
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
2,4-Dinitrophenylacetic acid
CAS:<p>2,4-Dinitrophenylacetic acid is a chemical substance with the potential to inhibit acetylation. It can be used as an antigen and has been detected in environmental chemistry. 2,4-Dinitrophenylacetic acid is produced by the reaction of chemicals that are found in the environment and it can be detected at low concentrations. This compound is able to react with proteins in cells, leading to high cytotoxicity. 2,4-Dinitrophenylacetic acid can also stabilize optical systems.</p>Formula:C8H6N2O6Purity:Min. 95%Color and Shape:PowderMolecular weight:226.14 g/mol3-Bromophenyl boronic acid
CAS:<p>3-Bromophenyl boronic acid is a group P2 molecule with functional groups of vibrational and cross-coupling. It has been shown to inhibit the activity of aryl boronic acids, which are commonly used in analytical methods. 3-Bromophenyl boronic acid is also capable of inhibiting the production of alizarin, which is a dye that is used for staining biological tissue. The molecular modeling study revealed that this molecule has an atomic orbital with electron density distribution around the central carbon atom. This distribution indicates that it is more stable than other molecules with similar structures.</p>Formula:C6H6BBrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:200.83 g/molFmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid
CAS:<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>Formula:C23H27NO5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:397.46 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Molecular weight:555.63H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>Formula:C40H58N10O7SPurity:Min. 95%Molecular weight:823.02 g/molGambogic acid
CAS:<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>Purity:Min. 95%Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate
CAS:<p>Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate is a metabotropic glutamate receptor antagonist. It blocks the glutamate receptor and prevents the transmission of nerve impulses in the central nervous system. This drug is used to treat neurological disorders such as anxiety, depression, and schizophrenia. Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate has been shown to have a number of side effects including drowsiness, nausea, dizziness and headache.</p>Formula:C11H10O3Purity:Min. 95%Molecular weight:190.2 g/molLinoleic acid - powder
CAS:<p>Linoleic acid is a polyunsaturated fatty acid that is an important component of cell membranes. It has been shown to inhibit oxidative injury and improve mitochondrial functions. Linoleic acid also has a role in energy metabolism, as it is the precursor for biosynthesis of eicosanoids and arachidonic acid. The physiological effects of linoleic acid have been studied using a model system consisting of isolated rat adipose tissue and mitochondria. This model system has been used to investigate the inhibitory properties of linoleic acid on caproic acid-induced lipid peroxidation. Linoleic acid has also been shown to have anion radical scavenging activity when in the presence of iron. This compound can be analyzed using gas chromatography-mass spectrometry (GC-MS) based on its chemical composition, which consists mainly of linear 18-carbon chains with two double bonds at positions 9 and 12.</p>Formula:C18H32O2Purity:Min. 95%Color and Shape:PowderMolecular weight:280.45 g/molAnxiety Peptide acetate salt
CAS:<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>Formula:C81H138N24O29Purity:Min. 95%Molecular weight:1,912.11 g/molH-Gly-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O2·C2H4O2Purity:Min. 95%Molecular weight:281.31 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/moltert-Butyl allylcarbamate
CAS:<p>Tert-Butyl allylcarbamate is a fluorinated, reactive compound that has been used in the synthesis of amines and phosphazenes. Tert-Butyl allylcarbamate is an intermediate for the synthesis of isophthalaldehyde, which can be used to produce polymers and other organic compounds. The reaction rate of tert-butyl allylcarbamate is inhibited by phosphazene, which also inhibits polymerization. Tert-Butyl allylcarbamate has been shown to inhibit transfer reactions involving functional groups such as allylamine, silicon, and fluoroalkyl.</p>Formula:C8H15NO2Purity:Min. 95%Molecular weight:157.21 g/molMaxadilan trifluoroacetate salt
CAS:<p>Maxadilan trifluoroacetate salt is a low-potency drug that binds to the GABA receptor and affects the central nervous system. Maxadilan trifluoroacetate salt is structurally related to leishmaniasis, an infectious disease caused by protozoa of the genus Leishmania. Maxadilan trifluoroacetate salt has been shown to prevent the development of autoimmune diseases in mice, including systemic lupus erythematosus, experimental autoimmune encephalomyelitis, and collagen-induced arthritis. Maxadilan trifluoroacetate salt has also been shown to be effective against cutaneous lesions in mice infected with Leishmania major. The mechanism of action is not yet known but may be due to its ability to influence mitochondrial membrane potential or fatty acid metabolism.</p>Formula:C291H466N86O94S6Purity:Min. 95%Molecular weight:6,865.73 g/mol((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt
CAS:<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H60N10O15S2Purity:Min. 95%Molecular weight:1,177.27 g/molGAP 27 acetate salt
CAS:<p>GAP 27 is a connexin that is expressed in the cardiac and skin cells. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile-OH acetate salt is made up of a number of amino acids, including serine, arginine, proline, glutamic acid, lysine, threonine and isoleucine. It has been shown to have biological function in vivo models and in vitro assays. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr--Ile--Phe--Ile--Ile--OH acetate salt has been shown to be non toxic to the heart and skin cells. This protein also shows growth factor activity when it interacts with toll like receptor 4 (TLR4) on human skin cells.</p>Formula:C60H101N15O17Purity:Min. 95%Molecular weight:1,304.53 g/mol2-Chloropyridine-4-boronic acid
CAS:<p>2-Chloropyridine-4-boronic acid is a nicotinic acetylcholine receptor antagonist that has been shown to be effective against trypanosomiasis. It blocks the binding of acetylcholine to its receptor, which prevents the propagation of an action potential in the postsynaptic cell. 2-Chloropyridine-4-boronic acid inhibits the enzymes cyclooxygenase and prostaglandin synthase, which are involved in inflammation. 2-Chloropyridine-4-boronic acid is potent and selective for nicotinic acetylcholine receptors, but it also binds to other sites on the enzyme. The molecular modeling studies have shown that this compound has a pharmacophore that can be used as a guide for drug design.</p>Formula:C5H5BClNO2Purity:Min. 95%Molecular weight:157.36 g/mol(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Controlled Product<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2·C12H23NPurity:Min. 95%Molecular weight:370.53 g/mol(D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/mol(Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molTRAP-5 trifluoroacetate salt
