
GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(1,003 products)
- Adenosine Receptor(247 products)
- Adrenergic Receptor(3,010 products)
- Bombesin Receptor(33 products)
- Bradykinin Receptor(60 products)
- CXCR(153 products)
- CaSR(33 products)
- Cannabinoid Receptor(215 products)
- Cholecystokinin(1 products)
- Dopamine Receptor(435 products)
- Endothelin Receptor(83 products)
- GNRH Receptor(82 products)
- GPCR19(33 products)
- GRK(32 products)
- GTPase(22 products)
- Glucagon Receptor(190 products)
- Hedgehog/Smoothened(48 products)
- Histamine Receptor(381 products)
- LPA Receptor(21 products)
- Melatonin Receptor(26 products)
- OX Receptor(41 products)
- Opioid Receptor(321 products)
- PAFR(13 products)
- PKA(51 products)
- S1P Receptor(18 products)
- SGLT(31 products)
- Sigma receptor(46 products)
Show 19 more subcategories
Found 5838 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Bradykinin (1-6)
CAS:Bradykinin (1-6) is a stable, CPY-cleaved metabolite that triggers pain, induces muscle contractions, and activates NO synthetase.Formula:C30H45N9O8Purity:98%Color and Shape:SolidMolecular weight:659.73(R)-V-0219 hydrochloride
(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89MOR agonist-3
MOR agonist-3 (Compound 84) is a dual D3R/MOR antagonist with K i values of 382 nM and 55.2 nM, respectively.Color and Shape:Odour SolidCB1R agonist 1
<p>CB1R agonist 1 (Compound '1350) is a potent full agonist of the cannabinoid-1 receptor (CB1R) with a Ki value of 0.95 nM. It demonstrates significant pain-relieving effects in various pain models, including acute thermal pain, inflammatory pain, and neuropathic pain.</p>Formula:C20H18F3N3O3SColor and Shape:SolidMolecular weight:437.435Cortistatin 14, human, rat acetate
Cortistatin 14, human, rat acetate is a neuropeptide having structural similarity to somatostatin-14 and shows anticonvulsive, neuroprotective effects andFormula:C80H112N18O19S2Purity:97.86%Color and Shape:SolidMolecular weight:1693.98[Ala11,D-Leu15]-Orexin B acetate
[Ala11,D-Leu15]-Orexin B acetate is a selective agonist of orexin-2 receptor (OX2) with an EC50 of 0.13 nM, showing 400-fold selectivity over OX1 (52 nM).Formula:C122H210N44O37SPurity:98.18%Color and Shape:SolidMolecular weight:2917.31Synephrine hemitartrate
CAS:<p>Synephrine hemitartrate, an alkaloid from Citrus aurantium, is a sympathomimetic for weight loss, with α and β-adrenergic action.</p>Formula:C9H13NO2C4H6O6Color and Shape:SolidMolecular weight:242.26Surfagon
CAS:Surfagon is an effective LHRH agonist.Formula:C56H78N16O12Purity:98%Color and Shape:SolidMolecular weight:1167.34Antisauvagine-30 TFA
aSvg-30 TFA: potent CRF2 receptor antagonist, Kd 1.4 nM (mCRFR2β), 150 nM (CRFR1).Formula:C163H275N48F3O49SColor and Shape:SolidMolecular weight:3764.28Amylin, amide, rat
CAS:Amylin: peptide, 50% similar to CGRP, found with somatostatin in stomach cells, reduces acid secretion in mice.Formula:C167H272N52O53S2Purity:99.92%Color and Shape:SolidMolecular weight:3920.44GLP-1R agonist 4
CAS:GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Formula:C32H30ClF2N3O5Color and Shape:SolidMolecular weight:610.05DSP-1053
CAS:Dsp-1053 is a powerful SERT (Ki=1.02 nM) inhibitor with partial 5-HT1A receptor (Ki=5.05 nM) agonizing activity.Formula:C26H32BrNO4Purity:98%Color and Shape:SolidMolecular weight:502.44Preclamol hydrochloride
