GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(1,024 products)
- Adenosine Receptor(249 products)
- Adrenergic Receptor(3,030 products)
- Bombesin Receptor(35 products)
- Bradykinin Receptor(61 products)
- CXCR(159 products)
- CaSR(34 products)
- Cannabinoid Receptor(217 products)
- Cholecystokinin(1 products)
- Dopamine Receptor(443 products)
- Endothelin Receptor(86 products)
- GNRH Receptor(84 products)
- GPCR19(33 products)
- GRK(33 products)
- GTPase(22 products)
- Glucagon Receptor(196 products)
- Hedgehog/Smoothened(49 products)
- Histamine Receptor(385 products)
- LPA Receptor(21 products)
- Melatonin Receptor(26 products)
- OX Receptor(42 products)
- Opioid Receptor(326 products)
- PAFR(14 products)
- PKA(53 products)
- S1P Receptor(17 products)
- SGLT(31 products)
- Sigma receptor(46 products)
Show 19 more subcategories
Found 5981 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PY-60
CAS:<p>PY-60 can effectively activate YAP transcriptional activity against annexin A2 (ANXA2).Cost-effective and quality-assured.</p>Formula:C16H15N3O2SPurity:99.5% - 99.67%Color and Shape:SolidMolecular weight:313.37Dipentylone hydrochloride
CAS:Dipentylone hydrochloride (Bk-dmbdp HCl) is a psychoactive synthetic cathinone and sympathomimetic stimulant. Its inhibitory activity towards the dopamine transporter (IC50=0.233µM) is tenfold higher than that towards NET and SERT, inhibiting dopamine uptake and stimulating locomotor activity in mice.Formula:C14H20ClNO3Purity:99.94%Color and Shape:SolidMolecular weight:285.77SB-408124
CAS:SB408124: Non-peptide, OX1 receptor antagonist, Ki 57 nM (whole cell) and 27 nM (membrane), 50x more selective than OX2.Formula:C19H18F2N4OPurity:99.81%Color and Shape:SolidMolecular weight:356.378-iso Prostaglandin E1
CAS:<p>8-iso Prostaglandin E1 causes spasm in the pulmonary veins of dogs and also acts as a vasodilator.</p>Formula:C20H34O5Color and Shape:Light Yellow Crystalline SolidMolecular weight:354.48Syk Inhibitor II hydrochloride
CAS:<p>Syk signaling is key in lupus. Syk inhibitors reduce inflammation and sepsis severity in FcgRIIb-/- mice, lowering cytokines and organ damage.</p>Formula:C14H16ClF3N6OPurity:99.05%Color and Shape:SolidMolecular weight:376.77Galanin (1-15) (porcine, rat)
CAS:N-terminal galanin fragment used to mediate central cardiovascular effectsFormula:C72H105N19O20Purity:98%Color and Shape:SolidMolecular weight:1556.728-iso-15-keto Prostaglandin F2α
CAS:8-iso-15-keto Prostaglandin F2α (8-iso-15-keto PGF2α) is a metabolite of the isoprostane 8-iso PGF2α in rabbits, monkeys, and humans.Formula:C20H32O5Color and Shape:SolidMolecular weight:352.471Prostaglandin F1α
CAS:Prostaglandin F1α (PGF1α) is a lipid mediator and an endogenous metabolite of prostacyclin, regulate smooth muscle contraction.Formula:C20H36O5Color and Shape:SolidMolecular weight:356.5LY 344864 racemate
CAS:LY 344864 racemate is a 5-HT1F receptor agonist.Formula:C21H22FN3OPurity:99.75%Color and Shape:SoildMolecular weight:351.42JNJ-10181457 (hydrochloride)
CAS:JNJ-10181457 (hydrochloride) is a non-imidazole H3 receptor antagonist that is brain-penetrating and selective, increasing NE and acetylcholine concentrationsFormula:C20H30Cl2N2OColor and Shape:SolidMolecular weight:385.37Seglitide
CAS:Peptide agonist targets sst2/sst5 receptors. IC50/Kd: sst1 >1000, sst2 = 0.2-1.5, sst3 = 27-36, sst4 >127, sst5 = 0.06-23 nM.Formula:C44H56N8O7Purity:98%Color and Shape:SolidMolecular weight:808.98Meluadrine tartrate
CAS:Meluadrine tartrate is an endogenous metabolite.Formula:C16H24ClNO8Purity:98%Color and Shape:SolidMolecular weight:393.82GHRF, porcine
