
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,472 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38263 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
4-Bromo-3-methoxypyridine
CAS:<p>Please enquire for more information about 4-Bromo-3-methoxypyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6BrNOPurity:Min. 95%Molecular weight:188.02 g/molHistatin-8
CAS:<p>Please enquire for more information about Histatin-8 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H99N25O17Purity:Min. 95%Molecular weight:1,562.69 g/molIL-8 Inhibitor
CAS:<p>IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.</p>Formula:C45H66N18O7SPurity:Min. 95%Molecular weight:1,003.19 g/molH-Trp-Asp-OH trifluoroacetic acid
CAS:<p>H-Trp-Asp-OH trifluoroacetic acid is a protein that is localized in the kinase domain of the gene product. It has been shown to activate leishmania and human serum regulatory proteins. H-Trp-Asp-OH trifluoroacetic acid binds to guanine nucleotide binding proteins in the nuclear DNA, which may play a role in mitotic checkpoint control. This protein has also been shown to have basic properties and may be involved in plant metabolism.</p>Formula:C17H18N3O7F3Purity:Min. 95%Molecular weight:319.31 g/mol(Des-Tyr1)-Leu-Enkephalin
CAS:<p>Des-Tyr1-Leu-Enkephalin H-Gly-Gly-Phe-Leu-OH is a synthetic opioid peptide that acts as a neuroprotective agent and has been shown to enhance the expression of nerve growth factor. It also has immunomodulatory effects by interacting with opioid receptors and regulating the production of inflammatory cytokines. Des-Tyr1-Leu-Enkephalin H-Gly-Gly-Phe-Leu-OH binds to opioid receptors in the central nervous system, thereby triggering a response that leads to pain relief and suppression of cough reflexes. This peptide has been shown to be effective in clinical trials for patients with neuropathic pain or postoperative ileus. It also shows promise as an analgesic for cancer patients with chronic pain, although this use is still experimental.</p>Formula:C19H28N4O5Purity:Min. 95%Molecular weight:392.45 g/molH-Cys(Fm)-OH
CAS:<p>Please enquire for more information about H-Cys(Fm)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H17NO2SPurity:Min. 95%Molecular weight:299.39 g/mol(Nle 8·18,Tyr34)-pTH (7-34) amide (bovine)
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (7-34) amide (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C158H248N48O49Purity:Min. 95%Molecular weight:3,603.95 g/molL-Alanine ethyl ester HCl
CAS:<p>L-Alanine ethyl ester HCl is a compound that belongs to the group of amino acids. It is an aliphatic, non-essential amino acid that is classified as a non-polar and hydrophobic amino acid. L-Alanine ethyl ester HCl has been shown to have biological properties that are similar to those of L-alanine on tissue culture cells, including receptor activity and protein synthesis. L-Alanine ethyl ester HCl also has antiviral properties against infectious bacteria such as Escherichia coli and chlamydia, which may be due to its ability to inhibit the synthesis of bacterial proteins required for replication. L-Alanine ethyl ester HCl can be used in wastewater treatment as it reacts with hydrochloric acid in water to produce salt and ethanol.</p>Formula:C5H11NO2·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:153.61 g/molH-Ile-Arg-OH acetate salt
CAS:<p>H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/mol(Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H287N55O57SPurity:Min. 95%Molecular weight:4,285.71 g/molDynorphin A (1-10) amide
CAS:<p>Dynorphin A (1-10) amide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2 is an analog of dynorphin A. It is a peptide that has been shown to be effective in reducing blood pressure and stress levels in animals. Dynorphin A (1-10) amide H-Tyr-Gly-Gly-Phe-Leu-Arg - Arg - Ile - Arg - Pro - NH2 also has analgesic properties and may be useful for the treatment of cardiac diseases.</p>Formula:C57H92N20O11Purity:Min. 95%Molecular weight:1,233.47 g/molFmoc-Lys(Boc)-Thr(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Thr(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H43N3O8Purity:Min. 95%Molecular weight:609.71 g/molAc-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H66N12O9Purity:Min. 95%Molecular weight:871.04 g/molSuc-Ala-Ala-Pro-Phe-2,4-difluoroanilide
CAS:<p>Please enquire for more information about Suc-Ala-Ala-Pro-Phe-2,4-difluoroanilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H35F2N5O7Purity:Min. 95%Molecular weight:615.63 g/mol4-(4-Phenylbutoxy)benzoic acid
CAS:<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>Formula:C17H18O3Purity:Min. 95%Molecular weight:270.32 g/molLIP2 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H288N58O58Purity:Min. 95%Molecular weight:4,240.61 g/mol3-Methyldihydrofuran-2,5-dione
CAS:<p>3-Methyldihydrofuran-2,5-dione is a diterpenoid alkaloid found in the plant Dictamnus albus. This compound has been shown to have metal chelating properties and can be used as an asymmetric synthesis intermediate. 3-Methyldihydrofuran-2,5-dione reacts with diazonium salt to form a high resistance molecule that is highly reactive. This chemical reacts with hydroxyl groups, amide groups, or methyl ethyl groups. The structure of this compound consists of nitrogen atoms and anhydride bonds. 3-Methyldihydrofuran-2,5-dione has been shown to exhibit electrochemical impedance spectroscopy (EIS) characteristics similar to those of other molecules that are known to be reactive.</p>Formula:C5H6O3Purity:Min. 95%Molecular weight:114.1 g/molZ-Leu-Phe-NH2
CAS:<p>Please enquire for more information about Z-Leu-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H29N3O4Purity:Min. 95%Molecular weight:411.49 g/molH-Lys(2-chloro-Z)-OBzl·HCl
CAS:<p>Please enquire for more information about H-Lys(2-chloro-Z)-OBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H25ClN2O4·HClPurity:Min. 95%Molecular weight:441.35 g/mol(D-Lys(nicotinoyl)1,b-(3-pyridyl)-Ala3,3,4-dichloro-D-Phe5,Asn6,D-Trp7·9, Nle 11)-Substance P trifluoroacetate salt
CAS:<p>Substance P is a tachykinin neuropeptide that belongs to the tachykinin family. It is found in the central and peripheral nervous system and has been shown to have an important role in locomotor activity, protein synthesis, receptor activity, and neurotransmitter release. Substance P is also associated with a number of diseases such as infectious diseases, sciatic nerve pain, and vasoactive intestinal peptide (VIP) production. This substance has been used for the diagnosis of neurogenic bladder dysfunction by measuring its effects on urinary bladder contractility.</p>Formula:C86H104Cl2N18O13Purity:Min. 95%Molecular weight:1,668.76 g/molZ-Trp-NH2
CAS:<p>Please enquire for more information about Z-Trp-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H19N3O3Purity:Min. 95%Molecular weight:337.37 g/molH-Phe-AMC trifluoroacetate salt
CAS:<p>H-Phe-AMC Trifluoroacetate salt is a synthetic, protease inhibitor that inhibits the activity of serine and cysteine proteases. It binds to the active site of these enzymes and blocks their function. H-Phe-AMC trifluoroacetate salt has been used in food chemistry to hydrolyze proteins, and can be used to measure enzyme activities. This product also has been shown to have biological functions such as the inhibition of molting, physiological function, and the prevention of carcinogenesis.</p>Formula:C19H18N2O3Purity:Min. 95%Molecular weight:322.36 g/molH-Met-Glu-OH