CAS:Preclamol hydrochloride: selective dopamine agonist with research potential in schizophrenia.Formula:C14H22ClNOColor and Shape:SolidMolecular weight:255.78LY86057
CAS:LY86057 is a bioactive chemical.Formula:C20H26N2O3Color and Shape:SolidMolecular weight:342.43915(S)-15-methyl Prostaglandin E2
CAS:15(S)-15-methyl PGE2: A stable PGE2 analog; strong antiulcer with double PGE2 affinity; excels PGE1 in uterine contraction.Formula:C21H34O5Color and Shape:SolidMolecular weight:366.49AMI-193
CAS:<p>AMI-193 (Spiramide) is a selective 5-HT2 & D2 receptor antagonist with antipsychotic properties.</p>Formula:C22H26FN3O2Purity:99.65%Color and Shape:SolidMolecular weight:383.46Pirepemat
CAS:Pirepemat (IRL752) is a cortical-preferring catecholamine agent that enhances cognition. It is utilized in the investigation of Parkinson's disease.Formula:C11H13F2NOColor and Shape:SolidMolecular weight:213.22PF-232798
CAS:PF-232798 is a second generation oral CCR5 antagonist with potent broad-spectrum anti-HIV-1 activity.Formula:C29H40FN5O2Color and Shape:SolidMolecular weight:509.66Tienoxolol FA
Tienoxolol FA, a beta-blocker for treating heart disease, hypertension, and ischemia.Formula:C22H30N2O7SPurity:97.05% - 98.53%Color and Shape:SoildMolecular weight:466.55(3R,5R,6S)-Atogepant
(3R,5R,6S)-Atogepant (MK-8031) is a CGRP antagonist enantiomer used in migraine research.Formula:C29H23F6N5O3Color and Shape:SolidMolecular weight:603.52S 16474
CAS:S 16474 is an antagonist of Neurokinin-1 Receptor.Formula:C44H48N6NaO8Purity:98%Color and Shape:SolidMolecular weight:811.892GRL018-21
GRL018-21 is a potent, highly selective inhibitor of G protein-coupled receptor kinase 5 (GRK5), exhibiting an IC50 of 10 nM [1].Color and Shape:Odour SolidPrepro-ANF (56-92), human
CAS:Human prepro-ANF (56-92) activates renal guanylate cyclase and boosts its activity.Formula:C173H270N44O57Color and Shape:SolidMolecular weight:3878.26Histamine H4 receptor antagonist-1
CAS:Histamine H4 receptor antagonist-1 is a potent antagonist of the histamine H4 receptor.Formula:C30H38N8O2Color and Shape:SolidMolecular weight:542.68INCB 3284 dimesylate
CAS:INCB 3284 dimesylate: oral CCR2 antagonist, blocks MCP-1/hCCR2 binding (IC50: 3.7 nM), potential in acute liver failure research.Formula:C28H39F3N4O10S2Purity:98%Color and Shape:SolidMolecular weight:712.76Linaclotide acetate
CAS:<p>Linaclotide acetate, an oral guanylate cyclase C agonist with 14 amino acids, treats constipation-predominant IBS and chronic constipation.</p>Formula:C61H83N15O23S6Purity:98%Color and Shape:SolidMolecular weight:1586.79Imelciment
CAS:<p>Imelciment (REGN-9035) is a humanised monoclonal antibody targeting NPR1, which can be used for research into heart failure.</p>Purity:95%Color and Shape:SoildProtease-Activated Receptor-1 antagonist 2
CAS:Orally active PAR-1 antagonist with 7 nM IC50; potential for CVD research.Formula:C24H23F2N3O2Color and Shape:SolidMolecular weight:423.46Sufotidine
CAS:Sufotidine (AH 25352X) is a highly selective competitive H2 receptor antagonist.Formula:C20H31N5O3SPurity:99.03% - 99.92%Color and Shape:SolidMolecular weight:421.56Prolactin Releasing Peptide (1-31), human acetate
Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion.Formula:C162H26N56O44SMolecular weight:3724.17PSB 0777 ammonium salt
CAS:adenosine A2A receptor full agonistFormula:C18H24N6O7S2Purity:98%Color and Shape:SolidMolecular weight:500.55Cannabidiolic acid methyl ester
CAS:<p>Cannabidiolic acid methyl ester (HU-580) is an orally active analogue of cannabidiolic acid. It enhances the activation of 5-HT1A receptors and increases the expression of c-Fos and NeuN in specific hypothalamic nuclei in rats. Cannabidiolic acid methyl ester exhibits anti-nausea, anxiolytic, and anti-nociceptive effects.</p>Formula:C23H32O4Color and Shape:SolidMolecular weight:372.5CB2R probe 1
CAS:<p>CB2R Probe 1, a cannabinoid 2 receptor (CB2R) fluorescent probe, exhibits both safety and environmental friendliness, boasting a dissociation constant (K i) of</p>Formula:C36H42N4O4Color and Shape:SolidMolecular weight:594.74GLP-2(1-33)(human)
CAS:GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Formula:C165H254N44O55SPurity:98%Color and Shape:SolidMolecular weight:3766.19L-threo Lysosphingomyelin (d18:1)
CAS:L-threo Lysosphingomyelin, a natural S1P receptor agonist, has EC50s: 19.3 nM (hS1P1), 131.8 nM (hS1P3), 313.3 nM (hS1P2).Formula:C23H49N2O5PColor and Shape:SolidMolecular weight:464.6212(S)-HpEPE
CAS:<p>12(S)-HpEPE, a fatty acid created by 12-lipoxygenase on EPA, has unclear biological activities but may resemble 12(S)-HpETE.</p>Formula:C20H30O4Color and Shape:SolidMolecular weight:334.456Poly-D-lysine hydrobromide (MW 1000-5000)
<p>Poly-D-lysine hydrobromide (PDLHB) (MW 1000-5000) is a synthetically produced polymeric substrate widely used in neural cell culture. Additionally, Poly-D-lysine hydrobromide acts as a CaSR agonist peptide.</p>Color and Shape:Odour SolidTamuzimod
CAS:Tamuzimod, an effective immunomodulator, exhibits modulatory activity on S1P Receptors with EC50 values below 1 μM [1] [2].Formula:C21H13Cl3F3N5O3Color and Shape:SolidMolecular weight:546.71Cloprostenol isopropyl ester
CAS:(+)-Chloprostol is a PGF2α agonist, mimics prostaglandin F2α, induces luteal dissolution in mares without side effects or stress.Formula:C25H35ClO6Color and Shape:SolidMolecular weight:466.995-HT2A receptor agonist-5
CAS:5-HT2A receptor agonist-5 (compound I-3) is a potent 5-HT2A agonist with a Ki value of 0.017 µM and exhibits antidepressant activity.Formula:C23H29N3OColor and Shape:SolidMolecular weight:363.5D5R agonist 1
D5R Agonist 1 (Compound 5j) is a selective, orally active partial agonist of the D5 receptor that can penetrate the blood-brain barrier (EC50: 269.7 nM). It has been demonstrated to enhance cognitive abilities in a scopolamine-induced amnesia model.Color and Shape:Odour SolidHaloperidol D4
CAS:<p>Haloperidol D4 is deuterium-labeled haloperidol.</p>Formula:C21H23ClFNO2Purity:98%Color and Shape:SolidMolecular weight:379.89K-(D-1-Nal)-FwLL-NH2 TFA
K-(D-1-Nal)-FwLL-NH2 TFA: potent ghrelin inverse agonist; Ki=4.9 nM (COS7), 31 nM (HEK293T); blocks Gq/G13 signaling.Formula:C53H68F3N9O8Color and Shape:SolidMolecular weight:1016.16Efranarelaxin alfa
CAS:Efranarelaxin alfa is an agonist of the relaxin receptor. It shows potential for research in cardiovascular diseases and tissue repair.Color and Shape:LiquidHPP-9