CAS:<p>TRAP-5 is a peptide consisting of the amino acid sequence H-Ser-Phe-Leu-Leu-Arg. This peptide has been shown to have antiviral, anti-inflammatory, and anticancer properties. It has also been found to inhibit platelet activation in vitro and to reduce atherosclerotic lesions in mice. TRAP-5 has been shown to have therapeutic potential for diseases such as heart disease and lung diseases, although its efficacy has not yet been tested in humans.</p>Formula:C30H50N8O7Purity:Min. 95%Molecular weight:634.77 g/mol(Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H60N10O8Purity:Min. 95%Molecular weight:796.96 g/mol1-Methyl-1H-imidazole-5-carboxylic acid
CAS:<p>1-Methyl-1H-imidazole-5-carboxylic acid is an amide that is used as a hardener in medicines. It can be synthesized by the reaction of ethyl formate with thionyl chloride and imidazoles. The yield of this product is high, and it can be produced in different stereoisomeric forms. 1-Methyl-1H-imidazole-5-carboxylic acid is used to produce other medicines, such as painkillers, tranquilizers, diuretics, and antibiotics. This product has been shown to have a number of health benefits, including reducing cholesterol levels and blood pressure.</p>Formula:C5H6N2O2Purity:Min. 95%Molecular weight:126.11 g/mol(+)-3-Bromo-10-camphorsulfonic acid monohydate
CAS:<p>Please enquire for more information about (+)-3-Bromo-10-camphorsulfonic acid monohydate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H15BrO4S•H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:329.21 g/moltert-Butyl 4,7-diazaspiro[2.5]octane-4-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 4,7-diazaspiro[2.5]octane-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%BNP-32 (rat) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C146H239N47O44S3Purity:Min. 95%Molecular weight:3,452.95 g/molAmyloid β-Protein (1-38) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H277N51O56SPurity:Min. 95%Molecular weight:4,131.54 g/molEndothelin-2 (human, canine) acetate
CAS:<p>Acetate salt</p>Formula:C115H160N26O32S4Purity:Min. 95%Molecular weight:2,546.92 g/molH-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>Formula:C20H35N9O10SPurity:Min. 95%Molecular weight:593.61 g/molPAR-2 (1-6) (human) trifluoroacetate salt
CAS:<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/mol(Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt
CAS:<p>Please enquire for more information about (Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H75N13O9Purity:Min. 95%Molecular weight:918.14 g/molMonocyte Chemotactic Protein-1 (human) acetate salt
CAS:<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C379H610N108O114S5Purity:Min. 95%Molecular weight:8,663.89 g/molH-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS:<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>Formula:C30H44N8O4Purity:Min. 95%Molecular weight:580.72 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Formula:C81H156N10O13SPurity:Min. 95%Molecular weight:1,510.23 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Formula:C148H239ClN44O42Purity:Min. 95%Molecular weight:3,342.21 g/mol(Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H283N51O53SPurity:Min. 95%Molecular weight:4,125.63 g/mol(Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Formula:C50H73N13O11Purity:Min. 95%Molecular weight:1,032.2 g/molEthyl 2,4-dichloropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Ethyl 2,4-dichloropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H6Cl2N2O2Purity:Min. 95%Molecular weight:221.04 g/molAQEE-30 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H245N47O56Purity:Min. 95%Molecular weight:3,674.9 g/mol2-Pyridineboronic acid
CAS:<p>2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.</p>Formula:C5H6BNO2Purity:Min. 95%Molecular weight:122.92 g/molEpinecidin-1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C114H176N30O21SPurity:Min. 95%Molecular weight:2,334.87 g/molMethyl-N,N-diethyldithiocarbamate
CAS:<p>Methyl-N,N-diethyldithiocarbamate is a copper complex that reacts with nitrogen atoms to form a stable chemical species. It has been shown to have cancer-fighting properties and is used in the treatment of liver cancer. Methyl-N,N-diethyldithiocarbamate also acts as an anti-inflammatory agent. The mechanism of action of methyl-N,N-diethyldithiocarbamate is not fully understood, but it has been suggested that this compound binds to p450 enzymes and inhibits their activity. This drug may also inhibit the production of carbon disulphide (CS2) by the liver microsomes and the elimination rate of methyl-N,N-diethyldithiocarbamate from rat livers.</p>Formula:C6H13NS2Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:163.31 g/molNeuropeptide AF (human) trifluoroacetate salt
CAS:<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>Formula:C90H132N26O25Purity:Min. 95%Molecular weight:1,978.17 g/molAmyloid β-Protein (1-40) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molPAR-2 (1-6) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 agonist is a synthetic peptide that activates PAR-2. It binds to PAR-2 receptors, which are present in the mesenteric vasculature and in various other tissues. Activation of PAR-2 leads to an increase in intracellular calcium concentration, activation of protein kinase C, cytosolic calcium ion release, phosphorylation of myosin light chain, muscle cell proliferation, transcription and translation initiation, and increased production of vasoactive intestinal peptide. This drug also has anti-inflammatory effects and stimulates epidermal growth factor (EGF) and thrombin receptor expression as well as growth factor production.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/mol3-(2-Cyanopropan-2-yl)benzoic acid
CAS:<p>Please enquire for more information about 3-(2-Cyanopropan-2-yl)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2Purity:Min. 95%Molecular weight:189.21 g/molMethyl 4-tert-butylphenylacetate
