Carboxylic Acids

<p>Neuropeptide Y (18-36) trifluoroacetate salt H-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg -Gln is a peptide belonging to the family of neuropeptides. It has been shown to have potent vasoconstricting activity in rat and guinea pig hearts, as well as contractile activity in rat aortic rings. Neuropeptide Y (18 - 36) trifluoroacetate salt H -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifl uoroacetate salt also inhibits the cyclase activity of adenylate cyclase, which is responsible for generating the second messenger cAMP. This compound may be used to treat congest</p>

<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>

<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>

<p>Please enquire for more information about 4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sodium fluoroacetate is a salt that is synthesized by the reaction of methyl ethyl and sodium trifluoroacetate. It has been used as an insecticide, but also has been used to treat metabolic disorders such as bowel disease and eye disorders. Sodium fluoroacetate also has been used in natural products for the treatment of autoimmune diseases. The toxicological studies of sodium fluoroacetate have shown that it can cause eye disorders and x-ray crystal structures have revealed its mechanism of action.</p>

<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br&gt;br&gt;<br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>

<p>Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>

<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Erythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.</p>

<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>

<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br&gt;<br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>

<p>Please enquire for more information about (R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>

<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>

<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>

<p>Magnesium acetate anhydrous is the magnesium salt of acetic acid and has been used as a polymerase chain reaction (PCR) buffer for DNA amplification. This product is also used in wastewater treatment to remove organic acids and carbonates from water. Magnesium acetate anhydrous has been shown to have a Langmuir adsorption isotherm that can be described by a single-site binding model with a Kd value of 2.8x10-2 M. The compound was found to bind to liver cells, which may be due to its hydroxyl group on the central atom of the molecule. Magnesium acetate anhydrous has been shown to have electrochemical impedance spectroscopy properties at Ω=1 MΩ-1, which are indicative of ionic conductivity and good chemical stability.</p>

<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>

<p>3,4,9,10-Perylenetetracarboxylic dianhydride is a dianhydride that is used in the production of polyesters. It has been shown to form herringbone structures when it is heated and forms kinetic energy. The formation of these structures can be induced by laser ablation. 3,4,9,10-Perylenetetracarboxylic dianhydride also has a redox potential that is more positive than most other organic compounds. This compound can undergo intermolecular hydrogen bonding with glycol ethers and copper chloride and can react with nitrogen atoms to produce photocurrent in model systems. 3,4,9,10-Perylenetetracarboxylic dianhydride also has hydroxyl groups that are important for the biosynthesis of fatty acids.</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>

<p>Please enquire for more information about 2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Trifluoromethyl)phenylacetic acid is an isoquinoline alkaloid that has been found to have anti-inflammatory properties. It was shown to inhibit TNF-α production in mice with colitis, reducing the severity of the disease. 3-(Trifluoromethyl)phenylacetic acid can be administered orally, and it is metabolized reductively by dihydroisoquinoline reductase enzymes. The drug's pharmacokinetics are not well understood, but it is thought to be a substrate for CYP3A4 and P-glycoprotein. 3-(Trifluoromethyl)phenylacetic acid has been studied as a potential antiviral agent and systemic inflammatory response inhibitor.</p>

<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6-Maleimidocaproic acid N-hydroxysuccinimide ester (6MCA-NHS) is a fluorescent probe that reacts with the hydroxyl group of fatty acids in human serum and other biological samples. 6MCA-NHS binds to the carboxylic acid group at the end of a fatty acid molecule, forming a covalent bond. This process generates light emission that can be detected by a fluorescence probe to measure changes in pH or other chemical properties within the solution. 6MCA-NHS has been used as a tumor treatment, where laser ablation is used to break up tumor cells and release 6MCA-NHS into the cytoplasm. The drug can then bind to DNA molecules and inhibit protein synthesis, which results in cell death.</p>