HPP-9, a Proteolysis-Targeting Chimera (PROTAC) derived from Hedgehog Pathway Inhibitor-1 (HPI-1) with a pIC50 value of 6.71, is designed to degrade BETFormula:C49H52N6O11Color and Shape:SolidMolecular weight:900.97Val9-Oxytocin
CAS:<p>Val9-Oxytocin, an Oxytocin analog where Gly9 is substituted with Val9 [1], functions as a complete antagonist of the vasopressin (V1a) receptor.</p>Formula:C46H72N12O12S2Purity:98%Color and Shape:SolidMolecular weight:1049.27Nocistatin(human)
CAS:Blocker of nociceptin-induced allodynia and hyperalgesiaFormula:C149H238N42O53S3Purity:98%Color and Shape:SolidMolecular weight:3561.936α-Prostaglandin I1
CAS:<p>6α-Prostaglandin I1 (6α-PGI1) is a stable Prostaglandin I2 (PGI2) analog resistant to hydrolysis in aqueous solutions.</p>Formula:C20H34O5Color and Shape:SolidMolecular weight:354.487Xylamidine
CAS:Xylamidine is a biochemical.Formula:C19H24N2O2Color and Shape:SolidMolecular weight:312.4126Rfa, Hypothalamic Peptide, human
CAS:26RFa, a human neuropeptide, stimulates appetite and possibly regulates feeding and the gonadotropic axis, with ≈80% identity across human, rat, and frog.Formula:C127H195N37O37Purity:98%Color and Shape:SolidMolecular weight:2832.13PSA1 (141-150)
CAS:This Prostate Specific Antigen 1 peptide was used in the immunotherapy of cancer experiments.Formula:C55H93N13O13SPurity:98%Color and Shape:SolidMolecular weight:1176.47Galanin (1-19), human
CAS:<p>Galanin (1-19), human: a fragment of GAL neuropeptide influencing hormone release, pain response, and eating behavior.</p>Formula:C89H130N26O25Purity:98%Color and Shape:SolidMolecular weight:1964.14isomer-Cilansetron
CAS:isomer-Cilansetron is an isomer of Cilansetron.Formula:C20H21N3OPurity:99.92% - 99.96%Color and Shape:SoildMolecular weight:319.416,16-dimethyl Prostaglandin F2α
CAS:<p>16,16-dimethyl Prostaglandin F2α can be used in related research in the field of life sciences. Its product number is T37993 and CAS number is 39746-23-1.</p>Formula:C22H38O5Color and Shape:SolidMolecular weight:382.541Mirtazapine N-oxide
CAS:<p>Mirtazapine N-oxide, a mirtazapine metabolite, is produced by CYP1A2 and CYP3A4 in human liver.</p>Formula:C17H19N3OColor and Shape:SolidMolecular weight:281.359Mitemcinal fumarate
CAS:<p>Mitemcinal fumarate is a erythromycin derivative that is used to treat gastroesophageal reflux disease.</p>Formula:C84H142N2O28Color and Shape:SolidMolecular weight:1628.02Neuronostatin-13 (human)
CAS:Neuronostatin-13: human-conserved, 13-amino-acid peptide with amidated C-terminus.Formula:C64H110N20O16Purity:98%Color and Shape:SolidMolecular weight:1415.681-Octadecyl Lysophosphatidic Acid
CAS:<p>1-Octadecyl LPA, an LPA analog with stearic acid at sn-1, has strong platelet aggregation (EC50=9 nM) via G protein receptors.</p>Formula:C21H45O6PColor and Shape:SolidMolecular weight:424.559DOTA-EB-TATE
DOTA-EB-TATE is formed by combining the SST peptide derivative DOTA-octreotate with an Evans blue analog (EB). This peptide drug conjugate (PDC) enhances the pharmacokinetics of SSTR2 analogs and reduces PRRT toxicity. Additionally, DOTA-EB-TATE serves in the synthesis/research of radiopharmaceutical conjugates (RDC).Formula:C105H133N21O30S5Molecular weight:2329.63Prolactin-Releasing Peptide (12-31), rat