CAS:<p>H-Met-Glu-OH is a synthetic substance that inhibits the activity of cytochrome P450. It binds to cells, specifically platelets, and causes degranulation and activation of calcium ion channels. This leads to an increase in intracellular calcium ions that triggers blood clotting. H-Met-Glu-OH has been shown to be effective in treating cardiovascular diseases such as high blood pressure and heart arrhythmia. Clopidogrel is often used with H-Met-Glu-OH to prevent platelet aggregation, which would otherwise block the effectiveness of H-Met-Glu-OH.<br>H-Met-Glu has a high affinity for collagen and binds more efficiently to platelets than other cell types. This binding is reversible, which allows for repeated doses without causing toxicity or adverse effects on healthy cells.</p>Formula:C10H18N2O5SPurity:Min. 95%Molecular weight:278.33 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH is a peptide that has been shown to have chemotactic activity for monocytes and polymorphonuclear leucocytes, which are cells that participate in the inflammatory response. It also has biological properties that are reactive with hydroxyl groups and can be used to generate monoclonal antibodies. H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH has been shown to stimulate the migration of galleria mellonella larvae, suggesting it may have potential as an antiinflammatory agent.</p>Formula:C28H49N11O11Purity:Min. 95%Molecular weight:715.76 g/molBoc-L-valine
CAS:<p>Boc-L-Valine is a model system for the synthesis of peptides. This compound is synthesized in a liquid phase and then purified by column chromatography. It has an antimicrobial activity against Gram-positive bacteria such as Staphylococcus aureus and Escherichia coli, but not against Gram-negative bacteria such as Proteus vulgaris or Pseudomonas aeruginosa. Boc-L-Valine is also used to study the binding of inhibitors and ferrocenes.</p>Formula:C10H19NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:217.3 g/molH-Ala-Phe-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Phe-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H20N4O4·HClPurity:Min. 95%Molecular weight:392.84 g/molAnantin (linear sequence) trifluoroacetate salt
CAS:<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H113N21O25Purity:Min. 95%Molecular weight:1,888.99 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N4O5Purity:Min. 95%Molecular weight:302.33 g/molH-Gly-Arg-Gly-Glu-Thr-Pro-OH
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Thr-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H41N9O10Purity:Min. 95%Molecular weight:615.64 g/molH-D-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-D-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molBoc-L-β-homoleucine
CAS:<p>Please enquire for more information about Boc-L-beta-homoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23NO4Purity:Min. 95%Molecular weight:245.32 g/molFmoc-Lys(Boc)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Arg-Arg-bNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H39N9O4Purity:Min. 95%Molecular weight:589.69 g/molZ-Asp-Glu-Val-Asp-chloromethylketone
CAS:<p>Z-Asp-Glu-Val-Asp-chloromethylketone is a reactive compound that inhibits the activity of proteases and induces neuronal death. Z-Asp-Glu-Val-Asp-chloromethylketone has been shown to induce necrotic cell death in malignant brain cells and has neurotrophic properties. It also causes mitochondrial membrane depolarization, which leads to mitochondrial cytochrome c release and subsequent apoptosis. The reaction mechanism is still unclear but it may involve hydrogen bonding between the ketone group and the amide nitrogen atom of the aspartate residue.</p>Formula:C27H35ClN4O12Purity:Min. 95%Molecular weight:643.04 g/molH-Arg-Ala-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Ala-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H20N6O2·2HClPurity:Min. 95%Molecular weight:317.22 g/molH-Thr-Lys-Tyr-OH
CAS:<p>H-Thr-Lys-Tyr-OH is a synthetic peptide that has been used in the research of antigen, antibody and sequence. The intramolecular bond between the amino acids H-Thr-Lys-Tyr-OH has been shown to be stable up to pH 8.5 and alkaline conditions, making it suitable for use in a variety of different experiments. This peptide has also been used as an immunogen to generate antibodies against specific antigens or as a probe for sequence analysis.</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/molBz-Arg-betaNA·HCl
CAS:<p>Bz-Arg-betaNA·HCl is a fluorescent probe that binds to the active site of esterases. The fluorescence signal intensity is proportional to the amount of enzyme present and can be used for measuring the activity of esterases in vitro or in vivo. Bz-Arg-betaNA·HCl has been shown to have high specificity for esterases, with low affinity for other enzymes, such as proteases.</p>Formula:C23H25N5O2·HClPurity:Min. 95%Molecular weight:439.94 g/molFmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H36N2O8Purity:Min. 95%Color and Shape:PowderMolecular weight:552.62 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Formula:C81H156N10O13SPurity:Min. 95%Molecular weight:1,510.23 g/molH-Tyr-Gly-Arg-Phe-Ser-OH·HCl
CAS:<p>Please enquire for more information about H-Tyr-Gly-Arg-Phe-Ser-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40N8O8·HClPurity:Min. 95%Molecular weight:665.14 g/molH-D-Val-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Leu-Ser-Phe-OH
CAS:<p>H-Leu-Ser-Phe-OH is a synthetic molecule that is a serine protease. It has been shown to have phosphatase activity, which can be used in the processing of milk proteins. This enzyme can also be used in the production of acid casein and colostrum. The enzyme has been shown to convert aspartic acid into asparagine, which is then converted into aminosugars such as melamine and phenylalanine. H-Leu-Ser-Phe-OH can be used for the treatment of fibrinogen deficiency, with its ability to cleave fibrinogen at the γ site. The enzyme has also been shown to have an effect on blood coagulation by cleaving fibrinogens at the γ site, thus preventing clot formation.</p>Formula:C18H27N3O5Purity:Min. 95%Molecular weight:365.42 g/molFor-Met-Leu-p-iodo-Phe-OH
CAS:<p>Please enquire for more information about For-Met-Leu-p-iodo-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30IN3O5SPurity:Min. 95%Molecular weight:563.45 g/molH-Cys(Acm)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Ala-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about Boc-Ala-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H24N4O7Purity:Min. 95%Molecular weight:360.36 g/mol(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone
CAS:<p>(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone is an organic compound that has been shown to induce apoptosis in prostate cancer cells. The mechanism of this induction is not yet fully understood, but it may be due to the inhibition of the synthesis of proteins required for cell division. It also had a significant effect on locomotor activity in mice. This compound has been shown to have acute toxicities, and its phase transition temperature is below room temperature. It can be used as a fumigant and an inorganic acid, and it has been proposed as a potential fluorescence probe for natural compounds.</p>Purity:Min. 95%Acetyl-Hirudin (54-65) (sulfated)