<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Salusin-alpha (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Keto-4-etiocholenic acid is a type of fatty acid that is naturally found in the human body. It is produced by the oxidation of other types of fatty acids and is an intermediate in the synthesis of sex hormones. 3-Keto-4-etiocholenic acid can be synthesized by recombinant methods, which are used to produce proteins for research purposes. It has been shown to have cytostatic effects, which may be due to its irreversible inhibition of enzymes involved in biological function.</p>

<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>

<p>Ethoxyiminoacetic acid ethyl ester is an annulated, lactam-containing compound that is synthesized via the condensation of ethyl thiooxamate and carboxylic acid. This drug has been shown to be efficient in inhibiting the growth of bacteria that are resistant to antibiotics such as polycyclic, triazoles, and condensates. It also inhibits protein synthesis by binding to bacterial DNA gyrase and topoisomerase IV. Ethoxyiminoacetic acid ethyl ester has shown significant antimicrobial activity against Gram-positive bacteria such as streptococci and staphylococci.</p>

<p>Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a peptide hormone that may act as a neurotransmitter or neuromodulator. It is one of the most important vasoconstrictor and aldosterone-secreting hormones produced by the renin-angiotensin system in mammals. Angiotensin II has been shown to stimulate cardiac contractility, increase vascular resistance, and regulate blood pressure. The effect of Angiotensin II on cardiac contractility is mediated through its binding to a response element in the promoter region of genes encoding for Ca2+ channels. This binding leads to increased Ca2+ influx into cardiac cells and increased myofibrillar Ca2+ sensitivity. Angiotensin II also activates reactive oxygen species (ROS) production, which causes injury to the renal tubular epithelium and induces tubulointerstitial injury in rats with diabetes. It also stimulates squamous cell carcinoma growth by inducing reactive oxygen species (ROS) production and activating signal trans</p>

<p>Please enquire for more information about A-VI-5 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Methyl-1H-imidazole-5-carboxylic acid is an amide that is used as a hardener in medicines. It can be synthesized by the reaction of ethyl formate with thionyl chloride and imidazoles. The yield of this product is high, and it can be produced in different stereoisomeric forms. 1-Methyl-1H-imidazole-5-carboxylic acid is used to produce other medicines, such as painkillers, tranquilizers, diuretics, and antibiotics. This product has been shown to have a number of health benefits, including reducing cholesterol levels and blood pressure.</p>

<p>Please enquire for more information about tert-Butyl 4,7-diazaspiro[2.5]octane-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Etiroxate carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-(Carboxymethyl)-4,5-dimethoxybenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The process development of 4-fluoro-2-(trifluoromethyl)phenylboronic acid (4FTFPBA) is a simplified procedure that can be scaled up and used for medicinal chemistry. This compound was synthesized by a boronic acid process using the Suzuki-Miyaura cross coupling reaction. The major factor to consider in this synthesis is the placement of the fluorine atom, which determines the relative reactivity and stability of the compound. In order to mimic these factors, an environment with low water content and a sequence that minimizes exposure to air are required.</p>

<p>Neuropeptide EI is a cyclic peptide that has been shown to have receptor activity in the caudate putamen, as well as locomotor activity and metabolic rate. Neuropeptide EI has also been shown to inhibit lymphatic vessels and amide sequences in fat cells. It has been shown to have various biological functions, such as an anti-inflammatory agent, an analgesic, and a chemotherapeutic agent. It is active against cancer cells and autoimmune diseases, but is inactive against bacteria.</p>

<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-(2'-N-Boc-hydrazino)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CART (62-76) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>

<p>Please enquire for more information about [4-(1-Cyano-1-methylethyl)phenyl]boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SPARC (119-122) (mouse) is an acetate salt of H-Lys-Gly-His-Lys-OH. SPARC (119-122) has been shown to be a mimetic of the c-terminal region of the protein SPARC and can bind to many metal ions including Zn2+, Mn2+, Cu2+, Co2+, Ni2+ and Mg2+. The binding affinity for these metals is dose dependent, with saturation occurring at high concentrations. This property may make this compound a therapeutic target for drug discovery strategies.</p>