CAS:Prolactin-Releasing Peptide (12-31), rat, a fragment of PrRP, exhibits high affinity for GPR10 receptors and stimulates calcium mobilization in CHOK1 cellsFormula:C104H158N32O26Molecular weight:2272.57Neuropeptide Y (1-24) (human)
CAS:Neuropeptide Y (1-24) inhibits rat vas deferens twitch and activates NMDA-induced neurons in rat hippocampus.Formula:C116H170N30O40SMolecular weight:2656.83Onvitrelin ucalontide
CAS:Onvitrelin ucalontide is a LHRH analogue with anticancer effect; halts breast, ovarian, and prostate tumors in mice.Formula:C163H243N43O32Molecular weight:3316.94Lintitript
CAS:Lintitript (SR 27897) is a selective antagonist of CCK1 with EC50s of 6 nM and 200 nM for CCK1 and CCK2. The Ki value is 0.2 nM for CCK1.Formula:C20H14ClN3O3SPurity:99.28%Color and Shape:SolidMolecular weight:411.86Sulamserod
CAS:<p>Sulamserod (RS 100302) is a potent 5-HT4 receptor antagonist with antiarrhythmic activity for the study of atrial fibrillation and cardiovascular related</p>Formula:C19H28ClN3O5SPurity:98.76%Color and Shape:SolidMolecular weight:445.96(Iso)-Landipirdine
CAS:<p>(Iso)-Landipirdine((Iso)-RO5025181) is a selective and potent 5-HT6R antagonist.</p>Formula:C18H19FN2O3SPurity:98.50%Color and Shape:SoildMolecular weight:362.42Petrelintide acetate
<p>Petrelintide (ZP8396) acetate is an amylin analog with potential for weight reduction, suitable for diabetes research.</p>Formula:C185H305N49O61·xC2H4O2Color and Shape:SolidMolecular weight:4191.69 (free base)CRSP-1
CAS:Central CT receptor agonist, 350x stronger than CT, no CGRP or adrenomedullin action, inhibits osteoclasts, affects rat feeding, body temp, and calcium.Formula:C175H294N54O49S5Purity:98%Color and Shape:SolidMolecular weight:4098.88CHS-114
<p>CHS-114 (SRF-114) is a fully human IgG1 antibody targeting the (CCR8) receptor. It shows potential for research in head and neck squamous cell carcinoma (HNSCC). The isotype control for CHS-114 can be referred to as HumanIgG1kappa, Isotype Control.</p>Color and Shape:Odour Liquid3-hydroxy Desloratidine
CAS:3-hydroxy Desloratidine is a major metabolite of desloratadine , a tricyclic antagonist of the histamine H1 receptor.Formula:C19H19ClN2OColor and Shape:SolidMolecular weight:326.82Glucagon Receptor Antagonist Inactive Control
CAS:Glucagon Receptor Antagonist Inactive Control is a Glucagon receptor antagonist that can be used in related research in the field of life sciences.Formula:C21H23BrN2OSColor and Shape:SolidMolecular weight:431.39TE-8105
TE-8105 is a GLP-1 receptor agonist that demonstrates prolonged and enhanced efficacy in models of diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Color and Shape:Odour SolidAPC 366 TFA
CAS:APC 366 (TFA) is a potent irreversible inhibitor of mast cell tryptase. It is particularly useful in studies related to allergic diseases.Formula:C24H29F3N6O6Color and Shape:SolidMolecular weight:554.527ALD1910
ALD1910 is a humanized monoclonal antibody targeting PACAP38 and PACAP27. It inhibits PACAP signaling through pituitary adenylate cyclase-activating peptide type I receptor (PAC1-R), vasoactive intestinal peptide receptor 1 (VPAC1-R), and VPAC2-R. ALD1910 recognizes a non-linear epitope within PACAP and prevents its binding to cell surfaces. It is useful for studying PACAP-mediated migraines.Color and Shape:Odour LiquidCannabigerorcinic Acid
