
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,465 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38248 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-Leu-Glu-Val-Asp-AFC
CAS:<p>Please enquire for more information about Ac-Leu-Glu-Val-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H40F3N5O11Purity:Min. 95%Molecular weight:727.68 g/molH-β-Cyclohexyl-Ala-OMe·HCl
CAS:<p>Please enquire for more information about H-beta-Cyclohexyl-Ala-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO2·HClPurity:Min. 95%Molecular weight:221.72 g/molAc-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H66N4O12Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:758.94 g/molSuc-Ala-Ala-Phe-pNA
CAS:<p>Suc-Ala-Ala-Phe-pNA is a peptide that is being studied for its potential to act as an anticancer agent. It inhibits the growth of tumor cells by binding to the neurokinin receptor and thereby blocking the production of substances such as epidermal growth factor, which promote tumor growth. Suc-Ala-Ala-Phe-pNA also has been shown to inhibit the activity of enzymes involved in glucocorticoid receptors, which are proteins that play a key role in regulating the immune response. This peptide also has been shown to be active against mouse skin cells and human prostate cancer cells. In addition, it is believed that this peptide may be useful in gene therapy because it can induce apoptosis in tumor cells without affecting normal tissue.</p>Formula:C25H29N5O8Purity:Min. 95%Molecular weight:527.53 g/molHemokinin 1 (human) trifluoroacetate salt
CAS:<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>Formula:C54H84N14O14SPurity:Min. 95%Molecular weight:1,185.4 g/molH-Phe-Met-D-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/molSuc-Ala-Gln-Pro-Phe-pNA
CAS:<p>Suc-Ala-Gln-Pro-Phe-pNA is a peptide that is composed of 18 amino acids. This peptide has a molecular weight of 2,812. It has been shown to have biochemical activity in vitro and in vivo. Suc-Ala-Gln-Pro-Phe-pNA is an erythropoietin receptor agonist that has shown homologous sequences with tyrosine kinase receptors and collagen. This protein was expressed in the endoplasmic reticulum, cytosol, and mitochondria of cells. The enzyme phosphatase hydrolyzed the peptide during incubation with calf thymus DNA.</p>Formula:C32H39N7O10Purity:Min. 95%Molecular weight:681.69 g/molFmoc-Phe-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Glutaryl-Phe-bNA
CAS:<p>Please enquire for more information about Glutaryl-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H24N2O4Purity:Min. 99 Area-%Molecular weight:404.46 g/molFibronectin Receptor Peptide (124-131)
CAS:<p>Please enquire for more information about Fibronectin Receptor Peptide (124-131) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H72N8O15SPurity:Min. 95%Molecular weight:1,045.21 g/molFmoc-Thr(tBu)-Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Thr(tBu)-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H30N2O6Purity:Min. 95%Molecular weight:454.52 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H73N13O26Purity:Min. 95%Molecular weight:1,344.25 g/molPAR-2 (1-6) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 agonist is a synthetic peptide that activates PAR-2. It binds to PAR-2 receptors, which are present in the mesenteric vasculature and in various other tissues. Activation of PAR-2 leads to an increase in intracellular calcium concentration, activation of protein kinase C, cytosolic calcium ion release, phosphorylation of myosin light chain, muscle cell proliferation, transcription and translation initiation, and increased production of vasoactive intestinal peptide. This drug also has anti-inflammatory effects and stimulates epidermal growth factor (EGF) and thrombin receptor expression as well as growth factor production.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molType A Allatostatin II
CAS:<p>Allatostatin II is a fatty acid that has been shown to have receptor activity. It is an analog of the glycopeptide antibiotic gramicidin S and has been shown to inhibit the growth of bacteria and fungi. Allatostatin II also has diagnostic properties, which are used in biochemical tests for inflammatory diseases. The molecule is conjugated with various agents to form diagnostic agents or antibiotics, such as stenotrophomonas maltophilia and erythromycin. Allatostatin II is found in the human plasma, but its function is unknown.</p>Formula:C49H74N14O13Purity:Min. 95%Molecular weight:1,067.2 g/molO-Hippuryl-L-b-phenyllactic acid sodium salt
CAS:<p>Please enquire for more information about O-Hippuryl-L-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/molAmyloid β-Protein (1-40) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>Formula:C32H50N4O8Purity:Min. 95%Molecular weight:618.76 g/molH-Pro-His-Pro-Phe-His-Phe-Phe-Val-Tyr-Lys-OH
CAS:<p>H-Pro-His-Pro-Phe-His-Phe-Phe-Val-Tyr-Lys-OH is a monoclonal antibody that has been shown to inhibit the activity of enalaprilat, which is an enzyme inhibitor. H-Pro-His-Pro-Phe-His-Phe-Phe-Val--Tyr--Lys--OH binds to the active site of the enzyme and inhibits its activity. This drug has been shown to be effective against a number of infectious diseases, including HIV. It has also been shown to have diagnostic utility for renal function and congestive heart failure. H--Pro--His--Pro--Phe--His--Phe--Phe--Val----Tyr----Lys----OH has also been shown to inhibit protease activity in vitro. The biocompatible polymer coating used in this drug prevents degradation by enzymes in the body and enhances its stability in vivo.</p>Formula:C69H87N15O12Purity:Min. 95%Molecular weight:1,318.52 g/molEpinecidin-1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C114H176N30O21SPurity:Min. 95%Molecular weight:2,334.87 g/molH-Glu-Thr-Tyr-OH
CAS:<p>Please enquire for more information about H-Glu-Thr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H25N3O8Purity:Min. 95%Molecular weight:411.41 g/molAQEE-30 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H245N47O56Purity:Min. 95%Molecular weight:3,674.9 g/molFA-Ala-Arg-OH
CAS:<p>F-Ala-Arg-OH is a peptide hormone that has been shown to have antitumor, antiinflammatory, and antidiabetic properties. The peptide hormone binds to the creatine kinase enzyme and inhibits its activity, which leads to a decrease in phosphocreatine levels in the human serum. F-Ala-Arg-OH does not inhibit lysine residues of the creatine kinase enzyme. This inhibition can be reversed by adding ATP or adding an activator. F-Ala-Arg-OH also inhibits cancer cells through apoptosis. This inhibition of cancer cells may be due to the ability of this peptide to bind to lysine residues on cell membranes and activate them. F-Ala-Arg-OH is also able to destroy tumor cells by binding to their mitochondria and inducing their lysis.</p>Formula:C16H23N5O5Purity:Min. 95%Molecular weight:365.38 g/mol(Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated)
CAS:<p>Please enquire for more information about (Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H74N14O18SPurity:Min. 95%Molecular weight:1,251.33 g/mol1-Methylpiperidine-4-carboxylic acid hydrochloride
CAS:<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>Formula:C7H14NO2ClPurity:Min. 95%Molecular weight:179.64 g/mol1-Boc-5-Cyano-3-hydroxymethylindole
CAS:<p>Please enquire for more information about 1-Boc-5-Cyano-3-hydroxymethylindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H16N2O3Purity:Min. 95%Molecular weight:272.3 g/molCyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Phe-Phe-Asn-Tyr-Tyr-Trp-OH
CAS:<p>Please enquire for more information about Cyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Phe-Phe-Asn-Tyr-Tyr-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H115N23O23Purity:Min. 95%Molecular weight:2,043.16 g/molH-Ala-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Ala-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H17N3O2·HClPurity:Min. 95%Molecular weight:271.74 g/molpTH (1-34) (rat)
CAS:<p>Please enquire for more information about pTH (1-34) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H291N55O48S2Purity:Min. 95%Molecular weight:4,057.71 g/molFmoc-Glu(OtBu)-Thr(psi(Me,Me)pro)-OH
CAS:<p>Fmoc-glu(otbu)-thr(psi(Me,Me)pro)-OH is a c1-6 alkoxy, expressed, alkenyl, linker, c1-6 alkyl, efficiency, sequence that can be used for peptide synthesis. It is an efficient linker for the synthesis of peptides and has been shown to yield high yields with few side products. The hydroxyl group on the side chain of the amino acid residue provides an additional site for acylation. This product also contains an aralkyl and alkoxy group that can be used in further reactions.</p>Formula:C31H38N2O8Purity:Min. 95%Color and Shape:PowderMolecular weight:566.64 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/molBoc-Thionoleu-1-(6-nitro)benzotriazolide
