
GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(942 products)
- Adenosine Receptor(242 products)
- Adrenergic Receptor(2,949 products)
- Bombesin Receptor(30 products)
- Bradykinin Receptor(59 products)
- CXCR(149 products)
- CaSR(32 products)
- Cannabinoid Receptor(195 products)
- Dopamine Receptor(410 products)
- Endothelin Receptor(75 products)
- GNRH Receptor(73 products)
- GPCR19(31 products)
- GRK(32 products)
- GTPase(21 products)
- Glucagon Receptor(166 products)
- Hedgehog/Smoothened(45 products)
- Histamine Receptor(359 products)
- LPA Receptor(21 products)
- Melatonin Receptor(24 products)
- OX Receptor(40 products)
- Opioid Receptor(298 products)
- PAFR(11 products)
- PKA(49 products)
- S1P Receptor(17 products)
- SGLT(30 products)
- Sigma receptor(46 products)
Show 18 more subcategories
Found 5378 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
K-(D-1-Nal)-FwLL-NH2 TFA
<p>K-(D-1-Nal)-FwLL-NH2 TFA: potent ghrelin inverse agonist; Ki=4.9 nM (COS7), 31 nM (HEK293T); blocks Gq/G13 signaling.</p>Formula:C53H68F3N9O8Color and Shape:SolidMolecular weight:1016.16IRL-1038
CAS:<p>ETB endothelin receptor antagonist</p>Formula:C68H92N14O15S2Purity:98%Color and Shape:SolidMolecular weight:1409.67KwFwLL-NH2
CAS:<p>KwFwLL-NH2 is a hexapeptide that serves as a ligand for the ghrelin receptor (ghrelin receptor). This compound acts as a specific inverse agonist for the ghrelin receptor, exhibiting moderate potency (EC50=45.6 nM).</p>Formula:C49H66N10O6Color and Shape:SolidMolecular weight:891.11ALD1613
<p>ALD1613 is a potent neutralizing monoclonal antibody targeting adrenocorticotropic hormone (ACTH). It neutralizes ACTH-induced signaling and inhibits cyclic adenosine monophosphate accumulation in ACTH-stimulated Y1 (mouse adrenal cell line) via all five melanocortin receptors. ALD1613 significantly reduces plasma corticosterone levels in wild-type rats and is applicable in studies involving elevated ACTH-related conditions.</p>Color and Shape:Odour LiquidJNJ-10181457 (hydrochloride)
CAS:<p>JNJ-10181457 (hydrochloride) is a non-imidazole H3 receptor antagonist that is brain-penetrating and selective, increasing NE and acetylcholine concentrations</p>Formula:C20H30Cl2N2OColor and Shape:SolidMolecular weight:385.37Substance P (4-11)
CAS:Substance P (4-11), a C-terminal fragment of Substance P, acts as a highly selective agonist for NK1 receptors, demonstrating specificity in its interaction.Formula:C46H67N11O10SColor and Shape:SolidMolecular weight:966.16LP 12 hydrochloride
CAS:<p>LP 12 hydrochloride is a selective 5-HT7 receptor agonist (Ki=0.13 nM).</p>Formula:C32H40ClN3OColor and Shape:SolidMolecular weight:518.14Prostaglandin F1α
CAS:<p>Prostaglandin F1α (PGF1α) is a lipid mediator and an endogenous metabolite of prostacyclin, regulate smooth muscle contraction.</p>Formula:C20H36O5Color and Shape:SolidMolecular weight:356.5TT-OAD2 free base
CAS:<p>TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.</p>Formula:C50H47Cl2N3O6Purity:98%Color and Shape:SolidMolecular weight:856.83AZ7976
CAS:<p>AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].</p>Formula:C30H33F7N2O6SColor and Shape:SolidMolecular weight:682.65γ-1-Melanocyte Stimulating Hormone (MSH), amide