CAS:<p>Methyl 4-tert-butylphenylacetate is a chemical compound that has been used in various research collaborations. It is also used as a solvent for the production of octanoic acid and isobutyric acid, which are important chemical compounds for use in the food industry. The utilisation of methyl 4-tert-butylphenylacetate has been studied by researchers in relation to its maltol, levulinate and hexanoic acid derivatives. This compound can be used as a replacement for other chemicals such as sulfate, butanedione and propylene glycol in industrial applications.</p>Formula:C13H18O2Purity:Min. 95%Molecular weight:206.28 g/molH-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-OH acetate salt is a protease inhibitor. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, in vitro. H-Arg-Arg-OH acetate salt binds to the active site of the enzyme and prevents substrate binding. The acidity of the environment where this inhibitor is active can be used to control its activity. At acidic pH, H-Arg-Arg-OH acetate salt is more potent than at neutral pH. When it comes into contact with a protein substrate, H-Arg-Arg-OH acetate salt will bind to a hydroxyl group on the protein molecule and prevent it from hydrolyzing its substrate. This process can be reversed by adding an alkaline buffer to increase the pH of the system or by adding an acid buffer to decrease it.br>br> H-Arg-Arg-OH acetate salt is found in cyanob</p>Formula:C12H26N8O3Purity:Min. 95%Molecular weight:330.39 g/mol(His(1-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(1-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13Purity:Min. 95%Molecular weight:1,196.32 g/mol5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid
CAS:<p>5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid is a chemical compound that is used in the formylation of amines to produce formamides. It has been optimized for industrial production by optimizing reaction time, formylation conditions, and solvents. It has also been shown that 5-formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid produces good yields and high product purity.</p>Formula:C8H9NO3Purity:Min. 95%Molecular weight:167.16 g/molBoc-trans-4-aminocyclohexane acetic acid
CAS:<p>Please enquire for more information about Boc-trans-4-aminocyclohexane acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23NO4Molecular weight:257.33 g/mol2-Pyrimidine-carboxylic acid
CAS:<p>2-Pyrimidine-carboxylic acid is a biologically active molecule that can be found in the human body. It is a derivative of pyrimidine, which belongs to the group of purines. 2-Pyrimidine-carboxylic acid has been shown to inhibit the nicotinic acetylcholine receptor and α7 nicotinic acetylcholine receptor, which are receptors for acetylcholine. This molecule also has antihypertensive activity and has been shown to have therapeutic effects in psychotic disorders. 2-Pyrimidine-carboxylic acid binds to picolinic acid, which is an important intermediate in the metabolism of tryptophan, and hydroxyl group, which is essential for many biological functions. It also reacts with copper ions and forms a complex that is x-ray crystal structure confirmed. This complex may be used as a herbicide resistance inducer or as a chemical species for receptor binding studies or chemical reactions.</p>Formula:C5H4N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:124.1 g/molPAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/mol(2R,3S)-3-Amino-2-hydroxy-3-phenylpropanoic acid hydrochloride
CAS:<p>(2R,3S)-3-Amino-2-hydroxy-3-phenylpropanoic acid hydrochloride is an organic compound that is used in the manufacture of taxol, an anticancer drug. It is synthesized by reacting chloroacetic acid with a metal hydroxide, such as sodium hydroxide or potassium hydroxide. The reaction proceeds spontaneously to form the enantiomerically pure (2R,3S) form and unreacted (2S,3R) form. The (2R,3S) enantiomer has been found to be more reactive than the (2S,3R) form. Quaternary ammonium salts are formed when the (2R,3S) enantiomer reacts with quaternary ammonium compounds such as benzyltrimethylammonium chloride. This compound can also be used in catalytic reactions to produce drugs such as carbapenems and pen</p>Formula:C9H12ClNO3Purity:Min. 95%Molecular weight:217.65 g/molKyotorphin acetate salt
CAS:<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/mol4-[5-(4-Pentyloxyphenyl)isoxazol-3-yl]benzoic acid
CAS:<p>Please enquire for more information about 4-[5-(4-Pentyloxyphenyl)isoxazol-3-yl]benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21NO4Purity:Min. 95%Molecular weight:351.4 g/mol4-Oxo-1-adamantanecarboxylic acid
CAS:<p>4-Oxo-1-adamantanecarboxylic acid is a versatile building block that can be used as a reactant and reagent in organic chemistry. It is used to synthesize various heterocyclic compounds, including the 4-oxo-1,4-dihydropyridine ring system. This compound has been shown to be useful as an intermediate or building block in the synthesis of a number of complex compounds. 4-Oxo-1-adamantanecarboxylic acid may also be used as a research chemical or speciality chemical.</p>Formula:C11H14O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:194.23 g/molGRPP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about GRPP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H215N41O58SPurity:Min. 95%Molecular weight:3,384.47 g/mol5-FAM-Woodtide trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H133N21O26SPurity:Min. 95%Molecular weight:1,945.2 g/molHIV-1 gag Protein p17 (76-84) acetate salt
CAS:<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>Formula:C44H72N10O15Purity:Min. 95%Molecular weight:981.1 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H71ClN12O8S2Purity:Min. 95%Molecular weight:1,175.86 g/mol2-[(5-Chloropyridin-2-yl)amino]-2-oxoacetic acid ethyl ester monohydrochloride
CAS:<p>Intermediate in the synthesis of edoxaban</p>Formula:C9H9ClN2O3·HClPurity:Min. 95%Molecular weight:265.09 g/molH-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H82N10O14Purity:Min. 95%Molecular weight:1,047.25 g/mol(Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H108N22O12Purity:Min. 95%Molecular weight:1,401.7 g/molpTH (1-34) amide (human) trifluoroacetate salt
CAS:<p>Parathyroid hormone (PTH) is a peptide hormone that regulates calcium and phosphate balance in the body. PTH is secreted by the parathyroid glands, located near the thyroid gland in the neck. It is also known as parathormone or parathyrin. The active form of PTH, called pTH (1-34) amide, has been shown to stimulate bone resorption and to inhibit bone formation. The amino acid sequence of this hormone starts with arginine and ends with phenylalanine. The N-terminal amino acid residue is an aspartic acid or asparagine and histidine is the only basic residue in this molecule. This molecule has two acidic residues, glutamic acid and aspartic acid, which are found on the side chains of two amino acids: aspartic acid and glutamic acid. Valine is found at position 3 and phenylalanine at position 34.</p>Formula:C181H292N56O50S2Purity:Min. 95%Molecular weight:4,116.73 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molTyr-α-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-alpha-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C172H276N52O51S2Purity:Min. 95%Molecular weight:3,952.48 g/molN-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid
CAS:<p>N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid is a high quality chemical that is used as an intermediate in the production of pharmaceuticals and other fine chemicals. It is also a reagent for use in peptide synthesis. N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid has a CAS No. 669073-62-5 and can be used as a useful scaffold for the production of complex compounds. This compound is also useful for research purposes, due to its versatility as a building block with speciality chemical applications.</p>Formula:C23H26N2O6Purity:Min. 95%Molecular weight:426.46 g/molSomatostatin-14 (3-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H96N16O17S2Purity:Min. 95%Molecular weight:1,509.75 g/molc3-Ethylbenzoic acid
CAS:<p>C3-Ethylbenzoic acid is an organic compound that can be synthesized from the reactants ethyl bromide, propylene oxide, and acetic anhydride. The synthesis of C3-Ethylbenzoic acid is a stepwise process in which the starting materials are converted to intermediates and then reacted to form the desired product. The reaction mechanism involves bond cleavage, which generates a carboxylic acid group on one end of the molecule and a phenyl group on the other end. C3-Ethylbenzoic acid interacts with clausamine and isoprene during transport through cell membranes. This interaction may lead to increased permeability of cell membranes by c3-ethylbenzoic acid.</p>Formula:C9H10O2Purity:Min. 95%Molecular weight:150.17 g/molThymosin α1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H215N33O55·xC2HF3O2Purity:Min. 95%Molecular weight:3,108.28 g/molH-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H149N31O26SPurity:Min. 95%Molecular weight:2,017.32 g/molUrocortin III (mouse) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C186H312N52O52S2Purity:Min. 95%Molecular weight:4,172.92 g/mol2-Hydroxysuccinic acid methyl ester
CAS:<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>Formula:C5H8O5Purity:90% MinMolecular weight:148.11 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/molH-Phe-AMC trifluoroacetate salt
CAS:<p>H-Phe-AMC Trifluoroacetate salt is a synthetic, protease inhibitor that inhibits the activity of serine and cysteine proteases. It binds to the active site of these enzymes and blocks their function. H-Phe-AMC trifluoroacetate salt has been used in food chemistry to hydrolyze proteins, and can be used to measure enzyme activities. This product also has been shown to have biological functions such as the inhibition of molting, physiological function, and the prevention of carcinogenesis.</p>Formula:C19H18N2O3Purity:Min. 95%Molecular weight:322.36 g/molNeuropeptide Y (2-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H278N54O55Purity:Min. 95%Molecular weight:4,090.47 g/molACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Formula:C44H59N13O10SPurity:Min. 95%Molecular weight:962.09 g/molGastrin I (rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C94H128N22O31S2Purity:Min. 95%Molecular weight:2,126.28 g/molDefensin HNP-2 (human) trifluoroacetate salt
CAS:<p>Defensin HNP-2 is a peptide that has been shown to bind to cancer cells, metabolic disorders, and endometriosis. It also has pharmaceutical preparations for treating microbial infection and other diseases. Defensin HNP-2 is a broad-spectrum antimicrobial peptide and it binds to bacterial membranes in the cell cytoplasm. Defensin HNP-2 may be used as diagnostic agents or in the treatment of microbial infections. This antimicrobial peptide is stable when complexed with calcium ions and can be used against s. aureus strains that are resistant to antibiotics such as ciprofloxacin.</p>Formula:C147H217N43O37S6Purity:Min. 95%Molecular weight:3,370.96 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/molAbz-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H58N12O16Purity:Min. 95%Molecular weight:986.98 g/molNuclear Factor NF-KB Inhibitor SN50 trifluoroacetate salt
CAS:<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>Formula:C129H230N36O29SPurity:Min. 95%Molecular weight:2,781.5 g/molpTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C108H173N27O35Purity:Min. 95%Molecular weight:2,409.69 g/mol6-Bromohexanoic acid methyl ester
CAS:<p>6-Bromohexanoic acid methyl ester is a linker that can be used in the synthesis of amides. This compound is synthesized by reaction between 2-bromobutyric acid and malonic acid, followed by hydrolysis with sodium hydroxide. 6-Bromohexanoic acid methyl ester is an efficient method for the preparation of amides. It is biologically active and has been shown to have anti-inflammatory properties in biological studies.</p>Formula:C7H13BrO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:209.08 g/mol(D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt
CAS:<p>D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt H-Tyr-D-Ala-Gly-N-Me-Phe-methionin(O)-ol trifluoroacetate salt is an analog of the endocannabinoid neurotransmitter, anandamide. It has been shown to be effective in the treatment of autoimmune diseases such as multiple sclerosis and inflammatory bowel disease. D-(3R)-3-[(1S,2R,3R,5R) -3-[2-(2,6 dichlorophenyl)ethenyl] -1H -indole]-1 -butanamine trifluoroacetate salt has been shown to inhibit the replication of a number of viruses including human immunodeficiency virus type 1 (HIV). This drug also inhibits the growth of organisms that are resistant</p>Formula:C29H41N5O7SPurity:Min. 95%Molecular weight:603.73 g/molZ-Val-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H36N8O7Purity:Min. 95%Molecular weight:584.62 g/mol5-Acenaphthenecarboxylic acid
CAS:<p>5-Acenaphthenecarboxylic acid is a xylene derivative that has been characterized as an organometallic compound. The cyclopentane ring is the central feature of this molecule and it can be used in the synthesis of other organic compounds. 5-Acenaphthenecarboxylic acid is toxic to humans and animals and has been shown to induce liver tumors in rats. It also has been shown to inhibit the growth of some bacteria, including Mycobacterium tuberculosis, which causes tuberculosis. 5-Acenaphthenecarboxylic acid inhibits protein synthesis by binding to ribosomes and interfering with the biosynthesis of proteins. This binding prevents formation of a complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>Formula:C13H10O2Purity:Min. 95%Color and Shape:PowderMolecular weight:198.22 g/molH-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/molTLQP-21 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N40O26Purity:Min. 95%Molecular weight:2,432.75 g/mol3-Piperidin-1-ylpropanoic acid