CAS:GHRF, porcine, a growth hormone releasing factor (GHRF) peptide (porcine), binds to the growth hormone secretagogue receptor (GHSR), thereby inducing theFormula:C219H365N73O66SColor and Shape:SolidMolecular weight:5108.76(-)-Eseroline fumarate
CAS:(-)-Eseroline fumarate, a Physostigmine metabolite and AChE inhibitor, triggers cancer cell LDH release and neuronal cell death.Formula:C17H22N2O5Color and Shape:SolidMolecular weight:334.37Hemokinin 1, human TFA
Hemokinin-1 is a human TFA and selective NK1 agonist; also activates NK2 & NK3 and induces opioid-independent analgesia.Formula:C56H85F3N14O16SColor and Shape:SolidMolecular weight:1299.42Cortistatin-14 acetate
<p>Cortistatin-14 acetate, a neuropeptide have structural similarity to somatostatin-14, binds and exerts its function via the somatostatin receptors (sst1-sst5).</p>Formula:C83H118N20O20S2Purity:98.24% - 99.63%Color and Shape:SoildMolecular weight:1780.08Guanylate cyclase-IN-1
CAS:Guanylate cyclase-IN-1 (Example 46) is a specific inhibitor of guanylate cyclase, employed in research related to cardiovascular diseases.Formula:C20H17FN8OColor and Shape:SolidMolecular weight:404.409IRL-1038
CAS:<p>ETB endothelin receptor antagonist</p>Formula:C68H92N14O15S2Purity:98%Color and Shape:SolidMolecular weight:1409.67Ecnoglutide
CAS:Ecnoglutide (XW003) is a glucagon-like peptide 1 (GLP-1) receptor agonist [1] .Formula:C194H304N48O61Color and Shape:SolidMolecular weight:4284.76FR167344 free base
CAS:FR167344 free base: oral, nonpeptide B2 bradykinin receptor antagonist, high-affinity (IC50: 65 nM), no B1 affinity.Formula:C30H28BrCl2N5O4Purity:98%Color and Shape:SolidMolecular weight:673.38Utreglutide
CAS:Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formula:C191H298N46O58Color and Shape:SolidMolecular weight:4166.67Neuropeptide W-30 (rat)
CAS:Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3].Formula:C165H249N49O38SColor and Shape:SolidMolecular weight:3559.11AZ7976
CAS:AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].Formula:C30H33F7N2O6SColor and Shape:SolidMolecular weight:682.65PACAP (1-38) free acid TFA
PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrinColor and Shape:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3692.15CCK (26-30) (sulfated)
CAS:CCK (26-30) is a digestive and satiety-related peptide fragment inhibiting [125I]CCK-33 binding by 10% at 0.1 mM.Formula:C33H41N7O12S2Color and Shape:SolidMolecular weight:791.85LGnRH-III, lamprey
CAS:GnRH III triggers luteinizing and follicle-stimulating hormone release, part of the conserved GnRH family.Formula:C59H74N18O14Purity:98%Color and Shape:SolidMolecular weight:1259.33(D-Ser4,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Analog of LHRH, stimulates LH and FSH release, controls reproduction.</p>Formula:C59H84N18O14Color and Shape:SolidMolecular weight:1269.41Dexchlorpheniramine free base
CAS:Dexchlorpheniramine Maleate, a histamine receptor antagonist, is used to treat urticaria, allergic rhinitis, allergic conjunctivitis and pruritus.Formula:C16H19ClN2Purity:98%Color and Shape:Oily Liquid SolidMolecular weight:274.79Ebiratide
CAS:Ebiratide is an analog of ACTH 4-9.Formula:C48H73N11O10SPurity:98%Color and Shape:SolidMolecular weight:996.23MI 1544
CAS:MI 1544 is a LHRH antagonist.Formula:C71H94ClN17O13Color and Shape:SolidMolecular weight:1429.09K41498
CAS:Potent CRF2α/β antagonist; Ki: 0.66/0.62 nM, weak for CRF1 (425 nM). Blocks sauvagine in hCRF2 cells and urocortin hypotension in rats.Formula:C162H276N48O46Purity:98%Color and Shape:SolidMolecular weight:3632.26SAE-14