CAS:<p>Please enquire for more information about Acetyl-Hirudin (54-65) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H95N13O29SPurity:Min. 95%Color and Shape:PowderMolecular weight:1,590.62 g/molFmoc-Val-Pro-OH
CAS:<p>Fmoc-Val-Pro-OH is a low molecular weight amino acid that has anticoagulant properties. It is synthesized by activating the carboxylic acid group of pipecolic acid with an N,N'-dicyclohexylcarbodiimide (DCC) activated ester of thiazolidinecarboxylic acid and then reacting it with a basic amino acid. The resulting product is a peptide consisting of Val, Pro, and OH groups. This compound has been shown to inhibit blood clotting in rats and rabbits. Fmoc-Val-Pro-OH also has been shown to be effective in preventing postoperative blood clots in dogs undergoing surgery for repair of cranial cruciate ligament rupture.</p>Formula:C25H28N2O5Purity:Min. 95%Molecular weight:436.5 g/molBoc-Gly-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Gly-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(His(1-Me)2)-TRH Pyr-His(1-Me)-Pro-NH2
CAS:<p>Please enquire for more information about (His(1-Me)2)-TRH Pyr-His(1-Me)-Pro-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H24N6O4Purity:Min. 95%Molecular weight:376.41 g/molH-Met-Phe-Gly-OH
CAS:<p>H-Met-Phe-Gly-OH is a hydrophobic amino acid. It has been shown to be present in human proteins, and it has been used as a marker for determining the sequence of amino acids in peptides. H-Met-Phe-Gly-OH is an acidic tripeptide that can be analysed using reversed phase high performance liquid chromatography (RPHPLC). This tripeptide is found in the peptide transporter, which transports amino acids across cellular membranes. The structural studies of H-Met-Phe-Gly-OH have revealed that this tripeptide has an alpha helix conformation, with two hydrogen bonds from the backbone amides to the backbone carbonyl groups.</p>Formula:C16H23N3O4SPurity:Min. 95%Molecular weight:353.44 g/molAcetyl-Neurotensin (8-13) Ac-Arg-Arg-Pro-Tyr-Ile-Leu-OH
CAS:<p>Acetyl-neurotensin (8-13) Ac-Arg-Arg-Pro-Tyr-Ile-Leu-OH is a competitive antagonist of the NANC neurotransmitter, neuropeptide Y. It is a proteolytic product of neurotensin, an endogenous peptide that has been implicated in a number of physiological and pathological processes. Acetyl-neurotensin (8-13) Ac-Arg-Arg-Pro-Tyr-Ile-Leu-(OH) binds to the membrane receptors on neurons and blocks the binding of neuropeptides such as neurotensin and substance P to these receptors, thereby inhibiting their effects on the central nervous system. This compound is soluble in water and can be used for bladder protection by preventing the accumulation of urine.</p>Formula:C40H66N12O9Purity:Min. 95%Molecular weight:859.03 g/mol(Deamino-Pen 1,Val4,D-Arg8)-Vasopressin
CAS:<p>Vasopressin is a peptide hormone that regulates water balance. It is synthesized in the hypothalamus and stored in the posterior pituitary gland, from where it is released when blood pressure falls. Vasopressin binds to V1 receptors in the kidney and vascular smooth muscle cells, causing vasoconstriction and increased blood pressure. Vasopressin also stimulates phosphatidic acid synthesis and hypotension, which are mediated through V2 receptors. Vasopressin has been found to be effective against cardiac arrest and myocardial infarction in animals. This drug has also been shown to stimulate the paraventricular nucleus of the hypothalamus and inhibit sympathetic activity in ganglia.</p>Formula:C48H69N13O11S2Purity:Min. 95%Molecular weight:1,068.27 g/molBoc-(Asp(OBzl)16)-Gastrin I (13-17) (human)
CAS:<p>Please enquire for more information about Boc-(Asp(OBzl)16)-Gastrin I (13-17) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H53N7O9SPurity:Min. 95%Molecular weight:843.99 g/mol(D-Ala2)-Leu-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N9O8·xC2H4O2Purity:Min. 95%Molecular weight:725.84 g/molH-Met-Lys-OH formiate salt
CAS:<p>H-Met-Lys-OH formiate salt is an industrial chemical that can be used in the preparation of pharmaceutical preparations. It has been shown to have a potential to lower blood pressure and reduce the risk of cardiovascular diseases. H-Met-Lys-OH formiate salt is a lysine derivative that contains two amino acid residues, namely lysine and methionine. H-Met-Lys-OH formiate salt can be used as a therapeutic agent for prostate cancer by targeting tp53 mutations and radical prostatectomy. It can also be used as an antibacterial agent against gram-negative bacteria, such as Escherichia coli (E. coli).</p>Formula:C11H23N3O3SPurity:Min. 95%Molecular weight:277.38 g/molFA-Phe-Lys-OH·HCl
CAS:<p>Please enquire for more information about FA-Phe-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H27N3O5•HClPurity:Min. 95%Molecular weight:449.93 g/molZ-Leu-Leu-Arg-AMC
CAS:<p>Z-Leu-Leu-Arg-AMC is a proteolytic substrate that is used to study the activation of Th17 cells. It activates these cells by binding to the antigen peptide and protease activity, which are involved in the immune response. Z-Leu-Leu-Arg-AMC has been shown to induce autoimmune diseases in mice, as well as other conditions such as chronic inflammation and obesity. This compound also has a potential drug target for neutralizing acidity, which could be useful in treating cancer and other diseases. Z-Leu-Leu-Arg-AMC is stable at acidic pHs and can be used for biochemical studies of proteases at acidic pHs.</p>Formula:C36H49N7O7Purity:Min. 95%Color and Shape:PowderMolecular weight:691.82 g/molH-β-Ala-Leu-OH
CAS:<p>Please enquire for more information about H-beta-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H18N2O3Purity:Min. 95%Molecular weight:202.25 g/molHIV-1 gag Protein p17 (76-84) acetate salt
CAS:<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>Formula:C44H72N10O15Purity:Min. 95%Molecular weight:981.1 g/molH-Asp(His-OH)-OH
CAS:<p>Please enquire for more information about H-Asp(His-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N4O5Purity:Min. 95%Color and Shape:SolidMolecular weight:270.24 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H37F3N8O11Purity:Min. 95%Molecular weight:838.74 g/molBz-D-Thr-OMe
CAS:<p>Bz-D-Thr-OMe is a synthetic peptide with an amino acid sequence of Bz-D-Thr-OH. It has the chemical formula C14H24N2O4S and a molecular weight of 288.4 g/mol. This peptide reacts selectively with the n-terminal amino and carboxylic acids in peptides, cleaving the peptide bonds between these residues to produce free amino acids.</p>Formula:C12H15NO4Purity:Min. 95%Molecular weight:237.25 g/mol3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride
CAS:<p>3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride is a chlorinated, thermosetting emulsifier that is used in the production of pressure sensitive adhesives. This compound has a high viscosity and is used as a retardant and an emulsifier. It is also used as a trichloride to produce vinyl chloride monomer. 3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride inhibits the growth of bacteria by acting as an antimicrobial agent. The mechanism of action for this compound is not fully understood but it has been shown to inhibit protein synthesis in bacteria.</p>Formula:C11H6Cl3NO2Purity:Min. 95%Molecular weight:290.53 g/molH-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Pro-Lys-OH acetate salt