<p>γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and blood</p>Formula:C72H97N21O14SColor and Shape:SolidMolecular weight:1512.9FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Color and Shape:SolidMolecular weight:3692.15Guanylate cyclase-IN-1
CAS:<p>Guanylate cyclase-IN-1 (Example 46) is a specific inhibitor of guanylate cyclase, employed in research related to cardiovascular diseases.</p>Formula:C20H17FN8OColor and Shape:SolidMolecular weight:404.409REGN-7544
<p>REGN-7544 is a humanised monoclonal antibody targeting NPR1, which blocks and inhibits NPR1 to increase blood pressure, hypotensione.</p>Purity:95%Color and Shape:Odour LiquidGLP-1 receptor agonist 13
<p>Compound (S)-9, a GLP-1 receptor agonist, exhibits an EC50 of 76 nM for the glucagon GLP-1 receptor [1].</p>Formula:C25H23ClF2N6OColor and Shape:SolidMolecular weight:496.94Peptide YY (PYY) (3-36), porcine TFA
<p>Peptide YY (PYY) (3-36), porcine TFA, functions as a gut hormone that serves as a Y2 receptor agonist, effectively reducing appetite [1].</p>Formula:C176H272N52O54·C2HF3O2Color and Shape:SolidMolecular weight:4094.44Atilmotin
CAS:<p>Atilmotin is a gastrointestinal agent for treating motility disorders.</p>Formula:C86H135N20O19Color and Shape:SolidMolecular weight:1753.146(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat)
CAS:<p>(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat) is a corticotropin-releasing factor (CRF) antagonist known to counteract the inhibitory effects of IL-1a</p>Formula:C159H267N49O43Color and Shape:SolidMolecular weight:3553.12Neuropeptide Y (2-36) (porcine)
CAS:<p>Porcine Neuropeptide Y (2-36) is 97.14% similar to rat/human, an agonist for Y5, Y2, Y1 receptors, used in obesity research.</p>Formula:C181H278N54O55Color and Shape:SolidMolecular weight:4090.47Pramlintide TFA
Pramlintide TFA, a polypeptide analogue of human amylin and an antidiabetic agent, exhibits antineoplastic properties in colorectal cancer [1].Formula:C173H268N51F3O55S2Color and Shape:SolidMolecular weight:4063.4Dexchlorpheniramine free base
CAS:<p>Dexchlorpheniramine Maleate, a histamine receptor antagonist, is used to treat urticaria, allergic rhinitis, allergic conjunctivitis and pruritus.</p>Formula:C16H19ClN2Purity:98%Color and Shape:Oily Liquid SolidMolecular weight:274.79[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH
CAS:<p>[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH is a synthetic LHRH analog and a GnRH receptor antagonist.</p>Formula:C67H84N16O13Color and Shape:SolidMolecular weight:1321.48NF546
CAS:<p>NF546 is a selective agonist of non-nucleotide P2Y11(pEC50 of 6.27).</p>Formula:C47H44N6Na4O17P4Purity:98%Color and Shape:SolidMolecular weight:1180.74Chemerin-9, Mouse
CAS:<p>Chemokine-like receptor 1 (CMKLR1) agonist (EC50 = 42 nM). Corresponds to C-terminal of full length mouse Chemerin, amino acids 148 - 156.</p>Formula:C51H68N10O12Color and Shape:SolidMolecular weight:1013.163Orforglipron hemicalcium hydrate