CAS:GPR183, a chemotactic receptor aiding B cell maturation, binds 7α,25-OHC; studied in IBD research.Formula:C19H19F3N2O2Purity:99.85%Color and Shape:SolidMolecular weight:364.36[Des-Arg10]-HOE I40 TFA
<p>[Des-Arg10]-HOE I40 TFA is a potent antagonist of the bradykinin B1 receptor.</p>Formula:C53H77N15O12S·xC2HF3O2Color and Shape:Solid(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat)
CAS:(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat) is a corticotropin-releasing factor (CRF) antagonist known to counteract the inhibitory effects of IL-1aFormula:C159H267N49O43Color and Shape:SolidMolecular weight:3553.12Uroguanylin (human) TFA
Uroguanylin (human) (TFA) is the natural ligand for the guanylate cyclase C (GCC) receptor expressed in metastatic colorectal cancer tumors. In animal models of human colon cancer, Uroguanylin (human) (TFA) demonstrates antitumor activity.Color and Shape:Odour SolidMrgprX2 antagonist-4
CAS:MrgprX2 antagonist-4, from patent US20210128561A1, inhibits MrgprX2 receptor; useful for skin inflammation studies.Formula:C16H19N3OColor and Shape:SolidMolecular weight:269.348Neuropeptide Y (2-36) (porcine)
CAS:Porcine Neuropeptide Y (2-36) is 97.14% similar to rat/human, an agonist for Y5, Y2, Y1 receptors, used in obesity research.Formula:C181H278N54O55Color and Shape:SolidMolecular weight:4090.47Pasireotide (diaspartate)
CAS:Pasireotide diaspartate (SOM230) has high agonist activity at sst1/2/3/5, less at sst4; it's antiproliferative and proapoptotic.Formula:C66H80N12O17Color and Shape:SolidMolecular weight:1313.41S1P2 antagonist 1
CAS:S1P2 antagonist 1 is an orally bioavailable S1P2 antagonist against fibrotic diseases.Formula:C23H21ClN4O4Color and Shape:SolidMolecular weight:452.9N6-Benzyl-5'-ethylcarboxamido adenosine
CAS:N6-Benzyl-5'-ethylcarboxamido adenosine is a selective A3 adenosine receptor agonist.Formula:C19H22N6O4Color and Shape:SolidMolecular weight:398.42Cyclosomatostatin TFA
Cyclosomatostatin TFA blocks SST receptor, reduces CRC cell growth, ALDH+ size, and sphere-formation.Formula:C46H58F3N7O8Color and Shape:SolidMolecular weight:893.99(Trp7,β-Ala8)-Neurokinin A (4-10)
CAS:(Trp7,β-Ala8)-Neurokinin A (4-10) is a potent neurokinin-3 (NK3) antagonist [1] .Formula:C41H57N9O10SColor and Shape:SolidMolecular weight:868.01Asenapine citrate
CAS:Asenapine citrate: atypical antipsychotic for schizophrenia, bipolar disorder; targets serotonin, adrenoceptors, dopamine, histamine (pKi: 8.2-10.5).Formula:C23H24ClNO8Color and Shape:SolidMolecular weight:477.89Adrenomedullin (16-31), human TFA
Human adrenomedullin (16-31) TFA, fragment 16-31, binds CGRP1 receptor, raises rat blood pressure, not cats’.Formula:C84H130F3N25O23S2Color and Shape:SolidMolecular weight:1979.21Cagrilintide acetate
.Cagrilintide is a long-acting amylin analog,treat diabetes and obesity by reducing appetite through activation of the AMY3R and calcitonin receptor.Formula:C196H316N54O61S2Purity:99.88%Color and Shape:SolidMolecular weight:4469.06Antidepressant agent 4
Antidepressant agent 4: orally active, has antidepressant, anxiolytic, and nootropic effects.Formula:C19H38ClN5O2SColor and Shape:SolidMolecular weight:436.06VU0453379 hydrochloride
VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.Formula:C26H35ClN4O2Color and Shape:SolidMolecular weight:471.03L-770644
CAS:L-770644 is an agonist of B3 adrenergic receptor.Formula:C30H37N7O4SColor and Shape:SolidMolecular weight:591.72Orexin A (human, rat, mouse)
CAS:Orexin A, a 33 AA neuropeptide in humans, rats, mice, influences various processes, studied in pancreatic function and as an OX1R antagonist.Formula:C152H243N47O44S4Purity:98%Color and Shape:SolidMolecular weight:3561.1