CAS:<p>Please enquire for more information about Boc-Thionoleu-1-(6-nitro)benzotriazolide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O4SPurity:Min. 95%Molecular weight:393.46 g/molH-Thr(tBu)-pNA
CAS:<p>Please enquire for more information about H-Thr(tBu)-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N3O4Purity:Min. 95%Molecular weight:295.33 g/mol1-(4-Hydroxy-3-methoxyphenyl)-2-nitroethene
CAS:<p>1-(4-Hydroxy-3-methoxyphenyl)-2-nitroethene is an experimental molecule that was not previously known to exist. The intramolecular reaction of 1,4-dihydroxynitrobenzene and glyoxylic acid yields the product. It is a phenolic compound with biological activity, which has been shown to inhibit glycosidases and alkaloids.</p>Formula:C9H9NO4Purity:Min. 95%Color and Shape:SolidMolecular weight:195.17 g/molBifunctional Antiplatelet Agent H(-Lys-Arg)3-Arg-Gly-Asp-Val-OH
CAS:<p>Please enquire for more information about Bifunctional Antiplatelet Agent H(-Lys-Arg)3-Arg-Gly-Asp-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H103N25O13Purity:Min. 95%Molecular weight:1,298.55 g/molProcathepsin B (26-50) (rat)
CAS:<p>Please enquire for more information about Procathepsin B (26-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H198N34O33SPurity:Min. 95%Molecular weight:2,713.16 g/molAc-α-benzyl-muramyl-Ala-D-Glu(Lys(trans-(3-nitrocinnamoyl))-NH2)-NH2
CAS:<p>Please enquire for more information about Ac-alpha-benzyl-muramyl-Ala-D-Glu(Lys(trans-(3-nitrocinnamoyl))-NH2)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H56N8O14Purity:Min. 95%Molecular weight:884.93 g/molZ-D-Phe-Phe-Gly-OH
CAS:<p>Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.</p>Formula:C28H29N3O6Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:503.55 g/molAc-Phe-Gly-pNA
CAS:<p>Ac-Phe-Gly-pNA is a peptidyl prodrug that has been shown to have proteolytic activity against cells of the malignant phenotype. Ac-Phe-Gly-pNA is converted to an active form by serine proteases, which are found on the surface of trophozoites and in cancerous cells. The sequence of Ac-Phe-Gly-pNA is homologous with a protein found in Giardia lamblia, and it has been shown to be active against this parasite. Ac-Phe-Gly-pNA can also be detected with fluorogenic substrates and aminopeptidase activity.</p>Formula:C19H20N4O5Purity:Min. 95%Molecular weight:384.39 g/molH-Val-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu-OH
CAS:<p>H-Val-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu (HVLAHR) is a synthetic peptide that has been shown to have antiinflammatory properties. The peptide binds to the epidermal growth factor receptor (EGFR) and inhibits the production of proinflammatory cytokines and chemokines, such as IL1α, IL6, IL8, and TNFα. HVLAHR also binds to calmodulin and inhibits protein kinase C (PKC) activity. It has been shown that this peptide has neuroprotective effects in vitro by binding to neurogranin and inhibiting protein phosphorylation. HVLAHR can be used as a model organism in vitro to study protein kinase activity.</p>Formula:C51H100N22O11Purity:Min. 95%Molecular weight:1,197.48 g/molDnp-Pro-Gln-Gly-Ile-Ala-Gly-Gln-D-Arg-OH
CAS:<p>Dnp-Pro-Gln-Gly-Ile-Ala-Gly-Gln-D-Arg-OH is an activated form of DNP that has been proteolyzed and then carbonylated. It has a ph optimum of 10.5, is reactive in tissue culture, and reacts with collagen. This molecule has clinical response in women, and also shows low expression in human serum. The carbonyl group may be used as a synthetic substrate to generate antibodies against the protein or modified forms of the protein.</p>Formula:C40H61N15O15Purity:Min. 95%Molecular weight:992 g/molHIV-1 tat Protein (1-9)
CAS:<p>Tat is a protein from the human immunodeficiency virus type 1 (HIV-1) that is responsible for the regulation of viral gene expression. Tat binds to a cellular receptor, CD4, and enters the cell. The Tat protein forms a ternary complex with transcription factors and RNA polymerase II. This complex then binds to promoter regions of HIV genes and initiates transcription. Tat has been postulated to modulate immune functions such as chemokine production, T-cell activation, and macrophage activation. The HIV-1 tat Protein (1-9) H-Met-Asp-Pro-Val-Asp-Pro-Asn-Ile-Glu-OH has been shown to have an effect on the immune system by affecting chemokines and other immune functions.</p>Formula:C43H68N10O17SPurity:Min. 95%Molecular weight:1,029.12 g/molTRAP-5 trifluoroacetate salt
CAS:<p>TRAP-5 is a peptide consisting of the amino acid sequence H-Ser-Phe-Leu-Leu-Arg. This peptide has been shown to have antiviral, anti-inflammatory, and anticancer properties. It has also been found to inhibit platelet activation in vitro and to reduce atherosclerotic lesions in mice. TRAP-5 has been shown to have therapeutic potential for diseases such as heart disease and lung diseases, although its efficacy has not yet been tested in humans.</p>Formula:C30H50N8O7Purity:Min. 95%Molecular weight:634.77 g/molH-Lys-Leu-OH acetate salt
CAS:<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>Formula:C12H25N3O3·C2H4O2Purity:Min. 95%Molecular weight:319.4 g/molH-Phe-Phe-Phe-Phe-OH
CAS:<p>Please enquire for more information about H-Phe-Phe-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H38N4O5Purity:Min. 95%Molecular weight:606.71 g/molL-Glutamic acid 5-benzyl ester
CAS:<p>L-Glutamic acid 5-benzyl ester is an amino acid that has been synthesized to have a lysine residue. It is an ester hydrochloride and has been shown to have broad-spectrum antimicrobial properties. L-glutamic acid 5-benzyl ester's antimicrobial activity is thought to be due to its chemical structure which allows it to act as an antimicrobial peptide, binding to receptors on the surface of bacterial cells and inhibiting their growth. L-glutamic acid 5-benzyl ester also inhibits osteogenic genes in cervical cancer cells, but not in normal cells.</p>Formula:C12H15NO4Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:237.25 g/molmPEG9-OH
CAS:<p>mPEG9-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, mPEG9-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Formula:C19H40O10Purity:Min. 95%Molecular weight:428.51 g/mol(Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat)
CAS:<p>Please enquire for more information about (Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H166N28O30S3Purity:Min. 95%Molecular weight:2,360.78 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-Lys(Dnp)
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-Lys(Dnp) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H67N11O21Purity:Min. 95%Molecular weight:1,170.14 g/molTumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt
<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C94H174N32O22S2Purity:Min. 95%Molecular weight:2,168.72 g/molZ-His-Phe-Phe-OEt
CAS:<p>Z-His-Phe-Phe-OEt is a synthetic, polyacrylamide gel-based experiment that determines the amino acid composition of imidazolium zymogens. This experiment utilizes an ion-exchange chromatography technique to separate and identify peptides. The solvents used in this experiment are acetone and ion-exchange chromatography. In order to carry out this experiment, one must first dissolve the polyacrylamide gel in a system of solvents with a pH of 7.5 or lower in order to create an electrofocusing environment. This solution is then applied to the polyacrylamide gel, which will form a solid film when dried. The imidazolium zymogen can then be cleaved by pepsin, yielding peptides that can be analysed using mass spectrometry.</p>Formula:C34H37N5O6Purity:Min. 95%Molecular weight:611.69 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-OH is a cyclic peptide that contains five amino acids. It was synthesized by the reaction of L-glycine and D-alanine with D,L-aspartic acid and L,D,L-serine. HAGGS has been shown to stimulate the proliferation of fibroblast cells in vitro. The presence of HAGGS on the surface of human breast cancer cells (MDA MB 231) promotes the proliferation of these cells and stimulates the production of growth factor β1. HAGGS also activates integrin receptors on these cells, which are proteins that bind to collagen or fibronectin. This may be due to its ability to form disulfide bonds with neighboring proteins, such as fibronectin and integrin.</p>Formula:C22H37N9O10Purity:Min. 95%Molecular weight:587.58 g/mol(Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molH-Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys-Ala-OH trifluoroacetate salt (Disulfide bond between Pen2 and Cys9)
CAS:<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>Formula:C35H57N13O14S2Purity:Min. 95%Molecular weight:948.04 g/molZ-Arg-AMC hydrochloride salt