CAS:<p>H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.</p>Formula:C11H21N3O3Purity:Min. 95%Molecular weight:243.3 g/molAc-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2
CAS:<p>Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 is a synthetic chemokine that is a member of the CXC subfamily. Chemokines are small proteins that have a hydrophobic region, which allows them to insert into membranes. This chemokine has been shown to be capable of forming dimers in the presence of other chemokines and exhibits a high degree of homology with congener chemokines. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence has been shown to denature at pH 8 and has water solubility; however, it does not dissolve in lipid bilayers such as phospholipid bilayers or monolayers. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence is also stable in an Alzheimer's disease mouse model.</p>Formula:C39H59N7O6Purity:Min. 95%Molecular weight:721.93 g/molMyelin Basic Protein (87-99) (human, bovine, rat)
CAS:<p>Please enquire for more information about Myelin Basic Protein (87-99) (human, bovine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O17Purity:Min. 95%Molecular weight:1,555.82 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molH-Arg-Trp-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O2·2HClPurity:Min. 95%Molecular weight:432.35 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molFmoc-D-Lys(Trt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Lys(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H38N2O4Purity:Min. 95%Molecular weight:610.74 g/molBoc-D-Phe-Pro-Arg-OH
CAS:<p>Boc-D-Phe-Pro-Arg-OH is a receptor binding molecule that belongs to the family of serine proteases. It has been shown to be reactive with multi-walled carbon nanotubes and fatty acids, making it useful for analytical chemistry, processing and amplification. The Boc-D-Phe-Pro-Arg-OH molecule binds to carbohydrate molecules in a way that mimics the action of an enzyme. This binding activates markers and triggers a reaction that produces hydrogen bonds between the target and the substrate. Boc-D-Phe-Pro-Arg-OH has been shown to have high affinity for serine protease receptors.</p>Formula:C25H38N6O6Purity:Min. 95%Molecular weight:518.61 g/molFmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH
CAS:<p>Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is a complex compound that is useful as a reagent for organic synthesis. It has been shown to be an effective intermediate in the synthesis of various compounds, such as peptides and pharmaceuticals. Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is also used as a building block for more complex molecules. This chemical has been shown to have high purity and quality, making it suitable for research purposes.</p>Formula:C35H34N6O7Purity:Min. 95%Color and Shape:PowderMolecular weight:650.68 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N12O13PPurity:Min. 95%Molecular weight:1,055.04 g/molH-Ala-Met-OH
CAS:<p>H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.</p>Formula:C8H16N2O3SPurity:Min. 95%Molecular weight:220.29 g/molH-Pro-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Pro-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O2·HClPurity:Min. 95%Molecular weight:297.78 g/molG Protein Antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2
CAS:<p>G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2 is a synthetic peptide that inhibits the activity of cyclase enzymes. It has been shown to inhibit skin cancer cells and has been shown to bind intracellular targets, such as protein kinase C, with high affinity. G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp--Met--NH2 has also been shown to inhibit the guanine nucleotide binding proteins (G proteins), which are necessary for cell signaling. G protein antagonist Pyr--Gln--D--Trp--Phe--D--Trp--D---Trp---Met---NH2 may also be used as an inhibitor of neurokinin 1 receptor activation and whole cell recordings have shown this drug to be potent antagonists of α subunit. G protein antagonist Pyr--Gln--D</p>Formula:C57H64N12O9SPurity:Min. 95%Molecular weight:1,093.26 g/molH-Lys-Pro-Tyr-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molFmoc-D-Leu-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Leu-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2
CAS:<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>Formula:C38H57N15O11SPurity:Min. 95%Molecular weight:932.02 g/molN-Methyl-1,2-phenylenediamine dihydrochloride
CAS:<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>Formula:C7H12Cl2N2Purity:Min. 95%Color and Shape:PowderMolecular weight:195.09 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/molAc-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H43N10O12PPurity:Min. 95%Molecular weight:742.67 g/mol(d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H78N13O10S2Purity:Min. 95%Molecular weight:1,121.4 g/molBoc-Phe-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molFmoc-Cit-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cit-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Cys(SEt)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-Cys(SEt)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO4S2·C12H23NPurity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:462.71HTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/molH-Ser-Asp-Gly-Arg-Gly-OH
CAS:<p>H-Ser-Asp-Gly-Arg-Gly-OH is a peptide and model system for epidermal growth factor. It has been shown to stimulate epidermal growth and protein synthesis in the skin cells. The peptide has also been shown to inhibit fibrinogen production by monoclonal antibody, which is a biochemical marker of wound healing. H-Ser-Asp-Gly-Arg-Gly-OH analogs have been shown to inhibit the activation of epidermal growth factor receptor and have an inhibitory effect on cell growth.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/molFmoc-Tyr(Et)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5Purity:Min. 95%Molecular weight:431.48 g/mol5-(2-Methyl-4-nitrophenyl)-2-furaldehyde
CAS:<p>Please enquire for more information about 5-(2-Methyl-4-nitrophenyl)-2-furaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H9NO4Purity:Min. 95%Molecular weight:231.2 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molGlutathione-monoethyl ester (reduced)
CAS:<p>Glutathione-monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is a polymerase chain reaction (PCR) enhancer that consists of a glutathione monoester and an ethyl ester. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is used as a cancer therapeutics agent in the treatment of cells with high levels of reactive oxygen species. It also inhibits drug efflux from cells and induces apoptosis in endothelial cells, which can lead to the inhibition of tumor growth. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH has been shown to cause changes in intracytoplasmic sperm and protein thiols in PC12 cells, which may be related to its ability to inhibit cell proliferation.</p>Formula:C12H21N3O6SPurity:Min. 95%Molecular weight:335.38 g/mol3-Amino-2-methoxy-dibenzofuran