CAS:<p>3-Piperidin-1-ylpropanoic acid is a hydroxylated compound that belongs to the group of aromatic hydrocarbons. It has been shown to inhibit the activity of enzymes such as model studies and test compounds, which are used in biological samples. 3-Piperidin-1-ylpropanoic acid is not active against mouse tumor cells and does not show any locomotor activity. The terminal half life of this drug has been determined in urine samples from mice at 20 hours.</p>Formula:C8H15NO2Purity:Min. 95%Molecular weight:157.21 g/mol(Glu17·21·24)-Osteocalcin (1-49) (human) trifluoroacetate salt
<p>Please enquire for more information about (Glu17·21·24)-Osteocalcin (1-49) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C266H381N67O76S2Purity:Min. 95%Molecular weight:5,797.41 g/mol3,4,9,10-Perylenetetracarboxylic diimide
CAS:<p>3,4,9,10-Perylenetetracarboxylic diimide is a model system for studying the mechanism of protonated pyridine. It is a bicyclic heterocycle that contains two phenyl rings and one imide group. The nitrogen atoms in the molecule form hydrogen bonds with other molecules and can be substituted with chlorine or bromine. 3,4,9,10-Perylenetetracarboxylic diimide has been shown to have chemical stability under conditions of hydrochloric acid and heat. This compound also has a high melting point and is not soluble in water. 3,4,9,10-Perylenetetracarboxylic diimide has been used to study the reaction mechanisms of chemical reactions involving light emission. This compound absorbs light at wavelengths longer than 400 nm (e.g., ultraviolet) and emits light at wavelengths shorter than 400 nm (e.g.,</p>Formula:C24H10N2O4Color and Shape:PowderMolecular weight:390.35 g/molSubstance P (5-11) trifluoroacetate salt
CAS:<p>Substance P is a bifunctional neuropeptide that acts as both a neurotransmitter and a neurohormone. The amino acid sequence of Substance P is H-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2. It is found in the brain and spinal cord, but also in other tissues such as the parotid gland and stomach. This peptide is released from nerve cells when they are stimulated by pain or anxiety, and it causes contraction of smooth muscles in the lungs, uterus, and gastrointestinal tract. Animal studies have shown that Substance P can be toxic to neonatal animals, leading to hypothyroidism and death. In vitro studies have shown that this peptide can induce the growth of glioma cells and tumors.</p>Formula:C41H60N10O9SPurity:Min. 95%Molecular weight:869.04 g/mol1-Naphthyl acetate
CAS:<p>1-Naphthyl acetate is a cell-permeable esterase substrate that can be used for the treatment of lymphocytic leukemia, lung cancer, and Alzheimer's disease. It has been shown to inhibit tumor growth in mice by inhibiting cytochrome P450 enzymes. In addition, 1-naphthyl acetate has been found to be effective at inhibiting protein kinase activity in human cells. As a result, it may have potential as a therapeutic agent for leukemia and Alzheimer's disease.</p>Formula:C12H10O2Purity:Min. 95%Color and Shape:PowderMolecular weight:186.21 g/mol4-Acetamidophenyl boronic acid
CAS:<p>4-Acetamidophenyl boronic acid is a cross-coupling reagent that has been used in the synthesis of a variety of organic molecules. The reaction is stereoselective and proceeds with high yield. 4-Acetamidophenyl boronic acid has also been used to synthesize amides and azobenzenes, which can be substituted with chloride or uv irradiation to give chloroazobenzene or benzotriazole respectively. 4-Acetamidophenyl boronic acid has shown potent inhibition against the enzyme cyclooxygenase 2 (COX2) and acidic hydrolysis.</p>Purity:Min. 95%H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H49N7O11Purity:Min. 95%Molecular weight:659.73 g/mol3-Benzoyl acrylic acid
CAS:<p>3-Benzoyl acrylic acid is an organic compound that is the product of a chemical reaction between benzaldehyde and acetic anhydride. It contains a carboxylic acid group, an hydroxyl group, a nitro group, and a particle. 3-Benzoyl acrylic acid has been shown to inhibit the growth factor epidermal growth factor (EGF). This inhibition occurs by binding to the receptor for EGF on the cell membrane and blocking its activation. 3-Benzoyl acrylic acid also inhibits fatty acid synthesis and mitochondrial membrane potential, which may be due to its ability to form ester hydrochloride.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:PowderMolecular weight:176.17 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H285N55O57SPurity:Min. 95%Molecular weight:4,271.69 g/molKisspeptin-13 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H107N21O18Purity:Min. 95%Molecular weight:1,626.81 g/molD-α-Hydroxyisovaleric acid
CAS:<p>D-alpha-Hydroxyisovaleric acid is a compound that is used to synthesize stereoisomers. It is also a component of supramolecular chemistry and has been used in the construction of supramolecular polymers. D-alpha-Hydroxyisovaleric acid can be found in some plants, such as valinomycin, isovaleric acid, and metarhizium. This stereoisomer can be synthetized from the hydroxy group and an amino acid or peptide. D-alpha-Hydroxyisovaleric acid has the ability to degrade nonribosomal peptides into smaller molecules through its hydrolytic properties. It also inhibits Verticillium dahliae, which causes wilt disease in plants, by inhibiting the synthesis of hydroxycarboxylates. D-alpha-Hydroxyisovaleric acid is biodegradable and can be used for industrial purposes as well as pharmaceuticals.</p>Formula:C5H10O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:118.13 g/molAmyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H107N19O17SPurity:Min. 95%Molecular weight:1,494.76 g/molH-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
CAS:<p>L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.</p>Formula:C21H42N6O5Purity:Min. 95%Molecular weight:458.6 g/mol1-Pyreneboronic Acid (contains varying amounts of Anhydride)
CAS:<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>Formula:C16H11BO2Purity:Min. 95%Molecular weight:246.07 g/molH-Lys-Pro-Tyr-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/mol(Asp28)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H281N49O61SPurity:Min. 95%Molecular weight:4,187.56 g/molOsteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H42N10O7Purity:Min. 95%Molecular weight:618.69 g/molBiotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C148H223N43O42S3Purity:Min. 95%Molecular weight:3,372.82 g/mol2-Hydroxyethanesulfonic acid sodium salt