CAS:<p>Z-Arg-AMC hydrochloride salt is a proteolytic agent that inhibits serine proteases. It can be used to study the biological function of proteases and as a tool in the kinetic analysis of protease activity. Z-Arg-AMC hydrochloride salt has been shown to inhibit trypsin, chymotrypsin, and elastase enzymes at nanomolar concentrations. This compound also inhibits human pathogens such as enterovirus 71 and herpes simplex virus type 1, which are associated with severe disease symptoms. The structural analysis of Z-Arg-AMC hydrochloride salt has shown it to be a racemic mixture of L-Arginine and D-Arginine with an average molecular weight of 313.5 Da.</p>Formula:C24H27N5O5Purity:Min. 95%Molecular weight:465.5 g/molFmoc-octyl-D-Gly-OH
CAS:<p>Fmoc-octyl-D-Gly-OH is a supramolecular polymer with a wide range of applications, including oil recovery and as a nanomaterial. Fmoc-octyl-D-Gly-OH is synthesized by the ring opening polymerization of octylglycol with D,L lactic acid. It has been shown to be an effective emulsifier in water, which may be due to its synergistic effect with other molecules. Fmoc-octyl-D-Gly-OH also has the ability to self assemble into a variety of morphologies such as nanoribbons, nanowires, and gel networks. This polymer can also be used as a hydrogenation catalyst for organic synthesis reactions that require high pressures and temperatures. Fmoc-octyl-D-Gly-OH has also been used in the production of ultrasonication devices for use in medicine.</p>Formula:C25H31NO4Purity:Min. 95%Molecular weight:409.52 g/molH-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2
CAS:<p>H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 is a compound which is structurally related to the amino acid histidine. It has been used as an indicator for Xanthochromia, a diagnostic for copper. H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 has also been used in polyester production and as a monitoring agent for modifications of polylactic acid thermally.</p>Formula:C40H69N11O8Purity:Min. 95%Molecular weight:832.05 g/molMet-Enkephalin-Arg-Phe
CAS:<p>Met-enkephalin is a 5-hydroxytryptamine (serotonin) agonist. It has been shown to have anesthetic properties and to be active in cardiac, pulmonary, and renal functions. Met-enkephalin has also been found to have a delta-opioid receptor activity. This molecule has been shown to inhibit noradrenaline release from the locus coeruleus, as well as immunohistochemically demonstrating its presence at the atrium of the heart. Met-enkephalin also exhibits hydroxylase activity and has been shown to inhibit dopamine release from the substantia nigra pars compacta and sinoatrial node in rats. This drug can be used for treatment of pain, hypertension, angina pectoris, myocardial infarction, unstable angina, cardiogenic shock, congestive heart failure due to left ventricular dysfunction or ischemia of the coronary artery, acute pulmonary edema</p>Formula:C42H56N10O9SPurity:Min. 95%Molecular weight:877.02 g/molAc-Ala-Ala-Pro-Phe-pNA
CAS:<p>Ac-Ala-Ala-Pro-Phe-pNA is a serine protease inhibitor that has been shown to inhibit chymotrypsin, elastase, and other serine proteases. It is benzoylated to protect it from proteolytic degradation in the gastrointestinal tract and can be used as a therapeutic treatment for inflammatory bowel disease, pancreatitis, or other chronic diseases. Ac-Ala-Ala-Pro-Phe-pNA can be inactivated by thermal treatment (e.g., boiling) or by chemical reduction (e.g., sodium borohydride).</p>Formula:C28H34N6O7Purity:Min. 95%Molecular weight:566.61 g/mol(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Controlled Product<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2·C12H23NPurity:Min. 95%Molecular weight:370.53 g/molZ-His(Z)-OH ethanol solvate
<p>Please enquire for more information about Z-His(Z)-OH ethanol solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H21N3O6Purity:Min. 95%Molecular weight:423.42 g/molMca-Amyloid β/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H129N27O28SPurity:Min. 95%Molecular weight:2,033.19 g/molH-Tyr-Gly-NH2·HCl
CAS:<p>Please enquire for more information about H-Tyr-Gly-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O3·HClPurity:Min. 95%Molecular weight:273.72 g/molBoc-N-Me-D-Tyr-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-N-Me-D-Tyr-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21NO5·C12H23NPurity:Min. 95%Molecular weight:476.65 g/molH-Lys-Glu-Gly-OH
CAS:<p>H-Lys-Glu-Gly-OH is a polyelectrolyte that has high affinity for cationic dyes. It is synthesized by the reaction of a protonated amino acid with an epoxide. This molecule has been shown to counter act the effect of polystyrene particles in experiments, which may be due to its ability to form complexes with other substances and decrease their solubility. H-Lys-Glu-Gly-OH has been used as a reagent in solid phase synthesis to prepare peptides and it also appears to be active against glutamic acid.</p>Formula:C13H24N4O6Purity:Min. 95%Molecular weight:332.35 g/mol(Tyr38,Phe42·46)-Osteocalcin (38-49) (human)
CAS:<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H101N19O17Purity:Min. 95%Molecular weight:1,516.7 g/molAcetyl-Neurotrophin Receptor (368-381) amide (human)
CAS:<p>Please enquire for more information about Acetyl-Neurotrophin Receptor (368-381) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H124N22O19Purity:Min. 95%Molecular weight:1,565.86 g/mol(β-Ala70)-C3a (70-77)
CAS:<p>Please enquire for more information about (Beta-Ala70)-C3a (70-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molExperimental Allergic Encephalitogenic Peptide (human)
CAS:<p>Experimental Allergic Encephalitogenic Peptide (human) H-Phe-Ser-Trp-Gly-Ala-Glu-Gly-Gln-Arg-OH is a protein that is used as an adjuvant to increase the immune response. It is composed of a string of amino acids that are recognized by the immune system, but do not elicit an immune response on their own. The peptide can be administered intracutaneously or in the form of a vaccine. This peptide has been shown to have a basic nature and has been found to have lethal effects when administered at high doses.</p>Formula:C46H64N14O14Purity:Min. 95%Molecular weight:1,037.09 g/molFibrinopeptide A (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>Formula:C63H97N19O26Purity:Min. 95%Molecular weight:1,536.56 g/molAbz-Ser-Pro-3-nitro-Tyr-OH
CAS:<p>Abz-Ser-Pro-3-nitro-Tyr-OH is a chromophobe peptide that is expressed in renal cell carcinomas. It is a potent inhibitor of all three major classes of proteases: serine, cysteine and aspartyl proteases. Abz-Ser-Pro-3-nitro-Tyr-OH inhibits the activity of peptidases, which are enzymes involved in protein degradation and turnover. Abz has been shown to inhibit the activity of intrarenal proteolytic enzymes, including endopeptidase, metallopeptidase and aminopeptidase activities. Abz also has been shown to inhibit the expression of markers on the surface of kidney cells and to reduce renal cell proliferation.</p>Formula:C24H27N5O9Purity:Min. 95%Molecular weight:529.5 g/molHippuryl-Lys-OH
CAS:<p>Hippuryl-Lys-OH is a novel, potent and selective serine protease inhibitor that targets human cathepsin B. It has been shown to have inhibitory properties against other serine proteases such as chymotrypsin, trypsin, and elastase. Hippuryl-Lys-OH is used in the treatment of cancer patients with diabetes who require a creatine level less than 400 μM per liter of serum. It also has potential applications in the treatment of Alzheimer's disease and Parkinson's disease due to its ability to inhibit polymerase chain reactions (PCR).</p>Formula:C15H21N3O4Purity:Min. 95%Molecular weight:307.35 g/mol(Ala6,D-Trp8,L-alaninol15)-Galanin (1-15)
CAS:<p>Please enquire for more information about (Ala6,D-Trp8,L-alaninol15)-Galanin (1-15) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H114N20O18Purity:Min. 95%Molecular weight:1,655.9 g/molH-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS:<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>Formula:C30H44N8O4Purity:Min. 95%Molecular weight:580.72 g/molLymnaDFamide-1
CAS:<p>LymnaDFamide-1 is a neuropeptide that belongs to the family of c-terminal peptides. It is a dipeptide with a sequence of L-Pro-Tyr-Asp-Arg-Ile-Ser-Asn-Ser-Ala-Phe. This peptide was found in the nervous system of invertebrates, where it is believed to play an important role in the regulation of neurotransmitter release. In mammals, LymnaDFamide has been detected in the brain and in the gallbladder. It may be involved in regulating feeding behavior and gastric motility.</p>Formula:C68H96N18O22Purity:Min. 95%Molecular weight:1,517.6 g/molH-Gly-Gly-pNA·HCl
CAS:<p>Please enquire for more information about H-Gly-Gly-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12N4O4·HClPurity:Min. 95%Molecular weight:288.69 g/molH-Gly-Leu-Tyr-OH