CAS:<p>Orforglipron hemicalcium hydrate (LY3502970 hemicalcium hydrate; GLP-1 receptor agonist 1 hemicalcium hydrate) represents the hemicalcium hydrate form of the calcium salt of Orforglipron, an orally active agonist targeting the Glucagon-like peptide-1 receptor (GLP-1R). This compound has demonstrated efficacy in mitigating type 2 diabetes [1].</p>Formula:C48H48F2N10O5Ca·H2OColor and Shape:SolidMolecular weight:921.02Angiopeptin TFA
CAS:Angiopeptin TFA: somatostatin analogue, sst2/sst5 partial agonist (IC50: 0.26/6.92 nM), suppresses GH & IGF-1, for atherosclerosis research.Formula:C58H73F6N11O14S2Color and Shape:SolidMolecular weight:1326.39Orexin B, rat, mouse TFA
<p>Orexin B, rat/mouse TFA, activates OX1-R & OX2-R receptors, influencing food intake, energy, and sleep regulation.</p>Formula:C128H216F3N45O36SColor and Shape:SolidMolecular weight:3050.42[Tyr11]-Somatostatin
CAS:[Tyr11]-Somatostatin, a neuroactive peptide, aids proteomics research and modulates retinal function.Formula:C76H104N18O20S2Molecular weight:1653.89Donetidine
CAS:<p>Donetidine is a histamine H2 receptor antagonist used to treat digestive disorders.</p>Formula:C20H25N5O3SPurity:99.32%Color and Shape:SolidMolecular weight:415.51[Des-Arg10]-HOE I40 TFA
<p>[Des-Arg10]-HOE I40 TFA is a potent antagonist of the bradykinin B1 receptor.</p>Formula:C53H77N15O12S·xC2HF3O2Color and Shape:SolidAdenosine 2',5'-diphosphate sodium
CAS:<p>Adenosine 2',5'-diphosphate sodium is a competitive P2Y1 antagonist with non-selective antagonism at recombinant and human platelet P2X1 receptors.</p>Formula:C10H15N5NaO10P2Color and Shape:SolidMolecular weight:450.192Sar-[D-Phe8]-des-Arg9-Bradykinin
CAS:<p>Potent bradykinin B1 agonist, EC50 = 9.02 nM, enzyme resistant, induces hypotension and angiogenesis.</p>Formula:C47H66N12O11Purity:98%Color and Shape:SolidMolecular weight:975.11Naratriptan D3 Hydrochloride
CAS:Naratriptan D3 Hydrochloride is the deuterium labeled Naratriptan, is a selective agonist of 5-HT1 receptor subtype.Formula:C17H26ClN3O2SPurity:98%Color and Shape:SolidMolecular weight:374.94Mini Gastrin I, human
CAS:<p>Mini Gastrin I, human, is a truncated form of the human gastrin peptide, encompassing amino acids 5-17 of the original sequence.</p>Formula:C74H99N15O26SPurity:98%Color and Shape:SolidMolecular weight:1646.73Satoreotide
CAS:<p>Satoreotide (JR11) is an SSTR2 antagonist, typically conjugated with radiolabeled chelators for use in neuroendocrine tumor imaging [1].</p>Formula:C58H72ClN15O14S2Color and Shape:SolidMolecular weight:1302.87Spantide I
CAS:<p>Spantide antagonizes both bombesin & substance P. It is also tachykinin receptor antagonist.</p>Formula:C75H108N20O13Purity:98%Color and Shape:SolidMolecular weight:1497.79Satavaptan
CAS:<p>Satavaptan is a vasopressin V2 receptor antagonist. Satavaptan improves the control of ascites in cirrhosis.</p>Formula:C33H45N3O8SColor and Shape:SolidMolecular weight:643.79SAE-14
CAS:<p>GPR183, a chemotactic receptor aiding B cell maturation, binds 7α,25-OHC; studied in IBD research.</p>Formula:C19H19F3N2O2Purity:99.85%Color and Shape:SolidMolecular weight:364.36ELA-11(human) TFA
<p>ELA-11(human) TFA: apelin receptor agonist, K i =14 nM, inhibits cAMP, stimulates β-arrestin, from ELA-32 fragment.</p>Formula:C60H91F3N16O15S2Color and Shape:SolidMolecular weight:1397.58BA 1 TFA
<p>BA1 TFA agonizes BB receptors; binds BRS3, GRPR, NMBR with IC50s of 6, 0.4, 2.5 nM.</p>Formula:C59H77F3N14O13Color and Shape:SolidMolecular weight:1247.32GLP-1R agonist 19