CAS:<p>2-Hydroxyethanesulfonic acid sodium salt is a drug that is used to treat metabolic disorders such as cystinuria and hyperchloremic metabolic acidosis. It is also used for the treatment of water-vapor related respiratory problems and cataracts, as well as for the prevention of renal stone formation. This drug is made through electrochemical impedance spectroscopy of taurine in reaction solution with phosphorus pentoxide. 2-Hydroxyethanesulfonic acid sodium salt has been shown to increase locomotor activity in rats by improving their biochemical properties. This compound binds to the chloride ion receptor site on the Na+/K+ ATPase, causing an inhibition of the enzyme's function.</p>Formula:C2H5O4S·NaPurity:Min. 95%Color and Shape:White PowderMolecular weight:148.11 g/molGalanin (2-11) amide trifluoroacetate salt
CAS:<p>Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu is a galanin analog and a ligand for the galanin receptor 1. It has affinity for the receptors in the brain, which are involved in cognition, and is used to study Alzheimer's disease. Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser -Ala -Gly -Tyr -Leu -Leu is a member of the family of neuropeptides and neuromodulators that regulate nerve injury and alzheimer's disease.</p>Formula:C54H81N13O14Purity:Min. 95%Molecular weight:1,136.3 g/molAc-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H66N12O9Purity:Min. 95%Molecular weight:871.04 g/molTRAP-14 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H119N21O22Purity:Min. 95%Molecular weight:1,738.94 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35N3O4Purity:Min. 95%Molecular weight:357.49 g/molH-Arg-Leu-OH acetate salt
CAS:<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C188H282N52O59S2Purity:Min. 95%Molecular weight:4,278.7 g/mol4-Chlorophenylboronic acid
CAS:<p>4-Chlorophenylboronic acid is a chemical compound that is used in the industrial preparation of biphenyl. It is produced by the Friedel-Crafts reaction between chlorine and 4-methoxyphenylboronic acid. This reaction can be carried out using a variety of solvents, such as chloroform or carbon tetrachloride. The optimal reaction conditions are acidic pH values, which are achieved by adding sodium carbonate to the solution. The product can be purified by distillation or crystallization. 4-Chlorophenylboronic acid can also be used for the synthesis of organic compounds through cross-coupling reactions with organometallic reagents, such as palladium chloride and triphenylphosphine, or through asymmetric synthesis with chiral ligands like (S)-proline and 2-(diphenylphosphino)ferrocene.</p>Formula:C6H6BClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:156.37 g/molPAR-2 (6-1) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/molBenzyl acetate
CAS:<p>Benzyl acetate is a colorless liquid that has a pleasant odor. It is used as a flavoring agent in food, beverages and tobacco products. Benzyl acetate is also used as an intermediate in the production of other chemicals. A low-dose group of rats was given benzyl acetate at doses of 0.5, 1, 5 and 10 mg/kg/day for 30 days. The animals were observed for changes in enzyme activities and thermal expansion reactions. Chronic exposure to benzyl acetate may cause carcinogenesis by inducing dimethyl fumarate (DMF) or methyl transferase activity.</p>Formula:C9H10O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:150.17 g/molH-Gly-Pro-Arg-Pro-NH2 acetate salt
CAS:<p>H-Gly-Pro-Arg-Pro-NH2 acetate salt is a peptide with antiplatelet activity. It has been shown to inhibit the interaction between fibrinogen and platelets, which leads to the inhibition of thrombin formation and subsequent clotting. The amide bond in this peptide is susceptible to hydrolysis by enzymes such as phospholipase A2, which means that it can be broken down into smaller fragments that have different biological activities. H-Gly-Pro-Arg-Pro-NH2 acetate salt has been shown to inhibit the growth of babesia microti, a causative agent of babesiosis in cattle, through lysis of infected erythrocytes. This drug also inhibits the growth of hemagglutinating virus type 3 (HV3) and filovirus, two viruses that are not yet fully understood.</p>Formula:C18H32N8O4Purity:Min. 95%Molecular weight:424.5 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molCell-permeable Caspase-3 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-3 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C94H158N20O27Purity:Min. 95%Molecular weight:2,000.38 g/molH-Ala-Ala-Ala-OMe acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N3O4Purity:Min. 95%Molecular weight:245.28 g/mol(Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H76N18O9S2Purity:Min. 95%Molecular weight:1,209.45 g/mol16-Hydroxyhexadecanoic acid
CAS:<p>16-Hydroxyhexadecanoic acid is a fatty acid that contains 16 carbons and 2 hydroxyl groups. It can be found in rat liver microsomes, where it binds to the cytochrome P450 enzyme, inhibiting its activity. The structural analysis of this compound has been shown to have intermolecular hydrogen bonding between the nitrogen atoms and the oxygen atoms in the hydroxyl group. 16-Hydroxyhexadecanoic acid also exhibits phase transition temperatures, which are increased by adding water molecules. This compound also has an inhibitory effect on recombinant cytochrome P450 enzymes from p. pastoris and can be used as a substrate for methyl myristate metabolism. In addition, 16-hydroxyhexadecanoic acid binds to dinucleotide phosphate (NADPH) and fluoresces when excited at 340 nm using a fluorescence detector.</p>Formula:C16H32O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:272.42 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H203N41O38Purity:Min. 95%Molecular weight:3,080.37 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/moltert-Butyl carbamate
CAS:<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>Formula:C5H11NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:117.15 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%pTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C406H670N122O126S3Purity:Min. 95%Molecular weight:9,372.61 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H78N14O11Purity:Min. 95%Molecular weight:1,111.3 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/molHexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt
<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H250N44O43SPurity:Min. 95%Molecular weight:3,425.96 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C141H235N47O41Purity:Min. 95%Molecular weight:3,244.67 g/mol4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt
CAS:<p>4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.</p>Formula:C23H34N6O6Purity:Min. 95%Molecular weight:490.55 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/molTRAF6 Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H238N34O44Purity:Min. 95%Molecular weight:3,161.64 g/mol3-(4-Methoxybenzoyl)acrylic acid
CAS:<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H10O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.19 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molTAT 2-4 trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C132H240N66O29Purity:Min. 95%Molecular weight:3,215.75 g/molBiotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C137H217N47O41S4Purity:Min. 95%Molecular weight:3,306.75 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/mol(2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate
CAS:<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O4Purity:Min. 95%Molecular weight:244.29 g/molpTH (1-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH (1-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H316N58O54S2Purity:Min. 95%Molecular weight:4,401.09 g/mol(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester
CAS:<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>Formula:C12H16O3Purity:Min. 95%Color and Shape:LiquidMolecular weight:208.25 g/mol2,4,6-Trifluorobenzoic acid
CAS:<p>2,4,6-Trifluorobenzoic acid is a chemical compound that is an intermediate in the synthesis of stilbazole. It is prepared by chlorinating the 2,4,6-trichlorobenzoic acid with hydrogen peroxide and hydrochloric acid. The 2,4,6-trifluorobenzoic acid is then reduced to the desired product with sodium borohydride. This chemical has been detected in nature as a racemic mixture and can be used as a precursor in analytical methods for detecting other compounds. It is also used in dechlorination reactions to remove chlorine from organic molecules. This process can be monitored using UV detectors.</p>Formula:C7H3F3O2Purity:Min. 95%Molecular weight:176.09 g/mol(2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate
CAS:Controlled Product<p>Please enquire for more information about (2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H17NO2•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:285.26 g/molOvokinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H67N13O11Purity:Min. 95%Molecular weight:1,002.13 g/mol(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H244N48O40S2Purity:Min. 95%Molecular weight:3,496.04 g/molAndrostanolone acetate
CAS:Controlled Product<p>Androstanolone acetate is a synthetic androgen that has been shown to stimulate the production of testosterone in the testes. Androstanolone acetate has been shown to be effective in treating symptoms of male hypogonadism, as well as erectile dysfunction. The drug also has an antigenic effect, which stimulates the production of antibodies against it. Androstanolone acetate binds to cell specific antigens and stimulates cell proliferation. It has been used in cancer prevention studies, where it was found that it could suppress estrogen-induced endometrial cancer in animals. In addition, Androstanolone acetate is capable of stimulating light emission when incubated with cells and can be detected using chromatographic methods.</p>Formula:C21H32O3Purity:Min. 95%Color and Shape:PowderMolecular weight:332.48 g/molAc-D-Ala-D-lactic acid
CAS:<p>Please enquire for more information about Ac-D-Ala-D-lactic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H13NO5Purity:Min. 95%Molecular weight:203.19 g/molBiotinyl-Neuromedin S (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H279N55O46SPurity:Min. 95%Molecular weight:4,017.58 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formula:C39H64N12O19Purity:Min. 95%Molecular weight:1,004.99 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/molFibronectin Fragment (1954-1959) trifluoroacetate salt
CAS:<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H63N11O7Purity:Min. 95%Molecular weight:713.91 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H66Cl2N12O8S2Purity:Min. 95%Molecular weight:1,146.22 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H116N20O19SPurity:Min. 95%Molecular weight:1,657.93 g/mol(D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H73N11O9S2Purity:Min. 95%Molecular weight:1,192.45 g/molBoc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid
CAS:<p>Please enquire for more information about Boc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25NO5Purity:Min. 95%Molecular weight:275.34 g/molAc-Lys-D-Ala-D-lactic acid·acetate
CAS:Controlled Product<p>Please enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H25N3O6·C2H4O2Purity:Min. 95%Molecular weight:391.42 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/mol(Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molDABCYL-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H97N17O18SPurity:Min. 95%Molecular weight:1,532.72 g/molEthyl 2-(chlorosulfonyl)acetate
CAS:<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>Purity:Min. 95%Color and Shape:PowderMolecular weight:186.61 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H54N10O9Purity:Min. 95%Molecular weight:782.89 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/mol4-Bromobutyl acetate
CAS:<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>Formula:C6H11BrO2Purity:Min. 95%Molecular weight:195.05 g/molAlloferon - in acetate salt
CAS:<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>Formula:C52H75N22O16Purity:Min. 95%Molecular weight:1,264.29 g/molFmoc-D-thiazolidine-4-carboxylic acid
CAS:<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17NO4SPurity:Min. 95%Molecular weight:355.41 g/molCyclopropane-1,1-dicarboxylic acid, methylester
CAS:<p>Please enquire for more information about Cyclopropane-1,1-dicarboxylic acid, methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:144.13 g/molDnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt
<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H64N14O12SPurity:Min. 95%Molecular weight:965.09 g/mol(Glu9)-Exenatide (2-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Glu9)-Exenatide (2-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C179H277N47O59SPurity:Min. 95%Molecular weight:4,063.46 g/molKR-12 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H127N25O15Purity:Min. 95%Molecular weight:1,570.93 g/mol2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid
CAS:<p>2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid is a fine chemical that is used in research and as a reagent. It is also used as a building block for more complex compounds and as a versatile scaffold in organic synthesis. 2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid can be reacted with other chemicals to create new compounds. This chemical has been shown to have antihistamine properties and may also function as an antipsychotic drug.</p>Formula:C9H6BrNO5Purity:Min. 95%Molecular weight:288.05 g/molAmyloid β-Protein (35-25) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H81N13O14SPurity:Min. 95%Color and Shape:PowderMolecular weight:1,060.27 g/molGalanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H210N42O43Purity:Min. 95%Molecular weight:3,157.41 g/mol(R)-methyl pyrrolidine-3-carboxylate hydrochloride
CAS:<p>Please enquire for more information about (R)-methyl pyrrolidine-3-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H295N53O59SPurity:Min. 95%Molecular weight:4,345.81 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS:<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Formula:C12H19NO5Purity:Min. 95%Molecular weight:257.28 g/mol(D-Ala2)-Leu-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N9O8·xC2H4O2Purity:Min. 95%Molecular weight:725.84 g/molDL-4-Hydroxymandelic acid
CAS:<p>DL-4-Hydroxymandelic acid is a phenolic acid that belongs to the family of organic acids. It is synthesized from 4-hydroxyphenylpyruvate and p-hydroxybenzoic acid by an enzyme called hydroxylase in the liver. The frequency shift in DL-4-Hydroxymandelic acid is caused by the hydrogen bonding between its hydroxyl group and pyran ring. This reaction occurs spontaneously, with no need for a catalyst or a change in pH. The reaction mechanism starts with the addition of water to the molecule, which results in an intermediate that breaks down into two molecules of formaldehyde and one molecule of formate. The reaction solution was found to be acidic because it contained H+ ions (H+).</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS:<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H37N5O4•3C2H4O2Purity:Min. 95%Molecular weight:567.67 g/mol2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid
CAS:<p>Please enquire for more information about 2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5BF2O4Purity:Min. 95%Molecular weight:201.92 g/molH-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
CAS:<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>Formula:C29H54N8O10Purity:Min. 95%Molecular weight:674.79 g/molpTH-Related Protein (1-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>Formula:C180H288N58O47Purity:Min. 95%Molecular weight:4,016.58 g/mol(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys<br>The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molC5a Anaphylatoxin (37-53) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about C5a Anaphylatoxin (37-53) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H141N27O22SPurity:Min. 95%Molecular weight:1,889.23 g/molZ-Arg-Arg-Arg-4MbetaNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H53N13O6Purity:Min. 95%Molecular weight:775.9 g/molC-Type Natriuretic Peptide (1-53) (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C251H417N81O71S3Purity:Min. 95%Molecular weight:5,801.7 g/mol2-[(3,5,6-Trichloro-2-pyridinyl)oxy]acetic acid
CAS:<p>Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.</p>Formula:C7H4Cl3NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:256.47 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt
CAS:<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47·xC2H4O2Purity:Min. 95%Molecular weight:3,355.67 g/mol(R,S)-α-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid hydrobromide
CAS:<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.</p>Formula:C7H10N2O4•HBrPurity:Min. 95%Molecular weight:267.08 g/molAngiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Angiotensin I/II (1-7) trifluoroacetate salt is a selective inhibitor of angiotensin II. It blocks the activity of angiotensin II, and thereby prevents the activation of growth factor-β1, which leads to a decrease in pulmonary hypertension. The drug has also been shown to be effective in blocking dextran sulfate absorption, as well as preventing bowel disease by inhibiting receptor activity. Angiotensin I/II (1-7) trifluoroacetate salt has been shown to have an anti-inflammatory effect on the cardiovascular system by blocking cell signaling pathways and reducing blood pressure. This drug is used for treatment of metabolic disorders such as atherosclerotic lesion, cardiac diseases such as coronary heart diseases, and bowel disease.</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/mol5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester
CAS:<p>Please enquire for more information about 5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H7F3N2O2Purity:Min. 95%Molecular weight:208.14 g/molH-D-Arg(Me)-OH acetate salt
CAS:Controlled Product<p>H-D-Arg(Me)-OH is a peptide that has been shown to inhibit the proliferation of cancer cells in culture. It inhibits the growth of tumor cells by blocking the activity of the oxytocin receptor, which regulates cell adhesion and migration. The H-D-Arg(Me)-OH acetate salt has also been shown to promote the differentiation of basophilic leukemia cells into normal myeloid cells. This peptide is used as a control for incubated cell cultures, such as liver cells, and can be used to study protein synthesis.</p>Formula:C7H16N4O2Purity:Min. 95%Molecular weight:188.23 g/molEthyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate
CAS:<p>Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate is an anticancer agent that belongs to the class of formamidines. It is synthesized by refluxing ethyl 4-hydroxyphenylacetic acid with hexamethylenetetramine and acetic acid in ethanol. After purification, it is converted to its active form by reacting with hydrochloric acid. Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate prevents the growth of cancer cells in culture by preventing DNA synthesis, which prevents RNA and protein synthesis. This agent has also been found to suppress paclitaxel production in cultured human breast cancer cells.</p>Formula:C13H13NO3SPurity:Min. 95%Molecular weight:263.31 g/molβ-Bag Cell Peptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Aplysia californica is a species of sea slug that produces a peptide, beta-Bag Cell Peptide (BACP), which has been shown to have depolarizing effects on neurons. BACP can be synthesized from the amino acid sequence of the Aplysia californica cell membrane protein, and this synthetic peptide has been shown to have maximal depolarizing effects at high concentrations. The depolarizing effect of BACP can be seen in populations of neurons as well as individual neurons. This peptide also desensitizes autoreceptors for acetylcholine and serotonin, which may play a role in its electrophysiological effects.</p>Formula:C33H53N13O6Purity:Min. 95%Molecular weight:727.86 g/mol