CAS:<p>H-Gly-Leu-Tyr-OH is a tripeptide that is found in some human and animal proteins. The peptide contains glycine, leucine, tyrosine, and hydroxyproline. It binds to copper ions with an inhibition constant of 1.5 x 10^5 M and has a pH optimum of 7.0. In the active form, it inhibits α subunit of bacterial aminopeptidase which is required for protein synthesis in bacteria. The peptide also has been shown to be a model system for the study of enzyme mechanisms and as a chromatographic method for analyzing proteins in food chemistry.</p>Formula:C17H25N3O5Purity:Min. 95%Molecular weight:351.4 g/molAmyloid β-Protein (1-42) hydrochloride salt
CAS:<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>Formula:C203H311N55O60SPurity:Min. 95%Molecular weight:4,514.04 g/mol(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt
CAS:<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>Formula:C109H163N25O32SPurity:Min. 95%Molecular weight:2,367.68 g/mol(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H69N9O11SPurity:Min. 95%Molecular weight:920.13 g/mol(Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H107N25O19S2Purity:Min. 95%Molecular weight:1,594.82 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Formula:C32H49N5O7•C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:675.81 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/molPhe-Leu-OH
CAS:<p>Phe-Leu-OH is an enzyme that has been found to be involved in the synthesis of meningococcal disease. In addition, it has been shown to have diagnostic potential for the detection of this disease. The enzyme is expressed on the surface of meningococci and produces a protein antigen which can be detected by the presence of antibodies in patient serum. Phe-Leu-OH is also involved in the synthesis of Phe-Leu amide, which may inhibit binding of inhibitor molecules to membrane channels. This activity may be related to its ability to cause a decrease in ion flow across cell membranes.</p>Formula:C15H22N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.35 g/molFmoc-N-methylglycine
CAS:<p>Fmoc-N-methylglycine is a modified form of the amino acid glycine, which has been modified to include a reactive group that can be used to link other molecules. This molecule has gram-negative bacterial activity and exhibits potent antibacterial activity against many gram-positive bacteria. Fmoc-N-methylglycine is also an antimicrobial peptide with binding constants in the nanomolar range. It is also an agent that binds to serotonin, which may explain its effects on mood and sleep. Fmoc-N-methylglycine can be synthesized using stepwise solid phase synthesis methods or by conjugation with other molecules.</p>Formula:C18H17NO4Purity:Min. 95%Molecular weight:311.33 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/molPerisulfakinin
CAS:<p>Perisulfakinin (PSK) is a cyclic peptide that has been isolated from the venom of the fly Phera insolita. PSK has a high affinity for protease activity and can be used as an inhibitor of proteases in control experiments. PSK is also an activator of cation channels and may be used as a neurotransmitter or neuromodulator in insects. The PSK peptide is present in dipteran species and can be seen by electron microscopy in their abdominal ganglia. PSK also activates Ca2+ influx into cells, which can lead to cell death. The PSK peptide is converted to cleavage products by enzymes, with bioassays being one way to measure these products.</p>Formula:C64H86N18O22S2Purity:Min. 95%Molecular weight:1,523.61 g/molMastoparan 17 (free acid)
CAS:<p>Please enquire for more information about Mastoparan 17 (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H131N19O16Purity:Min. 95%Molecular weight:1,494.91 g/molCyclo(-Pro-Thr)
CAS:<p>Cyclo(-Pro-Thr) is a cyclic peptide that is derived from the amino acid sequence of serotonin. Cyclo(-Pro-Thr) has been detected in human urine, and it is possible that this compound may be formed by the hydrolysis of serotonin by enzymes such as pipecolate oxidase. The presence of cyclo(-Pro-Thr) in human urine has been correlated with the occurrence of stomach ulcers, which are caused by substances such as famotidine and other proton pump inhibitors. Cyclo(-Pro-Thr) has also been found to inhibit the production of gamma-aminobutyric acid (GABA), which is an important neurotransmitter for controlling muscle tone, blood pressure, and anxiety.</p>Formula:C9H14N2O3Purity:Min. 95%Molecular weight:198.22 g/molCharacteristic MSH-Tetrapeptide
CAS:<p>The melanocortin-4 receptor (MC4R) is a G protein-coupled receptor that mediates the protective and cytoprotective activities of endogenous melanocortins. This receptor has been shown to be an important target for neuroprotective agents. The MC4R is expressed in the central nervous system, peripheral nervous system, and other tissues where it may have a role in regulating energy homeostasis. The N-terminal amino acid sequence of the human MC4R ligand is H-His-Phe-Arg-Trp-OH. This peptide has been shown to have potent agonist potency at the MC4R with a Kd of 0.2 nM and an EC50 of 2 nM.</p>Formula:C32H40N10O5Purity:Min. 95%Molecular weight:644.72 g/molAmyloid Bri Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H273N49O52S2Purity:Min. 95%Molecular weight:3,935.45 g/molZ-Gly-Pro-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H34N8O7·C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:642.66 g/mol(Tyr1)-TRAP-7 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-TRAP-7 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H67N11O10Purity:Min. 95%Molecular weight:922.08 g/molH-Lys-Tyr-OH acetate salt
CAS:<p>H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/molH-Glu-Ala-OH
CAS:<p>H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br>br><br>br>br><br>This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (</p>Formula:C8H14N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:218.21 g/molDiethyl (5-phenylisoxazol-3-yl) phosphate
CAS:<p>Diethyl (5-phenylisoxazol-3-yl) phosphate is a chlorpyrifos analog that is detectable in the blood and urine. The compound has been detected in red blood cells, plasma, serum, and urine samples at levels of 10 to 50 μg/L. Diethyl (5-phenylisoxazol-3-yl) phosphate can be used as an analytical method for detecting chlorpyrifos residue on food products or in environmental samples. Diethyl (5-phenylisoxazol-3-yl) phosphate is transfected into human hepatoma cells and activated by carbamate or propanil. It inhibits cellular protein synthesis by binding to the 30S ribosomal subunit, preventing the formation of the initiation complex between aminoacyl tRNA and mRNA. This binding also prevents peptide bond formation between amino acids, leading to cell death.</p>Formula:C13H16NO5PPurity:Min. 95%Molecular weight:297.24 g/mol2-Iodo-5-methoxybenzoic acid
CAS:<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>Formula:C8H7IO3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.04 g/molZ-Gly-Val-OH
CAS:<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formula:C15H20N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:308.33 g/molFarnesyl-Met-OMe
CAS:<p>Please enquire for more information about Farnesyl-Met-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H37NO2SPurity:Min. 95%Molecular weight:367.59 g/molcis-4-Hydroxy-D-proline
CAS:<p>Cis-4-Hydroxy-D-proline is a metabolite of the amino acid proline. It has been shown to have beneficial effects on heart function in vitro and in vivo, as well as on collagen synthesis. Cis-4-Hydroxy-D-proline was also shown to inhibit herpes simplex virus replication and to induce apoptosis in hepatocyte-like cells. The affinity constants for cis-4-Hydroxy-D-proline were determined by ph assays, kinetic data, and structural analysis. The optimum pH for cis-4-Hydroxy D proline is 8.0 and the hydroxyl group makes this molecule more soluble in water than other molecules with a similar chemical structure.</p>Formula:C5H9NO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:131.13 g/molHippocampal Cholinergic Neurostimulating Peptide
CAS:<p>Hippocampal Cholinergic Neurostimulating Peptide Ac-Ala-Ala-Asp-Ile-Ser-Gln-Trp-Ala-Gly-Pro-Leu is a peptide hormone that has been found in the hippocampus. It is a cholinergic neurotransmitter that is synthesized and secreted by neurons in the brain. It has been shown to have an effect on bowel disease, locomotor activity, and hippocampal formation. Hippocampal Cholinergic Neurostimulating Peptide Ac-Ala-Ala-Asp-Ile-Ser-Gln-Trp was first identified through biochemical analysis of rat brain tissue.</p>Formula:C53H79N13O17Purity:Min. 95%Molecular weight:1,170.27 g/molAc-Cys(farnesyl)-OH
