induces GLP-1R-dependent insulin secretion in rat and human islets by offsetting the actions of Y1-R and GLP-1R agonism, controlled by Y1-R antagonists. Additionally, GEP44 enhances glucose uptake in muscle tissue through Y1-R mediation independent of insulin and significantly reduces food intake and body weight in diet-induced obese rat models. GEP44 is utilized in studies related to obesity and type 2 diabetes.Color and Shape:Odour SolidJMV3008
CAS:JMV3008 is a bioactive chemical.Formula:C36H39N7O3Color and Shape:SolidMolecular weight:617.74GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3850.31TNP-ATP tetrasodium
TNP-ATP is an antagonist of purinergic P2Y1, P2X3, and P2X2/3 receptors, exhibiting IC50 values of 6, 0.9, and 7 nM, respectively, in HEK293 cells expressing human receptors. It reduces acetic acid-induced calcium flux in 1321N1 cells expressing P2X3 and P2X2/3 receptors with IC50 values of 100 and 62 nM, respectively. TNP-ATP also dose-dependently alleviates acetic acid-induced writhing responses in a visceral pain model in mice, with an ED50 of 6.35 µmol/kg.Color and Shape:Odour Solid