CAS:<p>3-Amino-2-methoxy-dibenzofuran (3AMD) is a cytotoxic agent that is used in the treatment of bladder carcinoma. 3AMD inhibits DNA synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. 3AMD has been shown to be a potent inhibitor of cyclen-dependent kinases and to induce DNA damage in human cells. 3AMD also has significant cytotoxicity against malignant cells and has been shown to inhibit the growth of tumours in mice. 3AMD may have carcinogenic potential due to its structural similarity with other carcinogens such as aniline and aminobiphenyl.</p>Purity:Min. 95%Molecular weight:213.23 g/molFmoc-D-His(1-Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-His(1-Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H35N3O4Purity:Min. 95%Molecular weight:633.73 g/molH-D-Val-Leu-Arg-pNA·2 AcOH
CAS:<p>H-D-Val-Leu-Arg-pNA·2 AcOH is a kallikrein inhibitor that can be used as a blood pressure lowering agent. It inhibits the enzymatic activity of kallikrein, which is responsible for the conversion of kininogen to bradykinin, and thus prevents the production of natriuretic peptides. H-D-Val-Leu-Arg-pNA·2 AcOH has been shown to decrease blood pressure in animals by inhibiting filtration through the glomerulus and by blocking renin release from juxtaglomerular cells.</p>Formula:C23H38N8O5·2C2H4O2Purity:Min. 95%Molecular weight:626.7 g/molOsteocalcin (37-49) (human)
CAS:<p>Please enquire for more information about Osteocalcin (37-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H104N20O19Purity:Min. 95%Molecular weight:1,589.75 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-L-glutamic acid γ-methyl ester
CAS:<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>Formula:C11H19NO6Purity:Min. 95%Molecular weight:261.27 g/mol([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate
CAS:<p>Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H189N33O36Purity:Min. 95%Molecular weight:2,682 g/molNeuropeptide Y (3-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H271N53O54Purity:Min. 95%Molecular weight:3,993.36 g/mol(D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molNeuropeptide W-30 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O38SPurity:Min. 95%Molecular weight:3,559.12 g/mol(Lys(Z)2)-Tuftsin
CAS:<p>Please enquire for more information about (Lys(Z)2)-Tuftsin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N8O8Purity:Min. 95%Molecular weight:634.72 g/mol(Des-Arg9,Leu8)-Bradykinin
CAS:<p>Bradykinin is a peptide hormone that is produced in the body and has been found to be involved in many physiological processes. Bradykinin is formed from the cleavage of a larger protein, kininogen, by the enzyme kallikrein. Bradykinin binds to two types of receptors, B1 and B2. This antibody reacts with both types of receptor. The B2 receptor is found mainly on muscle cells and causes contraction, while the B1 receptor is found mainly on endothelial cells and causes vasodilation. The maximal response of bradykinin occurs when it binds to extracellular receptors. When knockout mice lack either type of bradykinin receptor they have an increased inflammatory response following injection with carrageenan or formaldehyde.</p>Formula:C41H63N11O10Purity:Min. 95%Molecular weight:870.01 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21N5O7Purity:Min. 95%Molecular weight:395.37 g/molZ-Gly-Gly-Leu-pNA
CAS:<p>The peptide z-Gly-Gly-Leu-pNA is a synthetic substrate that is used in the study of metalloendopeptidases. The peptide is composed of four amino acids and has an acidic, monoclonal antibody, dodecyl, proteolytic, peptide hormones, extracellular, inactivated, serine protease. It is synthesized from wheat leaves and can be used as a substrate for the enzyme.</p>Formula:C24H29N5O7Purity:Min. 95%Molecular weight:499.52 g/molH-D-Tyr-Val-Gly-OH
CAS:<p>H-D-Tyr-Val-Gly-OH is a catalyst that is used in the synthesis of phenylhydrazones. It catalyses the condensation of an aromatic aldehyde and hydrazine, which leads to the formation of a phenylhydrazone. The reaction occurs at neutral pH and high temperature. H-D-Tyr-Val-Gly-OH has been shown to inhibit protein synthesis in rat liver cells, with its inhibitory effect increasing with increased pH.</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C121H168N26O33S4Purity:Min. 95%Molecular weight:2,643.05 g/molZ-Phe-Leu-Ala-OH
CAS:<p>Z-Phe-Leu-Ala-OH is a homologous protein that has been shown to have proteolytic activity. It has a neutral pH and is stable in the presence of metal ions. This enzyme is structurally similar to subtilisin, with a sequence of residues containing two histidine residues, which are important for stability. The kinetic parameters of this enzyme were determined by analyzing its activity under different conditions and at different temperatures. The mutant Z-Phe-Leu-Ala-OH was found to be more active than the wild type at high temperature, but less active at low temperature, suggesting that the protein could be used as an industrial catalyst in food processing or chemical production.</p>Formula:C26H33N3O6Purity:Min. 95%Molecular weight:483.56 g/mol(d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H79N13O10S2Purity:Min. 95%Molecular weight:1,086.38 g/molH-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H38N6O5Purity:Min. 95%Molecular weight:526.63 g/molFormyl-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H70N16O12Purity:Min. 95%Molecular weight:1,099.2 g/molH-Trp-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>H-Trp-Nle-Arg-Phe-NH2 acetate salt is a muscle relaxant that binds to the muscle receptor site, which is responsible for contraction of skeletal muscles. It has been shown to be effective in treating anterior retractor mytilus in horses.</p>Formula:C32H45N9O4Purity:Min. 95%Molecular weight:619.76 g/molCholecystokinin-33 (1-21) (porcine)
CAS:<p>Cholecystokinin-33 (1-21) (porcine) H-Lys-Ala-Pro-Ser-Gly-Arg-Val-Ser-Met-Ile-Lys-Asn-Leu-Gln, Ser, Leu, Asp, Pro, His, Arg is a linker that can be used to form peptide conjugates. It can be used as a cell type specific carrier to transport therapeutics across the blood brain barrier. It has also been shown to have therapeutic effects on cells in culture.</p>Formula:C98H169N33O30SPurity:Min. 95%Molecular weight:2,321.66 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/mol1-O-Octadecyl-sn-glycero-3-phosphocholine
CAS:<p>Edelfosine is a phospholipid analog that has been shown to inhibit insulin-induced glucose uptake in adipocytes. It is a potent inhibitor of the insulin receptor tyrosine kinase and can also act as an allosteric inhibitor of protein kinase C (PKC). Edelfosine inhibits the growth of mammary carcinomas by inhibiting PKC, which leads to a decrease in cell proliferation. This drug also interacts with sulfonic acids, forming hydrogen bonds, which may be the reason for its high-performance liquid chromatography. The molecular weight of edelfosine is 582.3 g/mol.</p>Formula:C26H56NO6PPurity:Min. 95%Molecular weight:509.7 g/molMethyl 2-amino-5-methylbenzoate
CAS:<p>Methyl 2-amino-5-methylbenzoate is a chemical substance that is a precursor for the synthesis of picolinic acid. It also has an antitumor activity against various cancer cell lines and microcapsules. In addition, methyl 2-amino-5-methylbenzoate can be used as a reagent in the preparation of amines and sample preparation. The chemical reactions of methyl 2-amino-5-methylbenzoate are catalyzed by hydrochloric acid and sulfamoyl chloride. This chemical substance reacts with carbonyl groups to form nitro compounds.</p>Formula:C9H11NO2Purity:Min. 95%Molecular weight:165.19 g/molH-Thr-Gly-OH