CAS:<p>Ac-Cys(farnesyl)-OH is a synthetic chemical that has been shown to inhibit the growth of cells. It inhibits the enzyme form of farnesyl protein transferase, which is involved in the synthesis of basic proteins. Ac-Cys(farnesyl)-OH also binds to and inhibits epidermal growth factor receptor, which plays an important role in cell proliferation. In addition, this compound has been found to have anti-cancer properties. Ac-Cys(farnesyl)-OH has been shown to reduce the frequency of cellular transformation in vitro and in vivo. This effect may be due to its ability to inhibit protease activity.</p>Formula:C20H33NO3SPurity:Min. 95%Molecular weight:367.55 g/molAntho-RPamide III·HCl Pyr-Val-Lys-Leu-Tyr-Arg-Pro-NH2·HCl
CAS:<p>Please enquire for more information about Antho-RPamide III·HCl Pyr-Val-Lys-Leu-Tyr-Arg-Pro-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H68N12O9·HClPurity:Min. 95%Molecular weight:921.53 g/molFmoc-a-Me-D-Asp(OtBu)-OH
CAS:<p>Please enquire for more information about Fmoc-a-Me-D-Asp(OtBu)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27NO6Purity:Min. 95%Molecular weight:425.47 g/mol(Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molFmoc-Dap(Ac)-OH
CAS:<p>Fmoc-Dap(Ac)-OH is a fine chemical that is used as a building block in the synthesis of complex compounds. It reacts with various nucleophiles to form an amide bond, and has been shown to be useful for both research and industrial applications. Fmoc-Dap(Ac)-OH can also be used as a reagent to synthesize peptides, which are biologically active compounds that form the basis of many drugs. This versatile intermediate is also used as a scaffold in the construction of more complex molecules. Fmoc-Dap(Ac)-OH has CAS No. 181952-29-4 and is classified as a speciality chemical by the International Union of Pure and Applied Chemistry (IUPAC).</p>Formula:C20H20N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:368.38 g/molH-Arg(Pbf)-OtBu·HCl
CAS:<p>Please enquire for more information about H-Arg(Pbf)-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H38N4O5S·HClPurity:Min. 95%Color and Shape:PowderMolecular weight:519.1 g/mol(Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H286N54O56Purity:Min. 95%Molecular weight:4,222.63 g/molNesfatin-1 (30-59) (human) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H263N41O54Purity:Min. 95%Molecular weight:3,709.12 g/mol(Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molNeuropeptide Y (13-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (13-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H209N41O36Purity:Min. 95%Molecular weight:2,982.36 g/molSeminalplasmin Fragment (SPF) Analog
CAS:<p>Seminalplasmin Fragment (SPF) is a potent antibacterial agent that has been shown to inhibit the growth of Leishmania. It binds to the target cells, forming a covalent bond with the surface of the cell membrane. The SPF analog H-Pro-Lys-Leu-Leu-Lys-Thr-Phe-Leu-Ser-Lys-Trp-Ile-Gly-OH has been shown to have an increased antimicrobial spectrum due to its increased stability in acidic environments. This analog is also active against Gram positive bacteria and can be synthesized using cyclic peptide chemistry. This drug has been shown to have hemolytic activity, meaning that it inhibits red blood cell lysis by binding to phospholipids on the surface of red blood cells.</p>Formula:C76H123N17O16Purity:Min. 95%Molecular weight:1,530.89 g/moltrans-4-Benzyloxy-3-methoxy-β-nitrostyrene
CAS:<p>Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is an oxime that can be used as a catalyst for the catalytic hydrogenation of nitroalkanes. It is also a precursor to pallimamine, which is used as a pharmaceutical agent and an experimental virucide. Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is synthesized by coupling two indole carboxylic acid analogues in the presence of sodium hydroxide and potassium carbonate. The reaction yields trans-(4'-benzyloxy)-3'-methoxystyrene, which is then converted to the title compound with ammonium chloride and hydrochloric acid. This compound undergoes acidic hydrolysis to yield the title compound.</p>Formula:C16H15NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:285.29 g/molZ-Leu-Ala-OH
CAS:<p>Z-Leu-Ala-OH is a casein extract that has been processed by ultrafiltration to remove impurities. It is used in the diagnosis of dermatophyte infections and other diseases. Z-Leu-Ala-OH has been shown to inhibit the growth of Trichophyton mentagrophytes, an organism that causes skin infections, as well as the growth of some bacteria and fungi. In addition, this extract can be used to diagnose collagen diseases such as pancreatic disease and fibrinogen disorders.</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molH-Tyr-His-OH
CAS:<p>H-Tyr-His-OH is a trifluoroacetic acid derivative that is a histidine odorant. It can be used as a substitute for histidine in the detection of blood pressure, due to its ability to bind to nitric oxide and histidine receptors. H-Tyr-His-OH has been shown to have immunological properties, and it has been used as an immunogen in the production of monoclonal antibodies against human erythrocytes. H-Tyr-His-OH is also considered to be a potential biomarker because it can be detected by LC-MS/MS methods.</p>Formula:C15H18N4O4Purity:Min. 95%Molecular weight:318.33 g/molHippuryl-Gly-Gly-OH
CAS:<p>Hippuryl-Gly-Gly-OH is a small molecule that inhibits the growth of bacteria. It is an inhibitor of epidermal growth factor (EGF) that binds to EGF and blocks its ability to interact with cells. Hippuryl-Gly-Gly-OH also has anti-inflammatory properties and has been shown to be effective against inflammatory bowel disease in vitro. This drug also has been shown to inhibit the enzyme activities associated with inflammatory bowel disease, such as COX2 and iNOS, in human serum, as well as inhibiting the production of proinflammatory cytokines from human peripheral blood mononuclear cells.</p>Formula:C13H15N3O5Purity:Min. 95%Molecular weight:293.28 g/molH-Phe-D-Pro-OH·HCl
CAS:<p>Please enquire for more information about H-Phe-D-Pro-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18N2O3·HClPurity:Min. 95%Molecular weight:298.77 g/molFA-Phe-Ala-OH
CAS:<p>F-Phe-Ala-OH is a peptidyl amide that is ionizable at physiological pH. It has a constant and kinetic residue, as well as a hydrophobic, uncharged, and carboxypeptidase activity. F-Phe-Ala-OH catalyzes transpeptidation reactions between the amino acid residues of proteins. This reaction involves the elimination of one water molecule from the peptide bond to form an amine and an imine, which are then hydrolyzed to form the new peptide bond. The optimum pH for this catalysis is acidic.</p>Formula:C19H20N2O5Purity:Min. 95%Molecular weight:356.37 g/molFmoc-D-Arg(Pbf)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H146N24O23SPurity:Min. 95%Molecular weight:2,132.49 g/molFmoc-Cys(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H293N55O50Purity:Min. 95%Molecular weight:4,087.65 g/mol(D-Trp11)-Neurotensin acetate salt
CAS:<p>Acetate salt</p>Formula:C80H122N22O19Purity:Min. 95%Molecular weight:1,695.96 g/molH-Gly-Arg-Gly-Leu-Ser-Leu-Ser-Arg-OH
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Leu-Ser-Leu-Ser-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H64N14O11Purity:Min. 95%Molecular weight:844.96 g/molH-Ile-NHOH acetate salt
CAS:<p>H-Ile-NHOH acetate salt is an inhibitor of l-amino acid metabolism. It is a competitive inhibitor of the enzyme L-amino acid oxidase, which catalyzes the conversion of l-amino acids to alpha-keto acids and ammonia. H-Ile-NHOH acetate salt has been shown to inhibit the growth of wild type C. glutamicum in a molecular modeling study. In addition, this compound has been shown to block messenger RNA (mRNA) synthesis in a mutant strain of C. glutamicum that does not have the frameshifting mutation. H-Ile-NHOH acetate salt is also known to be an inhibitor of fatty acid biosynthesis by blocking the activity of acyl carrier protein synthetase and acyl carrier protein reductase.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/molBoc-Pro-Leu-Val-OMe
CAS:<p>Boc-Pro-Leu-Val-OMe is a peptide analog of Dolastatin 10 which has been shown to inhibit the production of ATP in mitochondria. The compound binds to the active site of bacterial topoisomerase IV, and this binding prevents the enzyme from cleaving DNA. Boc-Pro-Leu-Val-OMe is a small molecule that has an intramolecular structure, and it interacts with DNA to form a stable complex.</p>Formula:C22H39N3O6Purity:Min. 95%Molecular weight:441.56 g/mol(2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate
CAS:<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O4Purity:Min. 95%Molecular weight:244.29 g/mol(Met5,Pro6,D-Phe7,D-Trp9,Phe10)-α-MSH (5-13)