<p>(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.</p>

<p>(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt H-Ala-Tyr-Pro-Gly-Lys-Phe-OH trifluoroacetate salt is a potent inhibitor of protein kinase C, and has been shown to inhibit the growth of prostate cancer cells. It also inhibits phosphorylation of epidermal growth factor receptors, which leads to lower levels of epidermal growth factor in the cell. This drug also has antiplatelet effects and may be used as an antiplatelet agent for patients with vascular disease or diabetes.</p>

<p>Please enquire for more information about Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys<br>The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.</p>

<p>Trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate (CDTA) is a chelating agent that has been shown to be effective in the treatment of some cancers. CDTA has been shown to inhibit the growth of tumor cells by binding to lysine residues on histones and DNA and inhibiting their acetylation. CDTA also prevents the genotoxicity induced by irradiation. CDTA can be used as an adjuvant in cancer therapy due to its ability to inhibit histone deacetylase activity. Trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate is synthesized from two amino acids: lysine and glutamic acid. This molecule is a polymeric compound composed of cyclic molecules linked together through amide bonds. These polymers are linear chains of</p>

<p>Parathyroid hormone (PTH) is a peptide hormone that regulates calcium and phosphate balance in the body. PTH is secreted by the parathyroid glands, located near the thyroid gland in the neck. It is also known as parathormone or parathyrin. The active form of PTH, called pTH (1-34) amide, has been shown to stimulate bone resorption and to inhibit bone formation. The amino acid sequence of this hormone starts with arginine and ends with phenylalanine. The N-terminal amino acid residue is an aspartic acid or asparagine and histidine is the only basic residue in this molecule. This molecule has two acidic residues, glutamic acid and aspartic acid, which are found on the side chains of two amino acids: aspartic acid and glutamic acid. Valine is found at position 3 and phenylalanine at position 34.</p>

<p>Please enquire for more information about (N-Me-Phe7)-Neurokinin B trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>

<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>

<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>

<p>2-Chlorophenylboronic acid is a diphenyl ether that can be used as a building block for the synthesis of benzodiazepine receptor ligands. It has been shown to be an efficient nucleophile, leading to the formation of carbonyl groups in the presence of halides. 2-Chlorophenylboronic acid has also been shown to inhibit p38 kinase activity and may be useful for anticancer therapy.</p>

<p>3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is a reagent that is used as a reactant in organic synthesis. It is also useful as a scaffold for the synthesis of heterocycles and other complex compounds. 3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is used in research chemical synthesis and as a versatile building block for the production of fine chemicals. This chemical can be used to create products such as pharmaceuticals, pesticides, and cosmetics.</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>

<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>

<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>a-(Trichloromethyl)benzyl acetate is an organic compound with the formula CHClCOCH. It is a colorless liquid which is soluble in organic solvents. This compound exhibits oxidative carbonylation activity, and has been shown to be used for the coating of particles, detergent compositions, and analytical methods. The microcapsules are prepared by encapsulating a fatty acid in a glycol ether. The health effects of this compound are not well understood but it is believed that it may have some carcinogenic properties.</p>

<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>

<p>Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Chlorooxazole-4-carboxylic acid is a synthetic compound belonging to the group of long-chain aliphatic carboxylic acids. It is an ester that can be synthesized by the reaction of toluene with 2,4-dichlorooxazole. The stereochemical configuration of this molecule is unknown. The synthesis of this compound has been reported in marine invertebrates and plants, including Mycalolide from the marine sponge Mycale sp.</p>

<p>Dibenzoyl-(-)-p-methoxy-L-tartaric acid is a chiral compound that has been extracted from plants and synthesized. It has a bitter taste and can be used as an enantiomer to treat schistosomiasis, a disease caused by parasitic flatworms. Dibenzoyl-(-)-p-methoxy-L-tartaric acid can be used as an enantiomer to treat schistosomiasis, which is caused by parasitic flatworms. The chemical is an anionic β-cyclodextrin derivative that binds to the parasites in the host's body and prevents them from releasing eggs into the water supply. This chemical also has pharmacological properties, such as antiinflammatory activities.</p>