CAS:<p>H-Thr-Gly-OH is a synthetic polymerase chain reaction product. It is a mixture of H-Thr and Gly, which are two amino acids that are involved in the replication of DNA. The sequences of these two amino acids have been determined and found to be phylogenetically related to each other. H-Thr-Gly-OH was synthesized by the ethyl esterification of H-Thr with Gly. This reaction product has been shown to have locomotor activity in Drosophila melanogaster and may also possess some other properties that are unknown at this time.</p>Formula:C6H12N2O4Purity:Min. 95%Molecular weight:176.17 g/molFmoc-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Acetyl-(Ala11·15)-Endothelin-1 (6-21)
CAS:<p>Acetyl-(Ala11·15)-Endothelin-1 (6-21) Ac-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu-Asp-Ile-Ile<br>TrpOH is a recombinant peptide that is a potent endothelin receptor antagonist. It binds to the endothelin receptor, blocking the binding of endothelin and preventing activation of the receptor. Acetyl-(Ala11·15)-Endothelin (6–21) Ac has been shown to inhibit atrial natriuretic peptide levels and reduce blood pressure in experimental models. This drug also prevents balloon injury by blocking the binding of endothelin to its receptors and inhibits growth factor β1, which is an important mediator in pulmonary hypertension. The mechanism of action for this drug is not fully understood, but it may work through inhibiting</p>Formula:C96H140N20O25SPurity:Min. 95%Molecular weight:2,006.32 g/molCaloxin 2A1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.52 g/molZ-Asp(ONp)-OBzl
CAS:<p>Z-Asp(ONp)-OBzl is a synthetic compound with minimal side-chain that can be used as a condensation and deprotection reagent in the synthesis of peptides. It functions to selectively cleave the N-terminal amino group from an unprotected peptide. This side chain is not present on natural amino acids and therefore provides selectivity for the N-terminal amino acid. Z-Asp(ONp)-OBzl has been found to be a more controllable and selective alternative to other deprotection reagents such as DBU, DCC, or TFA. The use of this reagent in peptide synthesis has been shown to provide high yields of unblocked chains with minimal side reactions.</p>Formula:C25H22N2O8Purity:Min. 95%Molecular weight:478.45 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H160N30O26S4Purity:Min. 95%Molecular weight:2,434.89 g/molBovine Pineal Antireproductive Tripeptide acetate salt
CAS:<p>Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.</p>Formula:C13H26N4O6Purity:Min. 95%Molecular weight:334.37 g/molH-Arg-Gly-Tyr-Ala-Leu-Gly-OH
CAS:<p>H-Arg-Gly-Tyr-Ala-Leu-Gly-OH is a synthetic, competitive inhibitor of the aminopeptidase that cleaves the amino acid Arg from peptide chains. This compound has been shown to inhibit kinases in vitro and block viral replication in cell culture. H-Arg-Gly-Tyr-Ala-Leu-Gly-OH is reversibly inhibited by endogenous aminopeptidases, which have been shown to be involved in the regulation of cell proliferation and apoptosis.</p>Formula:C28H45N9O8Purity:Min. 95%Molecular weight:635.71 g/molAc-Val-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H36F3N7O11Purity:Min. 95%Molecular weight:751.66 g/mol([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Glutaryl-Phe-AMC
CAS:<p>Glutaryl-Phe-AMC is a fluorophore that has been used to study dental plaque. It is an amide of glutaryl-Phe and AMC, which is a water molecule. Glutaryl-Phe-AMC is a synthetic molecule that can be deprotonated by histidine in the presence of d-homoserine. The fluorescence of this compound increases when it binds to the enzyme substrates, 7-amino-4-methylcoumarin (AMC) and water molecules. This assay can be used for studying proteolytic activity on enzymes such as protease and amylase.</p>Formula:C24H24N2O6Purity:Min. 95%Molecular weight:436.46 g/molH-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH
CAS:<p>Please enquire for more information about H-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H125N23O19Purity:Min. 95%Molecular weight:1,749.02 g/mol(Des-Gly10,tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>Formula:C59H84N16O12•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,209.4 g/molBoc-Glu(OBzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Glu(OBzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Amino-5-methoxypyridine
CAS:<p>2-Amino-5-methoxypyridine (2AM5MP) is a synthetic compound that is used to study the nicotinic acetylcholine receptor. It has been shown that 2AM5MP can be used as an agonist for the nicotinic acetylcholine receptor, which may be due to its ability to act as a substrate for amine oxidase. This compound has been shown to have anti-cancer properties and fluoresce when exposed to positron emission tomography (PET) scans. The anti-cancer effects of 2AM5MP are thought to be due to its ability to inhibit cancer cell proliferation and induce cancer cell apoptosis.</p>Formula:C6H8N2OPurity:Min. 95%Molecular weight:124.14 g/molH-Glu-His-bNA
CAS:<p>Please enquire for more information about H-Glu-His-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H23N5O4Purity:Min. 95%Molecular weight:409.44 g/molH-D-Pro-Pro-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Pro-Pro-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/molH-Met-Arg-Phe-Ala-OH
CAS:<p>H-Met-Arg-Phe-Ala-OH is a synthetic peptide that has been shown to be an effective inhibitor of protein synthesis in mammalian cells. It binds to the active site of protein translation machinery, thereby inhibiting the production of proteins vital for cell division. H-Met-Arg-Phe-Ala-OH is stable in aqueous solution and resistant to proteolytic degradation. It also has a high detection sensitivity and can be detected by FTIR spectroscopy, which makes it suitable for use in a variety of applications. H-Met-Arg-Phe-Ala-OH can be used as a tool for studying protein synthesis inhibition or as an antiobiotic agent against cancer cells.</p>Formula:C23H37N7O5SPurity:Min. 95%Molecular weight:523.65 g/molHCV-1 e2 Protein (554-569)
CAS:<p>Please enquire for more information about HCV-1 e2 Protein (554-569) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H111N19O21S3Purity:Min. 95%Molecular weight:1,698.99 g/mol(3,5-Dibromo-Tyr1)-Leu-Enkephalin
CAS:<p>Please enquire for more information about (3,5-Dibromo-Tyr1)-Leu-Enkephalin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H35Br2N5O7Purity:Min. 95%Molecular weight:713.42 g/mol(Cys39)-Tissue Factor (33-53)
CAS:<p>Please enquire for more information about (Cys39)-Tissue Factor (33-53) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H166N26O33S2Purity:Min. 95%Molecular weight:2,456.79 g/molZ-Trp-Ala-OH
CAS:<p>Z-Trp-Ala-OH is an imidazolide that is used as a potassium supplement. It has the potential to be used in the treatment of epilepsy, but more research is needed to determine its safety and efficacy.</p>Formula:C22H23N3O5Purity:Min. 95%Molecular weight:409.44 g/molSuc-Ala-Ala-Pro-Phe-SBzl