CAS:<p>(Met5,Pro6,D-Phe7,D-Trp9,Phe10)-a-MSH (5-13) is a fragment of alpha-MSH. It is produced by the coupling of 5 amino acids with a fatty acid at the C-terminus. This peptide has been found to have an anti aging effect on the skin due to its ability to stimulate the production of collagen and glycerin. It also has an active oxygen species that can activate tyrosinase and therefore increase melanin production. The enzyme tyrosinase is responsible for catalyzing the last step in the synthesis of melanin from dopaquinone. This compound may be used cosmetically or as a growth regulator in skincare products.</p>Formula:C61H87N15O9SPurity:Min. 95%Molecular weight:1,206.51 g/molH-Ala-Phe-Pro-bNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Phe-Pro-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H30N4O3·HClPurity:Min. 95%Molecular weight:495.01 g/molL-Tyrosine dipotassium
CAS:<p>L-Tyrosine dipotassium salt is a high quality, reagent, complex compound, useful intermediate and fine chemical. It is a useful scaffold that can be used in the synthesis of various important natural products. L-Tyrosine dipotassium salt is a versatile building block that has been widely applied in research on the development of new drugs, such as antiviral agents and antibiotics. L-Tyrosine dipotassium salt can act as a reaction component for many organic reactions. It also has applications in many areas such as medicine, food production, and environmental protection.</p>Formula:C9H11NO3•K2Purity:Min. 95%Molecular weight:259.39 g/molMca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H110N22O20Purity:Min. 95%Molecular weight:1,675.84 g/mol4-Amino-2-methylbenzoic acid
CAS:<p>4-Amino-2-methylbenzoic acid is a low molecular weight compound that has been shown to inhibit the neuraminidase enzyme. It interacts with the imine group of the enzyme and forms a covalent bond, which prevents the release of sialic acid from the terminal sugar residue of glycoproteins. The inhibition of this enzyme leads to decreased bacterial growth. 4-Amino-2-methylbenzoic acid has been shown to be active against Gram positive bacteria such as Staphylococcus aureus and Streptococcus pneumoniae, but not against Gram negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. This compound is also able to inhibit the synthesis of c-reactive protein (CRP) in human erythrocytes.</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/molSuc-Phe-Gly-Leu-betaNA
CAS:<p>Suc-Phe-Gly-Leu-betaNA is a synthetic peptide that has been shown to bind to glutathione, an antioxidant. It is used in a method for determining the concentration of antioxidants in a sample by injection into the gas phase. The chemical ionisation (CI) and electrospray ionisation (ESI) are used to produce ions from the peptide. The compounds are then separated using chromatography before being quantified by measuring their mass using a mass spectrometer. This process is repeated until all of the antioxidant has been eluted from the column.</p>Formula:C31H36N4O6Purity:Min. 95%Molecular weight:560.64 g/molBoc-Pen (NPys)-OH
CAS:<p>Please enquire for more information about Boc-Pen (NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N3O6S2Purity:Min. 95%Molecular weight:403.48 g/molMbs-D-Arg-OH
CAS:<p>Please enquire for more information about Mbs-D-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H20N4O5SPurity:Min. 95%Molecular weight:344.39 g/molH-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H84N18O8Purity:Min. 95%Molecular weight:1,029.29 g/mol4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt
CAS:<p>4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.</p>Formula:C23H34N6O6Purity:Min. 95%Molecular weight:490.55 g/molACTH (11-24)
CAS:<p>ACTH is a hormone that belongs to the class of endogenous peptides. It is synthesized and secreted by the anterior pituitary gland in response to adrenocorticotropic hormone (ACTH) from the hypothalamus. ACTH has a high affinity for cells with receptors for ACTH and has been shown to stimulate cyclase activity, leading to increased production of cAMP. ACTH also binds to membranes and micelles, which are lipid bilayers with hydrophobic regions. The binding of ACTH at these sites alters the physical properties of these structures by increasing their permeability or solubility. This leads to changes in their functions, including modulation of membrane-bound enzymes such as adenylate cyclase activity.</p>Formula:C77H134N24O16Purity:Min. 95%Molecular weight:1,652.04 g/mol(d(CH2)51,D-Ile2,Ile4,Arg8)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Gly-NH2 (Disulfid e bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Ile2,Ile4,Arg8)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Gly-NH2 (Disulfid e bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H77N13O10S2Purity:Min. 95%Molecular weight:1,072.35 g/molBz-Phe-Val-Arg-AMC hydrochloride salt
CAS:<p>Bz-Phe-Val-Arg-AMC is a synthetic substrate that is used to measure proteolytic activity. It has been shown to be hydrolyzed by serine proteases, such as trypsin and chymotrypsin, at a rate proportional to the enzyme's concentration. The rate of hydrolysis was determined using a kinetic assay in which the release of AMC from the peptide bond was measured using an ultraviolet spectrophotometer. Bz-Phe-Val-Arg-AMC has also been used to study the effects of various food additives on proteolytic activity. This test can be used as a diagnostic tool for inflammatory diseases, such as Crohn's disease and ulcerative colitis.</p>Formula:C37H43N7O6Purity:Min. 95%Molecular weight:681.78 g/molPhenserine
CAS:<p>Phenserine is a natural drug that is an ester hydrochloride. It has been shown to be effective in the treatment of Alzheimer's disease in clinical trials. Phenserine has also been found to inhibit acetylcholinesterase, an enzyme that breaks down the neurotransmitter acetylcholine. This inhibition leads to increased levels of acetylcholine, which can improve cognitive function and reduce neuronal death. The mechanism of action for phenserine is unknown, but it may involve a change in iron homeostasis or other biochemical reactions. Phenserine has not been tested on humans; however, it has shown promising results in animal studies.</p>Formula:C20H23N3O2Purity:Min. 95%Molecular weight:337.42 g/molZ-Leu-Gly-OH
CAS:<p>Z-Leu-Gly-OH is a peptide inhibitor of serine proteases. This peptide is a potential inhibitor of trypanosome proteinases, which are enzymes that cleave proteins into smaller pieces. Z-Leu-Gly-OH is a reversible inhibitor of mammalian proteinase and nitrile protease with a high affinity for the target enzyme.</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molFmoc-Asp-OAll
CAS:<p>Fmoc-Asp-OAll is a cyclic peptide that has been shown to be active against human cancer cell lines in vitro. Fmoc-Asp-OAll binds to integrin receptors, inhibiting the prostaglandin synthesis pathway and thus reducing inflammation. It also inhibits the activity of enzymes that are involved in inflammatory responses. Fmoc-Asp-OAll is synthesized on solid phase by chemical ligation.</p>Formula:C22H21NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:395.41 g/molH-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu-OH
CAS:<p>H-Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu-OH is a peptide that is an activator of casein kinase II. Casein kinase II is a serine/threonine protein kinase that plays an important role in the regulation of cell proliferation and differentiation, apoptosis, and immune response. It has been shown to be involved in restenosis after angioplasty, as well as in tumorigenesis and radiation therapy. H-Arg-Arg-Glu-Glu-Glu-Thr-Glu - Glu - Glu - OH has also been shown to inhibit the replication of influenza virus by interfering with viral transcription and viral maturation. This peptide has been used for the treatment of alopecia, which may be due to its ability to inhibit hair follicle growth.</p>Formula:C46H75N15O23Purity:Min. 95%Molecular weight:1,206.18 g/mol(Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H86N16O13Purity:Min. 95%Molecular weight:1,251.44 g/molFmoc-Leu-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Leu-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Lauroyl-glycine
CAS:<p>Lauroyl-glycine is a fatty acid with a long acyl chain. It is an intermediate in the synthesis of lauric acid, which is used in the production of detergents and soaps. Lauroyl-glycine has been shown to be useful as a model system for skin condition studies due to its detergent properties.</p>Formula:C14H27NO3Purity:Min. 95%Molecular weight:257.37 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H270N48O51S2Purity:Min. 95%Molecular weight:4,046.55 g/mol1-Methylethyl N-((S)-(((1R)-2-(6-amino-9H-purin-9-yl)-1-methylethoxy)methyl)phenoxyphosphinoyl)-L-alaninate