CAS:<p>GLP-1R agonist 19 (M3190) is a potent, selective GLP-1 receptor agonist that demonstrates excellent plasma and liver microsomal stability, along with low hERG toxicity [1].</p>Formula:C94H136FN21O25Color and Shape:SolidMolecular weight:1979.21[Nle13]-Motilin
CAS:<p>[Nle13]-Motilin, a motilin analogue, is a motilin receptor agonist [1] [2] .</p>Formula:C121H190N34O35Color and Shape:SolidMolecular weight:2681.01Cagrilintide acetate
<p>.Cagrilintide is a long-acting amylin analog,treat diabetes and obesity by reducing appetite through activation of the AMY3R and calcitonin receptor.</p>Formula:C196H316N54O61S2Purity:99.88%Color and Shape:SolidMolecular weight:4469.06Rhazimine
CAS:<p>Rhazimine is an indole alkaloid. It is a dual inhibitor of arachidonic acid metabolism and platelet activating factor-induced platelet aggregation.</p>Formula:C21H22N2O3Color and Shape:SolidMolecular weight:350.418MM 07
CAS:<p>Biased agonist for apelin/G protein pathway, enhances eNOS and cell growth, reduces apoptosis, improves heart function, and dilates vessels.</p>Formula:C67H106N22O14S3Purity:98%Color and Shape:SolidMolecular weight:1539.9M1145
CAS:<p>Potent GAL2 agonist with EC50 = 38 nM; Ki: 6.55 nM (GAL2), 497 nM (GAL3), 587 nM (GAL1); enhances galanin signaling.</p>Formula:C128H205N37O32Purity:98%Color and Shape:SolidMolecular weight:2774.2615(S)-HpEPE
CAS:<p>15(S)-HpEPE, a monohydroperoxy fatty acid, forms when 15-lipoxygenase acts on EPA, with expected biological activities akin to 15(S)-HpETE.</p>Formula:C20H30O4Color and Shape:SolidMolecular weight:334.456CAY10606
CAS:<p>CAY10606 has a wide range of applications in life science related research.</p>Formula:C22H18ClNO3Color and Shape:SolidMolecular weight:379.84Adrenomedullin (AM) (22-52), human TFA
<p>Adrenomedullin (AM) human (22-52) is a truncated NH2 TFA-modified adrenal medullary receptor antagonist.</p>Formula:C161H253N46F3O50Purity:98%Color and Shape:SolidMolecular weight:3690.06Israpafant
CAS:<p>Israpafant: PAF receptor blocker, IC50 0.84nM, hinders platelet aggregation, eosinophil activation, boosts calcium transit, anti-nephrotoxic.</p>Formula:C28H29ClN4SColor and Shape:SolidMolecular weight:489.07Pasireotide pamoate
CAS:Pasireotide pamoate is a stable cyclohexapeptide somatostatin mimic. Pasireotide pamoate exhibits antisecretory, antiproliferative, and proapoptotic activity.Formula:C81H82N10O15Purity:98%Color and Shape:SolidMolecular weight:1435.58Neurokinin B (TFA)
CAS:<p>Neurokinin B TFA, a tachykinin, targets NK1R, NK2R, nk3r GPCRs, modulating effects.</p>Formula:C59H81F6N13O18S2Purity:98%Color and Shape:SolidMolecular weight:1438.47BAY-747
CAS:<p>BAY-747: oral, brain-penetrant sGC stimulator; improves rat memory, cognition, lowers blood pressure, aids Duchenne muscular dystrophy.</p>Formula:C22H26F2N4O2Color and Shape:SolidMolecular weight:416.46PACAP (1-27), human, ovine, rat
CAS:PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats.Formula:C142H224N40O39SPurity:98%Color and Shape:SolidMolecular weight:3147.66Labradimil