CAS:<p>Suc-Ala-Ala-Pro-Phe-SBzl is a synthetic peptide with a sequence similar to the signal peptide of procarboxypeptidase B2. It has been shown that Suc-Ala-Ala-Pro-Phe-SBzl can be used as a diagnostic tool for pancreatic cancer, because it is found in higher concentrations in the blood of patients with pancreatic cancer. This peptide also has an affinity for metal ions, which allows it to be used as a probe to detect the presence of these ions in solution. Suc-Ala-Ala-Pro-Phe-SBzl binds to human immunoglobulin G (IgG) and can be used in analytical methods that use x ray diffraction data.</p>Formula:C31H38N4O7SPurity:Min. 95%Molecular weight:610.72 g/molRanalexin
CAS:<p>Ranalexin is a peptide antibiotic that has been isolated from the fungus Penicillium patulum. It is an antimicrobial peptide and has shown antibacterial efficacy against gram-positive bacteria, including methicillin-resistant Staphylococcus aureus and Enterococcus faecalis. Ranalexin binds to bacterial membrane receptors, leading to rapid cell death. The biological properties of ranalexin are still being studied in order to determine its mechanism of action.</p>Formula:C97H167N23O22S3Purity:Min. 95%Molecular weight:2,103.7 g/molH-β-Ala-Ala-OH
CAS:<p>Please enquire for more information about H-beta-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O3Purity:Min. 95%Molecular weight:160.17 g/molH-D-Met-Met-OH
CAS:<p>H-D-Met-Met-OH is a synthetic compound, which is an optical isomer of DL-methionine. It has been shown to have the same biochemical and dietary concentrations as DL-methionine. H-D-Met-Met-OH has also been shown to have a linear response in bioassays, assays and other biochemical pathways. The thermodynamic properties of this compound are also similar to those of DL-methionine, although it is not as stable. This compound can be used as a substitute for DL-methionine because it has an identical chemical structure and can be converted into L -methionine by the enzyme methioninase.</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molNps-Val-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H14N2O4S·C12H23NPurity:Min. 95%Molecular weight:451.62 g/molH-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-e psilon-aminocaproyl-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-e psilon-aminocaproyl-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H152N34O14Purity:Min. 95%Molecular weight:1,790.26 g/molAzilsartan medoxomil
CAS:<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>Formula:C30H24N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:568.53 g/molVEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about VEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H99N23O18SPurity:Min. 95%Molecular weight:1,666.82 g/molBand 3 Protein (824-829) (human)
CAS:<p>Please enquire for more information about Band 3 Protein (824-829) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H65N11O8Purity:Min. 95%Molecular weight:791.98 g/molAngiotensin I/II (3-7)
CAS:<p>Angiotensin I/II (3-7) H-Val-Tyr-Ile-His-Pro-OH is an antagonist of the angiotensin II receptor. It has been shown to be a cognitive enhancer by statistically improving treatments for behavioural problems in rats and mice. Angiotensin I/II (3-7) H-Val-Tyr-Ile-His-Pro-OH has also been shown to inhibit nicotinic acetylcholine receptors, which are involved in mediating the effects of neurotransmitters on muscle cells. This agent also inhibits angiotensin II receptors, leading to vasodilation and reduced blood pressure. The mechanism of action is not yet clear but may involve inhibition of protein kinase C. In preclinical studies, it has been shown that this drug facilitates behavioural effects such as memory retention and motor performance in rats when given before treatment with peptides such as substance P or calcitonin gene related pept</p>Formula:C31H45N7O7Purity:Min. 95%Molecular weight:627.73 g/molBoc-Asp(OcHex)-Merrifield resin (100-200 mesh)
<p>Please enquire for more information about Boc-Asp(OcHex)-Merrifield resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Glu-pNA
CAS:<p>Ac-Glu-pNA is a synthetic substrate that is used in protease assays. Its amino acid sequence contains reactive groups, such as the carboxy terminal, that are cleaved by proteases. Ac-Glu-pNA has been shown to be a good substrate for thermophilic and licheniformis proteases and has been reported to be stable at neutral pH values.</p>Formula:C13H15N3O6Purity:Min. 95%Molecular weight:309.27 g/molH-Asp-Ala-His-Lys-OH
CAS:<p>Please enquire for more information about H-Asp-Ala-His-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H31N7O7Purity:Min. 95%Molecular weight:469.49 g/molBoc-L-isoleucine
CAS:<p>Please enquire for more information about Boc-L-isoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21NO4Purity:Min. 95%Molecular weight:231.29 g/molEntero-Kassinin
CAS:<p>Please enquire for more information about Entero-Kassinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H89N15O21SPurity:Min. 95%Molecular weight:1,364.48 g/mol2-Methylthio-N6-threonylcarbamoyladenosine
CAS:<p>A modified form of adenosine found in bacterial and eukaryotic tRNAs</p>Formula:C16H22N6O8SPurity:Min. 95%Color and Shape:PowderMolecular weight:458.45 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H54N10O9Purity:Min. 95%Molecular weight:782.89 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H32N6O7Purity:Min. 95%Molecular weight:444.48 g/molH-Tyr-Lys-OH
CAS:<p>H-Tyr-Lys-OH is a small drug molecule that has been shown to inhibit protein synthesis. It binds to the active site of the transcription-polymerase chain and competitively inhibits the binding of RNA polymerase. H-Tyr-Lys-OH has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis. H-Tyr-Lys-OH's conformational properties are similar to those found in proteins such as glutamic acid and lysine.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molH-Leu-Tyr-Leu-OH
CAS:<p>H-Leu-Tyr-Leu-OH is a molecule that contains a pyrrolidine ring and methyl groups. The molecule is an amino acid, which is one of the twenty that are used to form proteins. It has three terminal residues, which are H, Leu, and Tyr. The crystallographic structure of the compound was determined by x-ray crystallographic studies and it was found to be orthorhombic with a sephadex crystal lattice. The molecular conformation of this compound can be altered through kinetic or equilibrium processes.</p>Formula:C21H33N3O5Purity:Min. 95%Molecular weight:407.5 g/molZ-Leu-Tyr-chloromethylketone
CAS:<p>Z-Leu-Tyr-chloromethylketone is a peptide that binds to the reticulum and prevents the release of calcium ions. It is a chloromethyl ketone, which inhibits the L-type calcium channels in cells. Z-Leu-Tyr-chloromethylketone has been shown to block the influx of calcium ions into cytosolic compartments. This process leads to inhibition of protein synthesis and cell death by apoptosis.</p>Formula:C24H29ClN2O5Purity:Min. 95%Molecular weight:460.95 g/molAc-Ala-α-naphthyl ester
CAS:<p>Ac-Ala-alpha-naphthyl ester is a chemical compound that belongs to the class of aromatic esters. It is used as a research and benchmarking agent in the measurement of skin penetration potential. Ac-Ala-alpha-naphthyl ester has been shown to have good skin penetration properties, with no adverse effects on the skin.</p>Formula:C15H15NO3Purity:Min. 95%Molecular weight:257.28 g/molH-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu-OH