CAS:<p>Tenofovir is a nucleoside analog reverse transcriptase inhibitor that binds to the RNA-dependent polymerase. This compound is used in combination with other antiviral agents for the treatment of HIV-1 infection and for prophylaxis against HIV-1 infection. Tenofovir has been shown to be effective against infections caused by strains of HIV-1, such as the drug resistant virus. Tenofovir is absorbed rapidly after oral administration, with a bioavailability of over 80%. The prodrug fumarate is hydrolyzed to tenofovir in vivo and this conversion occurs more efficiently in acidic conditions. Alafenamide, a prodrug of tenofovir, has been approved by the FDA as an alternative to tenofovir disoproxil fumarate (TDF) for the treatment of HIV-1 infection. Alafenamide is an acyclic nucleoside phosphonate that inhibits viral replication by inhibiting reverse</p>Formula:C46H62N12O14P2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,069 g/molH-Lys(Boc)-OH
CAS:<p>H-Lys(Boc)-OH is an ε-amino-protected lysine that plays a pivotal role in solution phase peptide synthesis. Strategically protected at the ε-amino group, it allows controlled peptide assembly, and it serves as intermediate for synthesizing β-peptides. The bulky Boc (tert-butyloxycarbonyl) group shields its epsilon amine (NH2) group, acting as a protective measure to prevent unwanted side reactions.</p>Formula:C11H22N2O4Color and Shape:White PowderMolecular weight:246.3 g/molH-Asp-Ala-OH
CAS:<p>Adriamycin is an anticancer drug that is a structural analogue of aspartic acid. It can be synthesized in a solid-phase synthesis using a polymeric resin with an acidic functional group, such as H-Asp-Ala-OH. Adriamycin inhibits the production of inflammatory cytokines and prostaglandins, which are involved in the development of inflammatory diseases. Adriamycin has been shown to have anti-inflammatory effects on human serum and to inhibit the production of proteins important for tumor cell proliferation. Adriamycin also has anti-inflammatory properties due to its ability to bind with hydrogen bonds to acidic residues on proteins.<br>END></p>Formula:C7H12N2O5Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:204.18 g/molH-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C24H50N16O5Purity:Min. 95%Molecular weight:642.76 g/molAc-Phe-Trp-OH
CAS:<p>Please enquire for more information about Ac-Phe-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23N3O4Purity:Min. 95%Molecular weight:393.44 g/molProcollagen Type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH
CAS:<p>Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is a tetrapeptide that is the most abundant component of human skin. It has been shown to have biological properties and can be synthesized in vitro. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH has an absorption maximum at 265 nm, which makes it suitable for use in uv protection creams. It also has a high chemical stability and can be stored for up to two years without degradation. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is used as a substrate in cell culture to study protein synthesis and transcription, or polymerase chain reaction, technique. This peptide also inhibits the activity of proteases such as trypsin and chymotrypsin, making</p>Formula:C23H45N7O9Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:563.65 g/molMCLV3 trifluoroacetate salt
CAS:<p>Please enquire for more information about MCLV3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H89N19O19Purity:Min. 95%Molecular weight:1,344.43 g/molThrombin B-Chain (147-158) (human)
CAS:<p>Please enquire for more information about Thrombin B-Chain (147-158) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H84N16O18Purity:Min. 95%Molecular weight:1,245.34 g/mol(Pyr 5,N-Me-Phe8, Sar 9)-Substance P (5-11)
CAS:<p>Senktide is a substance P analog that has been shown to produce tail-flick responses in animals. The maximum response of the tail-flick test can be enhanced by the administration of either dopamine or serotonin. Inhibition of metabolism is likely to be responsible for these effects, as demonstrated by experiments in Sprague-Dawley rats. Senktide is an experimental model for studying the role of substance P in the regulation of blood pressure and locomotor activity. This compound also has pressor properties that are similar to those of dopamine and serotonin, which may be due to its ability to stimulate alpha-adrenergic receptors and inhibit dopaminergic neurons via a presynaptic mechanism.</p>Formula:C43H61N9O9SPurity:Min. 95%Molecular weight:880.07 g/mol(Nle 8·21,Tyr34)-pTH (1-34) amide (rat)
CAS:<p>Please enquire for more information about (Nle 8·21,Tyr34)-pTH (1-34) amide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H296N56O48Purity:Min. 95%Molecular weight:4,036.65 g/molBoc-D-His(3-Bom)-OH
CAS:<p>Please enquire for more information about Boc-D-His(3-Bom)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H25N3O5Purity:Min. 95%Molecular weight:375.42 g/molH-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl
CAS:<p>H-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl is a monoclinic crystalline compound. It has a molecular weight of 607.14 and contains the dipeptide Tyr-Lys in its structure. H-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl crystallizes in the P21/c space group and has an asymmetric unit cell with dimensions a=8.851 Å, b=7.965 Å and c=5.98 Å. This compound has been shown to have antibacterial properties against methicillin resistant Staphylococcus aureus (MRSA) isolates and Clostridium perfringens strains by inhibiting bacterial protein synthesis through inhibition of peptidyl transferase activity.</p>Formula:C19H21N3O3·HClPurity:Min. 95%Molecular weight:375.85 g/molN-α-Z-L-lysine methyl ester hydrochloride
CAS:<p>N-alpha-Z-L-lysine methyl ester hydrochloride is a preparation that is used as a methyl ester. It is an ester of lysine and methyl chloride. This product has a molecular weight of 170.16 g/mol and the chemical formula CH3CONHCH2CH(NH)CO2CH3. The structural data has not been confirmed by X-ray crystallography, but it can be assumed to be in the form of a zwitterion. N-alpha-Z-L-lysine methyl ester hydrochloride can be used for the synthesis of peptides, which are building blocks for proteins and enzymes. N-alpha-Z-L-lysine methyl ester hydrochloride is also used in the production of certain kinds of drugs and organic acids such as acetylsalicylic acid (aspirin).</p>Formula:C15H22N2O4·HClPurity:Min. 95%Molecular weight:330.81 g/molL-Tyrosine ethyl ester hydrochloride
CAS:<p>L-Tyrosine ethyl ester hydrochloride is a non-protein amino acid that inhibits the activity of metalloproteases, which are enzymes that break down proteins. It has been shown to be effective against bowel disease and cancer by inhibiting the release of inflammatory cytokines. L-Tyrosine ethyl ester hydrochloride also has anti-inflammatory properties and can be used in the treatment of depression and liver cirrhosis. This drug is an inhibitor of hydroxylase, which is an enzyme involved in the synthesis of melanin. It is a structural analogue to L-DOPA, which is used for Parkinson's disease. L-Tyrosine ethyl ester hydrochloride has been shown to have antihypertensive effects and can be used as a diuretic agent.</p>Formula:C11H15NO3·HClPurity:Min. 95%Color and Shape:PowderMolecular weight:245.7 g/molH-Tyr-Leu-OH
CAS:<p>H-Tyr-Leu-OH is a peptide that has been shown to have regulatory effects on the synthesis of dopamine and 5-hydroxytryptamine (5HT), which is responsible for mood, appetite, and sleep. H-Tyr-Leu-OH is an orally active compound that has antidepressant-like activity in animals. It has also been shown to have antiobesity effects by regulating the secretion of proctolin from the pancreas. H-Tyr-Leu-OH has a pH optimum of 7, which is neutral. This compound can be used in cell culture experiments to study the effect of pH on enzyme preparations.</p>Formula:C15H22N2O4Purity:Min. 95%Molecular weight:294.35 g/mol3,5-Diiodo-L-tyrosine
CAS:<p>3,5-Diiodo-L-tyrosine (3DILT) is an iodinated amino acid that can be used as a marker for human immunodeficiency virus (HIV) infection. It is synthesized by the reaction of 3,5-diiodotyrosine with L-tyrosine in the presence of a metal chelate and dinucleotide phosphate. This reaction proceeds via nucleophilic substitution on the aromatic ring with an iodide ion. The product is then purified to remove unreacted 3,5-diiodotyrosine and the metal chelate. 3DILT reacts with antibodies in a luminescence immunoassay to produce light that can be detected. The detection limit of this assay is 10 pg/mL.</p>Formula:C9H9I2NO3Purity:Min. 95%Molecular weight:432.98 g/molFmoc-4-(7-hydroxy-4-coumarinyl)-Abu-OH
CAS:<p>Please enquire for more information about Fmoc-4-(7-hydroxy-4-coumarinyl)-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H23NO7Purity:Min. 95%Molecular weight:485.48 g/molFmoc-Arg(Mtr)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Arg(Mtr)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Met-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Met-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H66N6O11SPurity:Min. 95%Molecular weight:851.06 g/molFmoc-Pro-Pro-Pro-Pro-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-Pro-Pro-Pro-Pro-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H47N5O8Purity:Min. 95%Molecular weight:725.83 g/mol(Ser4,Ile8)-Oxytocin