CAS:<p>Labradimil, a bradykinin B2 agonist, boosts brain drug delivery and tumor survival rates.</p>Formula:C49H75N15O12SPurity:98%Color and Shape:SolidMolecular weight:1098.29Kisspeptin 13
CAS:<p>Kisspeptin 13 activates GPR54 & GnRH receptors, boosts memory, and aids in Alzheimer's research.</p>Formula:C78H107N21O18Color and Shape:SolidMolecular weight:1626.81MRS2500 tetraammonium
CAS:<p>Highly potent and selective antagonist of the platelet P2Y1 receptor</p>Formula:C13H21IN6O8P2Purity:98%Color and Shape:SolidMolecular weight:578.19ECPLA
CAS:<p>ECPLA is an LSD analog and a potent 5-HT2A agonist (EC50 of 14.6 nM), capable of stimulating Gq-mediated calcium flux. It exhibits high affinity for most serotonin receptors, α2-adrenergic receptors, and D2-like dopamine receptors.</p>Formula:C21H25N3OColor and Shape:SolidMolecular weight:335.44Upidosin
CAS:<p>Upidosin (SB-216469), a uroselective α1 blocker: Ki α1a=0.34 nM, α1b=3.9 nM, α1d=1.5 nM, α2=33.3 nM.</p>Formula:C31H33N3O4Purity:99.66%Color and Shape:SolidMolecular weight:511.61YFLLRNP
CAS:<p>YFLLRNP is a biologically active peptide functioning as a partial agonist of PAR-1, selectively activating the G12/13 signaling pathway.</p>Formula:C45H67N11O10Color and Shape:SolidMolecular weight:922.08Orexin A (human, rat, mouse)
CAS:Orexin A, a 33 AA neuropeptide in humans, rats, mice, influences various processes, studied in pancreatic function and as an OX1R antagonist.Formula:C152H243N47O44S4Purity:98%Color and Shape:SolidMolecular weight:3561.1PEN (rat)
CAS:<p>PEN (rat) is an Endogenous peptide GPR83 agonist. ProSAAS-derived neuropeptide.</p>Formula:C102H169N27O33Purity:98%Color and Shape:SolidMolecular weight:2301.62A3AR modulator 1
<p>MRS8054 is an oral A3 adenosine receptor positive allosteric modulator, enhancing Cl-IB-MECA-induced activity.</p>Formula:C23H25IN4Color and Shape:SolidMolecular weight:484.38TRAP-6 amide TFA
CAS:<p>TRAP-6 amide TFA is a PAR-1 thrombin receptor agonist peptide.</p>Formula:C36H58F3N11O10Color and Shape:SolidMolecular weight:861.922LysoPalloT-NH-amide-C3-ph-m-O-C11
CAS:<p>LysoPalloT-NH-amide-C3-ph-m-O-C11 is an agonist of the GPR174 receptor with an EC50 value of 34 nM.</p>Formula:C27H47N2O9PColor and Shape:SolidMolecular weight:574.64Motilin, canine
CAS:<p>Motilin canine, a 22-amino acid peptide, functions as a robust gastrointestinal smooth muscle contraction agonist.</p>Formula:C120H194N36O34Purity:98%Color and Shape:SolidMolecular weight:2685.05Tocrifluor T1117
CAS:<p>Fluorescent form of AM 251, CB1 receptor antagonist</p>Formula:C56H53Cl2N7O5Purity:98%Color and Shape:SolidMolecular weight:974.97GIP/GLP-1 dual receptor agonist-1
CAS:<p>Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.</p>Color and Shape:SolidNeuropeptide Y (13-36), amide, human
CAS:<p>Neuropeptide Y (13-36), amide, human is a neuropeptide Y receptor agonist.</p>Formula:C134H207N41O36SPurity:98%Color and Shape:SolidMolecular weight:3000.4ALEPH hydrochloride
CAS:<p>ALEPH (hydrochloride) acts as a partial agonist of h5-HT2A and h5-HT2B receptors, with EC50 values of 10.3 nM and 19.2 nM, respectively. It can induce head twitch responses in mice, with an ED50 of 0.80 mg/kg.</p>Formula:C12H20ClNO2SColor and Shape:SolidMolecular weight:277.81Icatibant