CAS:<p>The target of H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu is the phosphotyrosine residue in tyrosine kinase. This compound has been shown to inhibit the proliferation of cells that express this type of receptor and induce apoptosis. The x-ray structures of ligand binding to the receptor show a hydrogen bond network with the hydroxyl group at position 2, which is believed to be important for binding activity. The molecular modeling studies confirm that this interaction is energetically favorable, with a ΔΔG = -6.5 kcal/mol. H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-(OH) has also been found to have antiosteoporotic properties when administered orally in rats.</p>Formula:C66H97N12O24PPurity:Min. 95%Molecular weight:1,473.52 g/molTIPP
CAS:<p>TIPP is a peptide that belongs to the group of chemokines. It has been shown to have receptor binding activity and to stimulate the release of pro-inflammatory cytokines in cancer cells. TIPP interacts with membranes by forming hydrogen bonds with carbonyl groups and hydroxyl groups, which are located in the membrane. This results in a low energy barrier for intramolecular hydrogen transfer, making it a suitable candidate for drug design. TIPP also interacts with receptors, such as δ receptors, which may contribute to its anti-cancer properties.</p>Formula:C37H38N4O6Purity:Min. 95%Molecular weight:634.72 g/molH-Arg-4MbetaNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Arg-4MbetaNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O2·xHClPurity:Min. 95%Molecular weight:365.86 g/molH-Asp(Gly-OH)-OH
CAS:<p>Polymyxin B is a polycationic antibiotic that has been used in the treatment of infectious diseases and as an ophthalmic ointment. It is effective against bacteria, fungi, and parasites. Polymyxin B exhibits antimicrobial activity by binding to microbial membranes and causing lysis. The redox potential of this antibiotic is low, which can make it difficult for it to penetrate into cells. Oral cephalosporins are acidic drugs that are poorly absorbed from the gastrointestinal tract; they are only active in the distal small intestine and colon. Streptococcus faecalis is a bacterium that causes infections in the upper respiratory tract and urinary tract. Polymyxin B may be used as an oral agent to treat these infections because it does not require acidity for activity. This drug also exhibits anti-inflammatory effects through its ability to inhibit gamma-aminobutyric acid (GABA) synthesis in bowel cells, which leads to decreased inflammation.</p>Formula:C6H10N2O5Purity:Min. 95%Molecular weight:190.15 g/molH-Gly-Ala-Hyp-OH
CAS:<p>Please enquire for more information about H-Gly-Ala-Hyp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17N3O5Purity:Min. 95%Molecular weight:259.26 g/molH-β-Ala-Gly-OH
CAS:<p>H-beta-Ala-Gly-OH is a monoclinic crystalline compound. It is soluble in water and slightly soluble in ethanol, acetone, and benzene. The solubility of this compound depends on the pH of the solution as well as the presence of glycine. H-beta-Ala-Gly-OH has an upfield shift when protonated, making it useful for analytical purposes. This compound can be used to prepare glycine methyl ester by reacting with methanol or hydrochloric acid.</p>Formula:C5H10N2O3Purity:Min. 95%Molecular weight:146.14 g/molH-Thr-Ser-OH
CAS:<p>H-Thr-Ser-OH is a synthetic peptide that contains the amino acid sequence H-Thr-Ser-OH. It has been shown to have antitumor activity and antiangiogenic properties. This peptide was observed to destabilize protonated lysine residues in the tumor cell membrane, leading to increased permeability of the membrane and subsequent leakage of ions and water. The resulting cytotoxic environment leads to cancer cell death by apoptosis. HTSOH also inhibits tumor angiogenesis by inhibiting vascular endothelial growth factor (VEGF) production. HTSOH is stable at physiological pH and has been crystallized with a resolution of 1.5 Å.</p>Formula:C7H14N2O5Purity:Min. 95%Molecular weight:206.2 g/mol(Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H231N45O41Purity:Min. 95%Molecular weight:3,188.6 g/molFluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H109N23O18SPurity:Min. 95%Molecular weight:1,628.86 g/molH-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
CAS:<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>Formula:C29H54N8O10Purity:Min. 95%Molecular weight:674.79 g/molAnti-Inflammatory Peptide 1
CAS:<p>Anti-Inflammatory Peptide 1 is a peptide that has been shown to have anti-inflammatory properties. It is synthesized from H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, with the hydroxyl group linked by an ester bond to the N terminal of the peptide. Antiinflammatory peptides can be used as potential biomarkers for inflammatory diseases or as a treatment for these diseases.</p>Formula:C45H82N12O14S2Purity:Min. 95%Molecular weight:1,079.34 g/mol(Met(O)35)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O61SPurity:Min. 95%Molecular weight:4,530.04 g/molTRAP-5 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H51N9O6Purity:Min. 95%Molecular weight:633.78 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N5O5·HClPurity:Min. 95%Molecular weight:534.05 g/molBoc-D-Ala-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-D-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Leu-Leu-Leu-Phe-OMe·HCl
CAS:<p>Please enquire for more information about H-Leu-Leu-Leu-Phe-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H46N4O5·HClPurity:Min. 95%Molecular weight:555.15 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS:<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Molecular weight:208.07 g/molH-Gly-Arg-Gly-Asp-OH
CAS:<p>H-Gly-Arg-Gly-Asp-OH is a cyclic peptide with the amino acid sequence of Gly-Arg-Gly-Asp. It has been shown to promote bone formation and inhibit bone resorption in vitro by stimulating the release of growth factors. This peptide can be used as a diagnostic agent for monitoring cell culture, which may be due to its ability to bind monoclonal antibodies. H-Gly-Arg-Gly-Asp-OH also has the ability to form conjugates with polymerase chain reaction (PCR) probes or other biomolecules. These conjugates can be used for detecting specific DNA sequences, such as those found in mammalian cells.</p>Formula:C14H25N7O7Purity:Min. 95%Molecular weight:403.39 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H85N19O13Purity:Min. 95%Molecular weight:1,208.37 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/mol(D-Arg1,D-Phe5,D-Trp7·9,Leu11)-Substance P
CAS:<p>Substance P is a neuropeptide that binds to the tachykinin receptor NK1. It has potent anti-inflammatory and mitogenic activities, which are mediated through its binding to the NK1 receptor. Substance P can stimulate lung cancer cells to proliferate and inhibit their apoptosis, which may be due to an autocrine mechanism. In addition, it has been shown that substance P can potentiate the growth of some cancers such as colon cancer in vitro and in vivo by increasing DNA synthesis and cell proliferation. This peptide also has a dose-dependent effect on cell growth, with high doses inhibiting cell proliferation at higher levels than low doses.</p>Formula:C79H109N19O12Purity:Min. 95%Molecular weight:1,516.83 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H84N20O13Purity:Min. 95%Molecular weight:1,329.47 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/mol