CAS:Cannabigerorcinic acid, structurally akin to recognized phytocannabinoids, serves as an analytical reference standard designed for research and forensic purposes.Formula:C18H24O4Color and Shape:SolidMolecular weight:304.386Selank
CAS:Selank is a synthetic analog of tuftsin.Formula:C33H57N11O9Purity:98%Color and Shape:SolidMolecular weight:751.87Ethoxyquin Dimer
CAS:Ethoxyquin dimer is an antioxidant, metabolite of ethoxyquin, that protects fish meal/oil fats but can cause liver damage in mice.Formula:C28H36N2O2Color and Shape:SolidMolecular weight:432.608(±)5-iPF2α-VI
CAS:Isoprostanes are prostaglandin (PG)-like products of free-radical induced lipid peroxidation.Formula:C20H34O5Color and Shape:SolidMolecular weight:354.487mPGES-1/sEH-IN-1
<p>mPGES-1/sEH-IN-1 (compound 1f) is an sEH inhibitor with an IC50 value of 5 μM. It also exhibits antitumor activity by inhibiting mPGES-1, with an IC50 value of 25 µM.</p>Formula:C20H16F3N3O2Color and Shape:SolidMolecular weight:387.355U92016A
CAS:U92016A is a highly potent and selective agonist of 5-HT1A receptor.Formula:C19H25N3Purity:98%Color and Shape:SolidMolecular weight:295.42Biotin-Gastrin Releasing Peptide, human TFA
Biotin-Gastrin Releasing Peptide, human TFA, is a biotinylated form of the gastrin-releasing peptide (GRP). GRP is a neuropeptide known for its growth-stimulating and tumorigenic properties.Color and Shape:Odour SolidBimatoprost cyclohexyl amide
Bimatoprostcyclohexyl amide (N-Cyclohexyl-desamethyl bimatoprost; 17-Phenyl trinor prostaglandin F2α cyclohexyl amide) is an analogue of Bimatoprost. This compound acts as an agonist of the prostaglandin F2α receptor (FP receptor) and can be utilized for research in lowering intraocular pressure and in studies of glaucoma.Color and Shape:Odour SolidDabelotine, (R)-
CAS:Dabelotine, (R)- is the R-isomer of Dabelotine. Dabelotine is an adrenergic agonist used in the study of dementia.Formula:C15H22N2O2Color and Shape:SolidMolecular weight:262.3516-phenoxy tetranor Prostaglandin F2α
CAS:16-phenoxy PGF2α is a metabolically stable analog of PGF2α. It binds to the FP receptor on ovine luteal cells with much greater affinity (440%) than PGF2α.Formula:C22H30O6Color and Shape:SolidMolecular weight:390.47Msh (11-13)
CAS:Msh (11-13) is a bioactive chemical.Formula:C16H30N4O4Color and Shape:SolidMolecular weight:342.43HGS101
HGS101 is a fully humanized CCR5 monoclonal antibody that exhibits high affinity for CCR5. It binds to the second extracellular loop (ECL-2) and functions as a signaling antagonist. HGS101 restores the inhibitory effect of Maraviroc in Maraviroc-resistant HIV-1 infected PBMCs. In an uninfected simian immunodeficiency virus model of rhesus monkeys, HGS101 shows anti-HIV activity by inhibiting CCR5 signaling.Color and Shape:Odour LiquidCCK (26-31) (non-sulfated)
CAS:CCK (26-31) is a digestive, satiety-inducing, anxiety-related peptide fragment from CCK hormone in the brain and gut.Formula:C38H50N8O10S2Molecular weight:842.98Canine KP-10
Canine KP-10 is a potent kisspeptin that induces a significant gonadotropin and estradiol response in female dogs during estrus.Color and Shape:Odour SolidGEP44