CAS:<p>Oxytocin is a neuropeptide hormone that regulates social behavior and the body's response to stress. It is produced by the hypothalamus, stored in the posterior pituitary gland, and released into the bloodstream. Oxytocin has been shown to regulate the release of prolactin from the anterior pituitary gland, as well as stimulate uterine contractions during labor. Oxytocin also plays a role in regulating blood pressure and vasopressin secretion. The activity of oxytocin is regulated by a number of factors including detection sensitivity, polyclonal antibodies, monoclonal antibodies, polymerase chain reaction (PCR), effective dose, salinity, neurosecretory sequences, and regulatory sequences such as linear regression analysis. Oxytocin has also been shown to have physiological activities including regulation of water balance through antidiuretic effects and modulation of appetite through action on receptors for ghrelin. Oxytocin is an endogenous molecule with a molecular weight of 3</p>Formula:C41H63N11O12S2Purity:Min. 95%Molecular weight:966.14 g/molPhylloseptin-L2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H126N18O19Purity:Min. 95%Molecular weight:1,595.92 g/molBoc-His(Trt)-OH
CAS:<p>Boc-His(Trt)-OH is a chemical compound that has been used in the laboratory to study uptake and binding of compounds. It is stable in complex with albumin, which has led to its use as a model system for studying hepatic steatosis. This chemical can be synthesized by solid-phase synthesis with trifluoroacetic acid and polypeptide synthesis. FT-IR spectroscopy has been used to characterize Boc-His(Trt)-OH, revealing its chemical diversity.</p>Formula:C30H31N3O4Purity:Min. 95%Color and Shape:PowderMolecular weight:497.58 g/molDynorphin A (1-9)
CAS:<p>Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-OH is a substrate binding inhibitor that blocks potassium channels. Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu Arg Arg Ile Arg OH binds to the d -alanine site of the potassium channel and inhibits glutamate release from presynaptic terminals. Dynorphin A (1 9) H Tyr Gly Gly Phe Leu Arg Arg Ile Arg OH has been shown to be a potent inhibitor of aminopeptidase activity in vitro, which may be due to its affinity for the substrate binding site on the enzyme. Its inhibition of aminopeptidase activity may lead to an increase in opioid peptides such as dynorphins and enkephalins. Dynorphin A (1 9) H Tyr Gly Gly Phe</p>Formula:C52H84N18O11Purity:Min. 95%Molecular weight:1,137.34 g/molH-2,6-Difluoro-Phe-OH·HCl
CAS:<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H9F2NO2·HClPurity:Min. 95%Molecular weight:237.63 g/molAc-Thr-Leu-Asn-Phe-OH
CAS:<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>Formula:C25H37N5O8Purity:Min. 95%Molecular weight:535.59 g/molH-Ala-Ala-pNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Ala-Ala-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N4O4Purity:Min. 95%Molecular weight:280.28 g/molAcetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH
CAS:<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N17O15Purity:Min. 95%Molecular weight:1,338.51 g/molBoc-Ser(Ile-Fmoc)-OH
CAS:<p>Boc-Ser(Ile-Fmoc)-OH is a peptide synthesis reagent that can be used for the efficient and convenient preparation of peptides. It is a synthetic, non-natural amino acid that has been synthesized by the chemists at Pfizer. Boc-Ser(Ile-Fmoc)-OH is an epimer of natural L-serine and has been shown to be more soluble than L-serine making it easier to work with. This reagent can also be used in the synthesis of biomolecules such as proteins and nucleic acids. The chemistry behind this compound has been published in the journal Biomolecular Chemistry.</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/molH-Arg-D-Asp-OH
CAS:<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N5O5Purity:Min. 95%Molecular weight:289.29 g/molAmyloid β-Protein (1-37) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-37) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H274N50O55SPurity:Min. 95%Molecular weight:4,074.49 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molH-Asp-Phe-NH2
CAS:<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>Formula:C13H17N3O4Purity:Min. 95%Molecular weight:279.29 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Formula:C23H38N6O5·2HClPurity:Min. 95%Molecular weight:551.51 g/molNα-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide
CAS:<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>Formula:C12H15FN4O5Purity:Min. 95%Color and Shape:Off-White To Yellow SolidMolecular weight:314.27 g/molH-Gly-Phe-bNA
CAS:<p>H-Gly-Phe-bNA is a dinucleotide phosphate that is activated by phosphatase to form an active nucleotide. This nucleotide inhibits the polymerase chain reaction (PCR) by binding to the template DNA strand and preventing the addition of nucleotides by the DNA polymerase. The monoclonal antibody recognizes H-Gly-Phe-bNA and binds it in a radioactive assay, inhibiting the activity of this dinucleotide phosphate. Radiation causes H-Gly-Phe-bNA to produce reactive oxygen species, which can induce DNA damage or cause cell death. This nucleotide also has an acidic pH optimum for its activity, making it useful in acidic environments such as lysosomes. H-Gly-Phe-bNA also binds to cation channels and is localized primarily in the cytosol, with some found in mitochondria or microsomes. It also has a high affinity for calcium ions</p>Formula:C21H21N3O2Purity:Min. 95%Molecular weight:347.41 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/molMethyltetrazine amine
CAS:<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>Formula:C10H11N5Purity:Min. 95%Color and Shape:PowderMolecular weight:201.23 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molH-DL-Ala-DL-Ala-OH
CAS:<p>H-DL-Ala-DL-Ala-OH is a chemical that belongs to the group of amides. It has been shown to have an inhibitory effect on the growth of bacteria in vitro. The molecular weight and stability of H-DL-Ala-DL-Ala-OH are greater than those of vancomycin, which may be due to its higher nitrogen content. This chemical can be used as a model system for studying the reaction mechanism and structure of vancomycin, including the formation of intramolecular hydrogen bonds and carbonyl oxygens. H-DL-Ala-DL-Ala-OH also has antibiotic properties that are similar to penicillin.</p>Formula:C6H12N2O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:160.17 g/molBz-Arg-OMe carbonate salt
CAS:<p>Bz-Arg-OMe carbonate salt is a protease inhibitor that binds to the active site of serine proteases, inhibiting their activity. Bz-Arg-OMe carbonate salt has been shown to have inhibitory effects on Leishmania, a protozoan parasite. It is also an inhibitor of fibrinolysis, which may be due to its ability to bind calcium ions and serum albumin. Bz-Arg-OMe carbonate salt has affinity for carbohydrates and interacts with peptides.</p>Formula:C14H20N4O3Purity:Min. 95%Molecular weight:292.33 g/molAcetyl-Amylin (8-37) (mouse, rat)
CAS:<p>Please enquire for more information about Acetyl-Amylin (8-37) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O44Purity:Min. 95%Molecular weight:3,242.6 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molOsteostatin amide trifluoroacetate
CAS:<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O57•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,450.59 g/molH-Lys(Boc)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Atriopeptin III (rat)
CAS:<p>Atriopeptin III is a peptide hormone that belongs to the atrial natriuretic peptide group. It is an analog of atrial natriuretic peptide (ANP), which regulates blood pressure and sodium excretion, and has minimal toxicity. The disulfide bond between Cys-Cys and Cys-Gly on the N terminus of Atriopeptin III is necessary for its activity. The enzyme responsible for this disulfide bond formation is thioredoxin reductase, which is found in the cytoplasm of cells. Atriopeptin III has been shown to inhibit cyclase activity in renal proximal tubular cells, as well as congestive heart failure in rats. It also inhibits fatty acid synthesis by inhibiting carnitine acyltransferase I, leading to increased levels of free fatty acids and diacylglycerols in the blood plasma.</p>Formula:C107H165N35O34S2Purity:Min. 95%Molecular weight:2,549.8 g/mol1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>Formula:C28H56NO7PPurity:Min. 95%Molecular weight:549.72 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/mol