CAS:<p>Icatibant is a selective and specific antagonist of the bradykinin B2 receptor (IC50 and Ki: 1.07 nM and 0.798 nM respectively).</p>Formula:C59H89N19O13SPurity:98%Color and Shape:White SolidMolecular weight:1304.52Neuropeptide Y (22-36)
CAS:<p>Neuropeptide Y (22-36) is a 15-amino acid fragment of NPY, which is abundant in the mammalian brain and involved in multiple physiological functions.</p>Formula:C85H139N29O21Purity:98%Color and Shape:SolidMolecular weight:1903.19VU0453379 hydrochloride
<p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>Formula:C26H35ClN4O2Color and Shape:SolidMolecular weight:471.03PF-4348235 HCl
<p>PF-4348235 HCl (β2AR/M-receptor agonist-2 HCl) is a muscarinic M3 receptor antagonist (Ki: 0.73 nM) and β2 adrenergic receptor agonist (MABA, EC50: 3.7 nM). PF-4348235 HCl is also a bronchial BM213 acetate is a bronchodilator used to study cardiovascular and respiratory diseases such as chronic obstructive pulmonary disease (COPD).</p>Formula:C36H50Cl2N4O7SPurity:98.81%Color and Shape:SolidMolecular weight:753.78α-Helical CRF(9-41)
CAS:<p>Corticotropin-releasing factor receptor antagonist (Ki values are 17, 5 and 0.97 at human CRF1, rat CRF2α and mouse CRF2β receptors respectively).</p>Formula:C166H274N46O53S2Purity:98%Color and Shape:SolidMolecular weight:3827Peptide C105Y TFA
Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.Formula:C97H148N20O23S·xC2HF3O2L-770644
CAS:<p>L-770644 is an agonist of B3 adrenergic receptor.</p>Formula:C30H37N7O4SColor and Shape:SolidMolecular weight:591.72ACTH (1-17)
CAS:<p>ACTH (1-17), a potent MC1 receptor agonist with a Ki of 0.21 nM, is a variant of corticotropin from the pituitary gland.</p>Formula:C95H145N29O23SPurity:98%Color and Shape:SolidMolecular weight:2093.41MCUF-651
CAS:<p>MCUF-651 is a guanylyl cyclase A receptor positive allosteric modulators, EC50=0.45 μM.</p>Formula:C17H22F2N4OSPurity:99.83%Color and Shape:SoildMolecular weight:368.44Myristoylated ARF6 (2-13)
<p>Myristoylated ARF6 (2-13) inhibits the MyD88–ARNO–ARF6 signaling axis by inactivating ARF6.</p>Formula:C74H128N16O18Molecular weight:1528.95925SGLT1/2-IN-2
CAS:<p>SGLT1/2-IN-2 is a chemical compound with robust dual inhibitory properties, exhibiting potent activities against SGLT1 (IC50 = 96 nM) and SGLT2 (IC50 = 1.3 nM).</p>Formula:C23H26F2O7Color and Shape:SolidMolecular weight:452.451MK-0493 HCl
CAS:<p>MK-0493 is a novel, potent, and selective agonist for melanocortin receptor 4 (MC4R).</p>Formula:C30H39Cl2F2N3O2Color and Shape:SolidMolecular weight:582.55Carazolol-d7
CAS:Carazolol-d7 is the deuterium-labeled isotope of Carazolol, commonly used in pharmacokinetic studies to investigate the metabolic pathways of Carazolol.Formula:C18H22N2O2Color and Shape:SolidMolecular weight:305.42Leukotriene B5
CAS:<p>LTB5, an eicosapentaenoic acid metabolite via 5-LO, has varied bioactivities and enhances bullfrog lung strip contraction.</p>Formula:C20H30O4Color and Shape:SolidMolecular weight:334.456Hemopressin(rat)
CAS:<p>Peptide inhibitor for ep24.15, neurolysin & ACE with Ki 27.76, 3.43, 1.87 μM. Lowers blood pressure, modulates CB1 receptor, reduces pain & food intake.</p>Formula:C53H77N13O12Purity:98%Color and Shape:SolidMolecular weight:1088.27Osanetant