GEP44 is a peptide-biased triple agonist targeting the glucagon-like peptide-1 receptor (GLP-1R), neuropeptide Y1 receptor (Y1-R), and neuropeptide Y2 receptor (Y2-R). It induces GLP-1R-dependent insulin secretion in rat and human islets by offsetting the actions of Y1-R and GLP-1R agonism, controlled by Y1-R antagonists. Additionally, GEP44 enhances glucose uptake in muscle tissue through Y1-R mediation independent of insulin and significantly reduces food intake and body weight in diet-induced obese rat models. GEP44 is utilized in studies related to obesity and type 2 diabetes.Color and Shape:Odour SolidVedaprofen
CAS:<p>Vedaprofen (PM 150) is a COX-1 inhibitor with anti-inflammatory effects, blocking E. coli clamp at IC50 222 μM, Ki 131 μM.</p>Formula:C19H22O2Purity:99.24% - 99.70%Color and Shape:SolidMolecular weight:282.38GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Molecular weight:3850.31TNP-ATP tetrasodium
TNP-ATP is an antagonist of purinergic P2Y1, P2X3, and P2X2/3 receptors, exhibiting IC50 values of 6, 0.9, and 7 nM, respectively, in HEK293 cells expressing human receptors. It reduces acetic acid-induced calcium flux in 1321N1 cells expressing P2X3 and P2X2/3 receptors with IC50 values of 100 and 62 nM, respectively. TNP-ATP also dose-dependently alleviates acetic acid-induced writhing responses in a visceral pain model in mice, with an ED50 of 6.35 µmol/kg.Color and Shape:Odour SolidGalanin (2-29) (rat)
CAS:Peptide agonist for galanin receptorsFormula:C139H208N42O40Purity:98%Color and Shape:SolidMolecular weight:3107.4CB2 receptor antagonist 2
Compound 39, also known as CB2 receptor antagonist 2, is a potent CB2 antagonist exhibiting an IC50 of 0.33 μM.Color and Shape:Odour SolidPhendioxan
CAS:Phendioxan is a biochemcial.Formula:C25H27NO5Color and Shape:SolidMolecular weight:421.49Somatostatin-25
CAS:Somatostatin: a brain/pancreas hormone binding receptors, with anxiolytic, antiepileptic, and appetite-suppressing effects.Formula:C127H191N37O34S3Purity:98%Color and Shape:SolidMolecular weight:2876.3[D-p-Cl-Phe6,Leu17]-VIP
CAS:Selective vasoactive intestinal peptide (VIP) receptor antagonist (IC50 = 125.8 nM). Displays no activity on glucagon, secretin or GRF receptors.Formula:C148H239ClN44O42Purity:98%Color and Shape:SolidMolecular weight:3342.24O-Desmethyl-N-deschlorobenzoyl Indomethacin
CAS:O-Desmethyl-N-deschlorobenzoyl indomethacin, a metabolite of indomethacin, reduces HL-60 cell viability and aids in synthesizing PGD2 receptor antagonists.Formula:C11H11NO3Color and Shape:SolidMolecular weight:205.21315-keto-17-phenyl trinor Prostaglandin F2α ethyl amide
CAS:Bimatoprost is the Allergan trade name for 17-phenyl trinor prostaglandin F2α ethyl amide (17-phenyl trinor PGF2α ethyl amide), an F-series PG analog which hasFormula:C25H35NO4Color and Shape:SolidMolecular weight:413.558Pemvidutide TFA
Pemvidutide (TFA), a GLP-1R/GCGR dual agonist, effectively reduces body weight, liver fat, and serum lipid levels, and is utilized in research on non-alcoholicFormula:C182H275N39O54·xC2HF3O2Color and Shape:SolidMolecular weight:3873.35 (free base)(±)-4-hydroxy Propranolol β-D-Glucuronide
CAS:(±)-4-hydroxy Propranolol β-D-glucuronide is a metabolite of (±)-4-hydroxy propranolol , which is a metabolite of propranolol.Formula:C22H29NO9Color and Shape:SolidMolecular weight:451.47