CAS:Osanetant produces anxiolytic- and antidepressant-like effects. Osanetant is a selective NK3 receptor antagonist. It is researched for schizophrenia.Formula:C35H41Cl2N3O2Purity:98%Color and Shape:SolidMolecular weight:606.62Neuromedin N
CAS:<p>Neuromedin N is a neuropeptide derived from the same precursor polypeptide as neurotensin, and with similar but subtly distinct expression and effects.</p>Formula:C38H63N7O8Purity:98%Color and Shape:SolidMolecular weight:745.95Antidepressant agent 4
<p>Antidepressant agent 4: orally active, has antidepressant, anxiolytic, and nootropic effects.</p>Formula:C19H38ClN5O2SColor and Shape:SolidMolecular weight:436.06MMC(TMZ)-TOC TFA
<p>MMC(TMZ)-TOC TFA exhibits high binding affinity and selectivity for the somatostatin receptor subtype 2 (SSTR2). It targets the delivery of TMZ to SSTR2-positive tumor cells, making MMC(TMZ)-TOC TFA useful for cancer research.</p>Formula:C74H99F3N20O21S2Color and Shape:SolidMolecular weight:1725.82NI-203
<p>NI-203 is a monoclonal antibody inhibitor that targets amylin and shows potential for research in type 2 diabetes.</p>Color and Shape:Odour LiquidAntisauvagine-30 TFA
<p>aSvg-30 TFA: potent CRF2 receptor antagonist, Kd 1.4 nM (mCRFR2β), 150 nM (CRFR1).</p>Formula:C163H275N48F3O49SColor and Shape:SolidMolecular weight:3764.28Nolomirole
CAS:<p>Nolomirole is a dopamine receptor agonist that reduces symptoms of congestive heart failure caused by monoclinine.</p>Formula:C19H27NO4Color and Shape:SolidMolecular weight:333.42Antipsychotic agent-2
<p>Compound 11: potent antipsychotic, binds 5-HT1A/2A/2C, D2, H1 receptors; K is 56.6-1140 nM, BBB permeable.</p>Formula:C22H26FN5OColor and Shape:SolidMolecular weight:395.47Paynantheine
CAS:<p>Paynantheine is an alkaloid with antinociceptive properties, found in Mitragyna speciosa. It also acts as an agonist at 5-HT1AR and 5-HT2BR receptors, inducing lower lip contraction and providing antinociception in rats.</p>Formula:C23H28N2O4Color and Shape:SolidMolecular weight:396.48FSLLRY-NH2
CAS:<p>PAR2 antagonist; counters taxol effects, PKC in mice; inhibits ERK, collagen in fibroblasts; lessens dermatophyte itch in mice.</p>Formula:C39H60N10O8Purity:98%Color and Shape:SolidMolecular weight:796.97L-803087 TFA
CAS:<p>L-803087 TFA: potent sst4 agonist, Ki=0.7 nM, >280x selective vs other somatostatin receptors; boosts AMPA, heightens seizures.</p>Formula:C27H30F5N5O5Color and Shape:SolidMolecular weight:599.55[Sar9] Substance P
CAS:<p>[Sar9]-Substance P is one of NK-1 receptor agonist. The action of SP on progesterone metabolism was mimicked by the rNK1-specific agonist [Sar-9,Met(O2)11]-SP.</p>Formula:C64H100N18O13SPurity:98%Color and Shape:SolidMolecular weight:1361.66Adrogolide HCl
CAS:Adrogolide Hydrochloride is a selective dopamine receptor D1 agonist.Formula:C22H26ClNO4SColor and Shape:SolidMolecular weight:435.96[D-Trp34]-Neuropeptide Y
CAS:<p>Potent NPY Y5 receptor agonist (pEC50 = 7.82); highly selective; induces hyperphagia, body weight gain; orally active.</p>Formula:C196H289N55O56Purity:98%Color and Shape:SolidMolecular weight:4311.77GW-328267
CAS:<p>GW-328267 is an agonist of the adenosine A2 receptor.</p>Formula:C21H26N10O4Color and Shape:SolidMolecular weight:482.5

